0$&+,1(86(5·60$18$/

1&3DQHO6L]LQJ&HQWUH
(%

L5801L0015 ENGLISH
Issue.Revision: 1.0
Serial number

1859/99
 ,QIRUPDWLRQRQWKLVSXEOLFDWLRQ

,QIRUPDWLRQRQWKLVSXEOLFDWLRQ

&RGH ,VVXH 5HYLVLRQ Approval number

L5801L0015 1 0 (11, 2001) SE01/0009

/LVWRI&KDQJHV
Revision: Addition §: Deletions §: Changes §:
0 New Document

This manual has been prepared for use by clients only and it contains information protected by
copyright. It must not be photocopied or reproduced in any form, either fully or in part, without the
prior written consent of BIESSE. The manual is supplied together with the machine, and must be
kept in a safe place in order to have it always to hand for consultation.

The manual must only be used by personnel who have been adequately trained to operate the
machine. BIESSE cannot be considered responsible or liable for damage resulting from incorrect
or improper use of the documentation provided. In order to avoid incorrect manoeuvres that might
result in danger to the operator or to third parties, it is essential to read and fully understand all the
documentation supplied with the machine.

BIESSE S.p.A. Woodworking Machinery

(l5801l0015.fm-141101)

,QIRUPDWLRQRQWKLVSXEOLFDWLRQ

 BIESSE S.p.A. Woodworking Machinery

(l5801l0015.fm-141101)
 7DEOHRIFRQWHQWV

7DEOHRIFRQWHQWV

,QWURGXFWLRQ
Field of Application and Limits of the Manual . . . . . . . . 
Documents Supplied with the Machine . . . . . . . . . . . . . 
Warning Signs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
Warnings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Part 1 - Description

&KDSWHU 0DLQ3DUWVDQG)RUHVHHQ8VHV
1.1 General Description of the Machine . . . . . . . . . . . . . . . . . . 
1.2 General View and Main Parts . . . . . . . . . . . . . . . . . . . . . . . 
Operating Section . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
1.3 Safety Devices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
1.4 Foreseen Use . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
Piece Characteristics and Dimensions . . . . . . . . . . . . . 
Possible Machining . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
1.5 Work Area . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
1.6 Danger Areas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

&KDSWHU 2SWLRQDOV
2.1 Rear Collet Stop for Pieces With Projecting Facings . . . . . 
2.2 Scoring Blade for Postformed Pieces . . . . . . . . . . . . . . . . . 
2.3 Cutting Area Laser . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
2.4 Grooving Device . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
2.5 Air Jet Panel Supports . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
2.6 Right-hand Side Machine . . . . . . . . . . . . . . . . . . . . . . . . . . 
2.7 Stop for Cuts of Variable Angular Direction (analog) . . . . . 
2.8 Stop for Cuts of Variable Angular Direction (digital) . . . . . . 
2.9 Regulator of the Side Pusher Stroke . . . . . . . . . . . . . . . . . 
2.10 Side Pusher with Front Roller . . . . . . . . . . . . . . . . . . . . . . . 
2.11 Electronic Regulator for Scoring Blade . . . . . . . . . . . . . . . . 
2.12 Pneumatic Unlocking Device for Blades . . . . . . . . . . . . . . . 
2.13 Regulator of the Presser and Cutting Blade Stroke . . . . . . 
2.14 Regulator of the Operating Section Stroke . . . . . . . . . . . . . 

&KDSWHU &RQWUROVDQG6LJQDOOLQJ'HYLFHV
3.1 Layout of the Controls and Signalling Devices . . . . . . . . . . 
3.2 Main Button Pad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
3.3 PLC Keyboard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

BIESSE S.p.A. Woodworking Machinery

(l5801l0015TOC.fm-141101)

7DEOHRIFRQWHQWV

&KDSWHU %DVLF&RQFHSWV
4.1 Axes and Origins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
4.2 Manual Axes Movement . . . . . . . . . . . . . . . . . . . . . . . . . . . 
4.3 Axes Movement Speed Variation . . . . . . . . . . . . . . . . . . . . 
4.4 Identification of Main Operating Areas . . . . . . . . . . . . . . . . 
4.5 Machine Operation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
4.6 Cutting Patterns. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Part 2 - Uses

&KDSWHU %DVLF8VHV
5.1 Start-up . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
5.2 Stop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
5.3 Restart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
5.4 Switching Off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

&KDSWHU 0DFKLQLQJ
6.1 Machining Modes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
Making an Immediate Cut . . . . . . . . . . . . . . . . . . . . . . . 
Making an Immediate Cut Using Fast Programming . . . 
Making Cuts in Sequence Using Fast Programming . . . 
Using a Cutting Pattern . . . . . . . . . . . . . . . . . . . . . . . . . 
Using a Series of Cutting Patterns . . . . . . . . . . . . . . . . . 
Making Cuts for Square-shaped Openings (optional) . . 
Groove Execution . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
6.2 Machining Hold . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
6.3 Piece Loading . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Part 3 - Operations

&KDSWHU 0DLQWHQDQFH
7.1 Maintenance Intervention Summary and Frequency. . . . . . 
7.2 General Cleaning of the Machine . . . . . . . . . . . . . . . . . . . . 
7.3 Draining Condensate from the FR Unit . . . . . . . . . . . . . . . . 
7.4 Cleaning the Filters of the Control Panel. . . . . . . . . . . . . . . 
7.5 Cleaning the Electrical Cabinet Filter . . . . . . . . . . . . . . . . . 
7.6 Cleaning the Air Conditioner on the Electrical Cabinet . . . . 
7.7 Lubricants . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

&KDSWHU 5HSODFHPHQWVDQG$GMXVWPHQWV
8.1 Blades Replacement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
Disassembling the Blade Locking Flange . . . . . . . . . . . 
Assembling the Blade Locking Flange . . . . . . . . . . . . . . 
8.2 Blade Belt Replacement . . . . . . . . . . . . . . . . . . . . . . . . . . . 
Measuring the Blade Belts Tension . . . . . . . . . . . . . . . . 
8.3 Scoring Blade Adjustment . . . . . . . . . . . . . . . . . . . . . . . . . . 
8.4 Pneumatic System Pressure Regulators. . . . . . . . . . . . . . . 
Pressure Adjustment . . . . . . . . . . . . . . . . . . . . . . . . . . . 

 BIESSE S.p.A. Woodworking Machinery

(l5801l0015TOC.fm-141101)
 7DEOHRIFRQWHQWV

Appendices

$SSHQGL[$ 6DIHW\LQIRUPDWLRQ
A.1 Transport and moving . . . . . . . . . . . . . . . . . . . . . . . . . . . . $
A.2 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $
A.3 Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $
A.4 Preparation and machining . . . . . . . . . . . . . . . . . . . . . . . . . $
A.5 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $
A.6 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $

$SSHQGL[% 7HFKQLFDO&KDUDFWHULVWLFV
B.1 General Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . %
B.2 Blades . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . %
B.3 Noise Level . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . %
B.4 Dust Emission . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . %

$SSHQGL[& 7UDQVSRUWDQG,QVWDOODWLRQ
C.1 Machine Parts To Be Transported . . . . . . . . . . . . . . . . . . . &
C.2 Unloading the Machine . . . . . . . . . . . . . . . . . . . . . . . . . . . . &
Lifting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . &
C.3 Shifting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . &
C.4 Machine Configuration, Connection Points, and Overall Dimensions
&
C.5 Installation Area Requirements. . . . . . . . . . . . . . . . . . . . . . &
Electric System Requirements. . . . . . . . . . . . . . . . . . . . &
Pneumatic System Requirements . . . . . . . . . . . . . . . . . &
Suction System Requirements. . . . . . . . . . . . . . . . . . . . &

$SSHQGL[' 'HFRPPLVVLRQLQJ'HPROLWLRQ

$SSHQGL[( *XDUDQWHHDQGFOLHQWVHUYLFLQJ
E.1 Conditions of the guarantee . . . . . . . . . . . . . . . . . . . . . . . . (
E.2 Client servicing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (

$QDO\WLFDO,QGH[

BIESSE S.p.A. Woodworking Machinery

(l5801l0015TOC.fm-141101)

7DEOHRIFRQWHQWV

 BIESSE S.p.A. Woodworking Machinery

(l5801l0015TOC.fm-141101)
 ,QWURGXFWLRQ

,QWURGXFWLRQ

)LHOGRI$SSOLFDWLRQDQG/LPLWVRIWKH0DQXDO

This manual is aimed at users of the machine for which it provides basic information that the user
must know before starting to use the machine. It also contains information on the maintenance of
the machine necessary to ensure that it remains efficient and safe over time. In order to use the
machine properly, the Software user’s manual and Enclosures must also be consulted.

'RFXPHQWV6XSSOLHGZLWKWKH0DFKLQH

6RIWZDUH8VHU¶V0DQXDO. Contains information on the typical operations and procedures to follow

in order to produce the programs that can be carried out with the software connected to the
machine.

6SDUH3DUWV&DWDORJXH. This is used to order components that must be replaced, following the
instructions given in the introduction to the manual.

&LUFXLWGLDJUDPV. These describe the main plants of the machine (electric, pneumatic, etc.) and
are provided for the technician responsible for solving problems. This technician must be expert
and competent in his job.

(QFORVXUHV. These contain information on any special parts of the machine. In order not to miss
any important information, each Enclosure must be consulted together with the document to which
it refers.

:DUQLQJ6LJQV

Paragraphs that should not be overlooked are highlighted and preceded by the symbols described
and illustrated below:

'$1*(5
3DUDJUDSKVPDUNHGZLWKWKLVV\PEROLQGLFDWHDQLPPLQHQWGDQJHUDQGWKHFRQWHQWVPXVW
WKHUHIRUHEHWDNHQLQWRFDUHIXODFFRXQWLQRUGHUWRSUHYHQWDVHULRXVDFFLGHQW

&$87,21
3DUDJUDSKVPDUNHGZLWKWKLVV\PEROLQGLFDWHSURFHGXUHVWREHXVHGDQGDFWLRQVWREH
WDNHQWRDYRLGDQ\GDPDJHWRJRRGVDQGSURSHUW\

BIESSE S.p.A. Woodworking Machinery

(a101h005.fm-141101)

,QWURGXFWLRQ

,1)250$7,21
7KLVV\PEROLVXVHGWRLQGLFDWHSRLQWVRISDUWLFXODULPSRUWDQFHWKDWPXVWQRWEHRYHUORRNHG

:DUQLQJV

The safety information provided in the appendix to this manual must be read before using the
machine.

 BIESSE S.p.A. Woodworking Machinery

(a101h005.fm-141101)
 3DUW'HVFULSWLRQ

BIESSE S.p.A. Woodworking Machinery

(a302h002.fm-141101)
BIESSE S.p.A. Woodworking Machinery
(a302h002.fm-141101)
&KDSWHU 0DLQ3DUWVDQG)RUHVHHQ8VHV

In this chapter the main parts of the machine basic configuration are described and information is
given on the foreseen uses of the machine. Information concerning the optionals is found in the
following chapters.

 *HQHUDO'HVFULSWLRQRIWKH0DFKLQH

This machine is a NC panel sizing centre with a single cutting line. More information on possible
machining, loading methods and piece characteristics is described in the paragraph 1.4
“Foreseen Use” on pages 1 - 6.

On the following paragraph a general plan view of the machine is shown and its main parts are
identified and described.

As a general rule, the machine is fitted for piece loading on its left-hand side (left-hand side
machine). However, should there be particular requirements, the customer may request a machine
fitted for piece loading on the right-hand side (right-hand side machine). For any further
information, please see paragraph 2.6 “Right-hand Side Machine” on page 2 - 2.

,1)250$7,21
3OHDVHQRWHWKDWLQWKLVPDQXDODVDJHQHUDOUXOHWKHLOOXVWUDWHGPDFKLQHLVWKHOHIWKDQGVLGH
PDFKLQH

BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)

&KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

 *HQHUDO9LHZDQG0DLQ3DUWV

*
+
-

%
(

'
&
/

$ . 0

$ %DVH; this is the machine’s bearing structure.

% 3DQHO6XSSRUW; this is used to support the piece during the loading and unloading phases.

& 2SHUDWLQJ6HFWLRQ; this is used to cut the piece. For further details, please go to the
paragraph “Operating Section” on page 1 - 4.

'- &RQWURO3DQHO; this is used to control the machine’s operation. For more information, see
Chapter 3. “Controls and Signalling Devices”.

( 6LGH6WRS; this is the reference point for the right- or left-hand side of the piece, according to
the position of the stop itself.

) 5HDU&ROOHW6WRS RU3XVKLQJ'HYLFH : this is the reference point for the rear side of the
piece. The stop is also equipped with a collet that locks the piece in order to prevent it from
losing its point of reference during movement.

* :KHHO3DQHO6XSSRUW: this supports the piece, allowing it to slide easily.

+ 3UHVVHU: this presses down on the upper side of the piece.

- 6LGH3XVKHU this pushes the piece to bring it up against the stops.

 BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)
 &KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

. (OHFWULFDO&DELQHW: this contains the main electric and electronic equipment.

/ )58QLW ILOWHUUHJXODWRU ; this filters the compressed air used by the machine and it
maintains the pressure at a constant level.

0 0DFKLQHDQG0DQXIDFWXUHU¶V
D
,GHQWLILFDWLRQ3ODWHV; these contain the
following information:
D - mark CE (only for the machines
destined for the European market and for
those Countries which apply the directive
89/392 EEC and subsequent modifications)
E - logo
F - address
G - model
H - serial number
I - year of construction E
J - power supply voltage
K - frequency F H
L - number of power supply phases G I
P - installed power
Q - electrical power input
R - weight of the machine

J K L P Q R

BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)

&KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

2SHUDWLQJ6HFWLRQ

&

$- %ODGH&DUULDJH: this supports and drives the scoring and cutting blades.

%- 6FRULQJ%ODGH: this scores the lower side of the piece in order to obtain cuts with a better
finish.

&- &XWWLQJ%ODGH: this cuts the piece.

 BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)
 &KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

 6DIHW\'HYLFHV

As well as various casings, covers, and other equipment fitted for the safety of the operator, which
are situated in different points, the machine is provided with safety devices as follows:

&

' $

$ (PHUJHQF\%XWWRQ; this is located in the main control panel as well as in other locations
close to the control panel and it is used to shut down the machine immediately. For further
information, please see Chapter 3. “Controls and Signalling Devices”.

% &XWRXW9DOYH; this is used to perform maintenance or repairs on the machine in safety

conditions and it may be locked in order to avoid any possible tampering from unauthorized
personnel. This valve is operated by turning anticlockwise the orange-coloured knob, thus
allowing for the discharge of the pneumatic system and for the shutdown of the air flow from
the general supply system. To reset the machine and put it into operation, press and turn
clockwise the same knob.

& 6DIHW\&XUWDLQ: this prevents hands from entering the cutting areas during machining.

' 6DIHW\%DU: this protects the operator from the risk of being crushed by the presser and is
equipped with interlock microswitches.

( 2SHUDWLQJ6HFWLRQ$FFHVV'RRU: this is a mobile guard equipped with interlock

microswitches with lock to allow risk-free access to the operating section.

BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)

&KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

 )RUHVHHQ8VH

The machine is a numerical control panel sizing centre with one cutting line for pieces with the
characteristics and dimensions as indicated in the paragraph “Piece Characteristics and
Dimensions”. This machine may be operated by one person only. The operator may be assisted by
another person for the stages of piece loading and unloading.

3LHFH&KDUDFWHULVWLFVDQG'LPHQVLRQV

It is possible to machine solid wood, fibre boards, chip boards, plywoods, and MDF (medium
density fibre boards) with the following dimensions:

/HQJWKDQG:LGWK

The machine is equipped, according to the

requirements of the customer, to machine one of
the maximum dimensions given here below:

n 3200 x 3100 mm

n 4400 x 4250 mm

0DFKLQDEOH+HLJKWRIWKH3LOHRI3LHFHV

In order to obtain a “rough cut” of an acceptable

quality, the maximum height of the pile of pieces
being machined must be such as that the teeth
may come out of the pieces. It is therefore
recommended to use the following value:

n EB 70 = 80 mm

Nevertheless, should a “finished cut” be required, it is not possible to define exactly the maximum
height of the pile of pieces being machined, since this measurement depends upon the surface
type of the pieces, on their calibration, on the quality and composition of the material, the type of
tool used, and on tool wear and tear.

 BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)
 &KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

3RVVLEOH0DFKLQLQJ

The following is an illustrated description of the types of machining that are possible with the
machine:

$ % & '

$ - Single or multiple rip cuts with the same or different measurements.

% - Single or multiple cross cuts with the same or different measurements.

& - Grooving (optional).

' - Square-shaped Openings (optional).

BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)

&KDSWHU
0DLQ3DUWVDQG)RUHVHHQ8VHV

 :RUN$UHD

The areas in which the operator must remain for the normal operation of the machine are as
follows:

$ - In front of the control panel to enable the controls and to use the numerical control.

% - In the proximity of the air jet panel supports in order to load or unload pieces.

The work area/s to be occupied during the different interventions on the machine (preparation,
maintenance, adjustment, ...) are specified throughout the manual.

 'DQJHU$UHDV

All of the danger areas of the machine, while it is in operation, are protected by suitable safety
devices and are therefore inaccessible.

 BIESSE S.p.A. Woodworking Machinery

(l127h024.fm-141101)
&KDSWHU 2SWLRQDOV

This chapter gives a brief description of all the optionals foreseen for the machine.

 5HDU&ROOHW6WRSIRU3LHFHV:LWK3URMHFWLQJ)DFLQJV

This type of stop is fitted in place of the stop

fitted on the basic version of the machine. It
allows the exact reference point of pieces with
projecting facings to be obtained.

pieces with projecting rear collet stop

facings

 6FRULQJ%ODGHIRU3RVWIRUPHG3LHFHV

This is a scoring blade with a larger diameter than that of the scoring blade fitted to the basic
version of the machine. This blade obtains a better cut when machining postformed pieces.

 &XWWLQJ$UHD/DVHU

This is a device that projects a laser ray along the cutting line in order to check the exact point in
which the piece will be cut. This device is usually used to make oblique cuts without using the
stops.

BIESSE S.p.A. Woodworking Machinery

(l128h025.fm-141101)

&KDSWHU
2SWLRQDOV

 *URRYLQJ'HYLFH

This device allows the vertical cutting blade stroke to be set in such a way that grooves can be
made. This device can be equipped to be manually or automatically adjusted.

 $LU-HW3DQHO6XSSRUWV

T hese are installed in place of the piece

supports planned for the basic version. Besides
supporting the pieces, they permit - through an
air flow coming from a special ventilating fan - to
handle the pieces in an easier way.

 5LJKWKDQG6LGH0DFKLQH

In general, the machine is fitted for piece loading on its left-hand side (left-hand side machine).
However, for particular requirements, the customer may request a machine fitted for piece loading
on the right-hand side (right-hand side machine). The different types of machines differ one from
the other only for the layout of some parts (stops, piece supports, control panel and electrical
cabinet).

left-hand side machine right-hand side machine

 BIESSE S.p.A. Woodworking Machinery

(l128h025.fm-141101)
 &KDSWHU
2SWLRQDOV

 6WRSIRU&XWVRI9DULDEOH$QJXODU'LUHFWLRQ DQDORJ

This device allows the piece to be placed in different angular positions with regard to the cutting
direction. In order to read the angular direction degree, this device is equipped with a vernier and a
vernier scale.

 6WRSIRU&XWVRI9DULDEOH$QJXODU'LUHFWLRQ GLJLWDO

This device allows the piece to be placed in different angular positions with regard to the cutting
direction. In order to read the angular direction degree, this device is equipped with a digital
instrument.

 5HJXODWRURIWKH6LGH3XVKHU6WURNH

This is a device which permits - through an automatic control - to position the side pusher
according to the piece width, in order to decrease the working cycle times.

 6LGH3XVKHUZLWK)URQW5ROOHU

This system allows the side pusher to operate also during the execution of rear double edge trim
cuts, in order to assure that the piece is perfectly aligned with the square fence.

 (OHFWURQLF5HJXODWRUIRU6FRULQJ%ODGH

This device is used to adjust the scoring blade using the numerical control software. For further
information see the paragraph 8.3 “Scoring Blade Adjustment” on page 8 - 8.

 3QHXPDWLF8QORFNLQJ'HYLFHIRU%ODGHV

The blade spindle may be equipped with a pneumatic device permitting a faster unlocking of the
blades.

BIESSE S.p.A. Woodworking Machinery

(l128h025.fm-141101)

&KDSWHU
2SWLRQDOV

 5HJXODWRURIWKH3UHVVHUDQG&XWWLQJ%ODGH6WURNH

This device permits - through an automatic control - to position the cutting blade and the presser in
a vertical direction depending on the height of the pieces; and this in order to decrease the working
cycle times.

 5HJXODWRURIWKH2SHUDWLQJ6HFWLRQ6WURNH

This device permits, in case of immediate complete cuts, to position the blades depending on the
piece width; and this in order to decrease the working cycle times.

 BIESSE S.p.A. Woodworking Machinery

(l128h025.fm-141101)
&KDSWHU &RQWUROVDQG6LJQDOOLQJ'HYLFHV

This chapter contains descriptions of the controls and signalling devices of the machine. The
controls are grouped together in different areas of the machine. The first paragraph identifies these
areas as well as allowing the groups of controls concerned to be located. Each description is
usually preceded by a symbol to allow the identification of the control required.

,1)250$7,21
1RGLVWLQFWLRQLVPDGHEHWZHHQWKHVWDQGDUGPDFKLQHFRPPDQGVDQGFRPPDQGVDVVRFLDWHGZLWK
RSWLRQDOGHYLFHVRUIXQFWLRQV,WLVWKHUHIRUHSRVVLEOHWKDWVRPHFRPPDQGVPD\QRWEHSUHVHQWRQ
\RXUPDFKLQH

BIESSE S.p.A. Woodworking Machinery

(l103h036.fm-141101)

&KDSWHU
&RQWUROVDQG6LJQDOOLQJ'HYLFHV

 /D\RXWRIWKH&RQWUROVDQG6LJQDOOLQJ'HYLFHV

( $

) %
' )

&

$ 0DLQ6ZLWFK: this is used to supply and cut off electric power. The main switch may be
padlocked to prevent any tampering by unauthorised persons.
 = voltage cut off.
 = voltage supplied.

% &RQWURO3DQHO; this contains the main controls and allows the use, through the fitted monitor
and keyboard, of the NC300 numerical control software. For information on the software, see
the Software User’s Manual or the documents enclosed with the PC.

& 0DLQ%XWWRQ3DG; see page 3 - 3 for a description of the controls.

' 2YHUULGH; this is used to make percentage variations in the programmed movement speed of
the operating section.

( 3/& .H\ERDUG; see page 3 - 4 for a description of the controls.

) (PHUJHQF\6WRS%XWWRQ UHGPXVKURRPKHDGEXWWRQ : this is used to bring the machine to

an immediate stop. To disengage the button, turn it in the direction of the arrows.

 BIESSE S.p.A. Woodworking Machinery

(l103h036.fm-141101)
 &KDSWHU
&RQWUROVDQG6LJQDOOLQJ'HYLFHV

 0DLQ%XWWRQ3DG

The main button pad is equipped with a series of controls for the main machine operations.

%6WDUW%XWWRQ JUHHQ : this is used to enable the supply of electric power to the
moving machine organs.
/LW= function enabled.

%6WRS%XWWRQ EODFN : this is present when the machine is part of a line of

machines. DIfferently from the red mushroom button, which when pressed will stop
the entire line of machines, this button is used to stop this machine only.

%%ODGH6WDUW%XWWRQ ZKLWH : this is used to start the blades.

/LW= function enabled.

%%ODGH6WRS%XWWRQ EODFN : this is used to stop the blades. In addition, the

same button is also used to stop the working cycle.

0 1 %%ODGH&KDQJH6HOHFWRU NH\ : this is used to check and/or replace blades.

5LJKW = function enabled.

%:RUNLQJ&\FOH6WDUW%XWWRQ ZKLWH : this is used to start the working cycle.

/LW= function enabled.

%:RUNLQJ&\FOH6XVSHQVLRQ%XWWRQ EODFN : this is used to suspend working

cycles.

%3XVKLQJ'HYLFH6HOHFWRU \HOORZ : this is used to suspend pushing device

forward and back strokes.
5LJKW = function enabled.
/LW = indicates that the pushing device has suspended its movements and that the
blade access hatch is released.

0 1
%&XWWLQJ$UHD/DVHU6HOHFWRU EODFN : this is used to switch on the laser device
situated in the cutting area.
5LJKW= function enabled.

%&ROOHW3UHVVXUH6HOHFWRU EODFN : this is used to set the working pressure of

HI LO
the collets on the rear stops.
/HIW = high pressure.
5LJKW = low pressure.

BIESSE S.p.A. Woodworking Machinery

(l103h036.fm-141101)

&KDSWHU
&RQWUROVDQG6LJQDOOLQJ'HYLFHV

 3/&.H\ERDUG

This keyboard may be used to enable different functions. Each key controls a machine action only,
however, after the cycle start button has been pressed.

(5(6(7.H\: when held down for at least 3 seconds, this key serves to place all
7*8*9 mobile machine organs on standby. It has no effect if pressed while machining is in
progress.

(.H\IRU3LHFHVZLWK3URMHFWLQJ)DFLQJV this is used when machining pieces with

projecting facings and using the special stops.
/LW = function enabled.

($XWRPDWLF%ODGH3URMHFWLRQ.H\: this is used to optimise the blade projection

according to the thickness of the pieces to be machined. This function may be enabled
at any time, although if it is enabled while a cut is in progress, it will not be activated
until the next cut.
/LW = function enabled.

(.H\IRU6FRULQJZLWKWKH‘PP%ODGH: this is used for machining with the

scoring blade with a diameter of 200 mm.

/LW = function enabled.

(.H\IRU6FRULQJ3RVWIRUPHG3LHFHV: this is used to cut postformed pieces using

the scoring blade with a diameter of 300 mm. When this function is enabled this also
automatically enables the function described here below.
/LW = function enabled.

(.H\IRU6FRULQJZLWKWKH‘PP%ODGH: this is used for machining with the

scoring blade with a diameter of 300 mm.

/LW = function enabled.

(.H\IRU3LHFH6LGH3XVKLQJ this is used for pushing pieces sideways using the

relevant device. This function may be enabled at any time, although if it is enabled
while a cut is in progress, it will not be activated until the next cut.
/LW = function enabled.

(,PPHGLDWH&RPSOHWH&XW.H\ this is used to make an immediate cut of the same

length as that set in the relevant parameter of the numerical control software (see the
Software User’s Manual).
/LW = function enabled.

(9HQWLODWLQJ)DQ6WDUW.H\: this is used to start the ventilating fans on the air jet
panel supports.
/LW = function enabled.

(,PPHGLDWH/RQJ&XW.H\ this is used to make an immediate cut of the same

length as that set in the relevant parameter of the numerical control software (see the
Software User’s Manual).
/LW = function enabled.

 BIESSE S.p.A. Woodworking Machinery

(l103h036.fm-141101)
 &KDSWHU
&RQWUROVDQG6LJQDOOLQJ'HYLFHV

(5HDU&ROOHW6WRS.H\this is used to drive the collets on the rear stop. To avoid

the risk of crushing, the safety curtain will lower when collet clamping is enabled.

(,PPHGLDWH6KRUW&XW.H\ this is used to make an immediate cut of the same

length as that set in the relevant parameter of the numerical control software (see the
Software User’s Manual).
/LW = function enabled.

(-2*.H\: this is used to move an axis, selected using the numerical control
/4, software, in a negative direction.

(-2*.H\; this is used to move an axis, selected using the numerical control
/4, software, in a positive direction.

BIESSE S.p.A. Woodworking Machinery

(l103h036.fm-141101)

&KDSWHU
&RQWUROVDQG6LJQDOOLQJ'HYLFHV

 BIESSE S.p.A. Woodworking Machinery

(l103h036.fm-141101)
&KDSWHU %DVLF&RQFHSWV

This chapter contains different subjects that will assist in the initial learning process for machine
operation.

 $[HVDQG2ULJLQV

Any mobile element of the machine that requires its position to be controlled at all times is known
as an “axis”.

Usually axis movements are controlled by a device known as an encoder, which is positioned on
the motor that drives the axis. The encoder detects the revolutions of the motor and transmits this
information to the numerical control, where it is processed and displayed in the form of millimetres
or sexagesimal degrees. It is also possible that the movement of an axis does not occur using a
motor but instead, for example, through the action of pneumatic actuators. In this case, switches to
detect the axis limit switch position only will be present in place of the encoders.

To calculate the position of an axis, if it is equipped with a motor and encoder, it is necessary to
establish two points of reference: one fixed point, known as the “origin” (or zero point ), and
another, mobile point on the axis itself.

BIESSE S.p.A. Woodworking Machinery

(l104h044.fm-141101)

&KDSWHU
%DVLF&RQFHSWV

The following section contains a description of all of the axes present on the machine. The codes
used by the numerical control software to indicate each axis are also given. In addition, this section
also contains the different reference points and the positive () or negative () directions for those
axes equipped with motor and encoder.

0 $
- +
0
-
%
+

$ 386+,1*'(9,&(: horizontal movement of the pushing device carriage and the rear collet
stops. The reference points are as follows: the inner part of the cutting blade () and the rear
stop.

% &$55,$*(: horizontal movement of the blade carriage. The reference points are as follows:
the side stop () and the part of the cutting blade farthest from the side stop.

 0DQXDO$[HV0RYHPHQW

During tooling or use of the machine, it may be useful or, in some cases, indispensable, to move
an axis. This operation can be carried out after switching on the machine, by using the JOG keys
on the PLC keyboard or the special page (JOG AXES) of the numerical control software. To open
and use the page for manual axes movement, see the Software User’s Manual.

 BIESSE S.p.A. Woodworking Machinery

(l104h044.fm-141101)
 &KDSWHU
%DVLF&RQFHSWV

 $[HV0RYHPHQW6SHHG9DULDWLRQ

Axis movement speed variation, which may only be used for the CARRIAGE axis, is usually
carried out when testing a program. This is done to establish the most suitable speed for the
material to be machined, or to be able to observe axis movements better during particularly critical
points of the program. Speed is varied by manually turning the override control. The percentage
speed variation is displayed in a special field by the numerical control software.

 ,GHQWLILFDWLRQRI0DLQ2SHUDWLQJ$UHDV

This section identifies the areas in which the main machining stages are carried out and is aimed
at simplifying the location of the machine parts or devices that are mentioned in this manual..

$ & %

$ /RDGLQJDQG8QORDGLQJ$UHD : the area in which the material for machining is loaded and
unloaded.

% 0RYHPHQW$UHD: the area in which the pieces are positioned for cutting.

& &XWWLQJ$UHD: the area in which the cutting operations are executed.

BIESSE S.p.A. Woodworking Machinery

(l104h044.fm-141101)

&KDSWHU
%DVLF&RQFHSWV

 0DFKLQH2SHUDWLRQ

The following section illustrates and describes the

main operations that the machine normally
executes after machining has been started. .

 - Clamping and moving back of the pieces.

 - Pieces forward feed to the cutting area.

 - Side alignment.

 - Presser downstroke.

 - Execution of cuts.

 - Outfeed of the sized pieces.

 



 &XWWLQJ3DWWHUQV

A cutting pattern consists of a series of rip and cross cuts that are defined using the PATTERN
EDITOR page of the numerical control software (to open this page press F4 from the main menu).
The following are a few examples of cutting patterns that can be used with the machine:

$ - Logic Cutting Pattern

% - 2-Type Differentiated Cutting Pattern '

$
& - 3-Type Differentiated Cutting Pattern

' - Cutting Pattern with Logic Head Cut

(
%
( - Cutting Pattern with Differentiated Head Cut

) - Logic Cutting Pattern with Third-phase Cut (Z

Cut). )
&

For more information about how to program cutting patterns, see the Software User’s Manual.

 BIESSE S.p.A. Woodworking Machinery

(l104h044.fm-141101)
 3DUW8VHV

BIESSE S.p.A. Woodworking Machinery

(a303h003.fm-141101)
BIESSE S.p.A. Woodworking Machinery
(a303h003.fm-141101)
&KDSWHU %DVLF8VHV

In this chapter, the procedures relative to the main basic uses of the machine are described in
order to operate the machine correctly. In other words, the following operations are illustrated:
machine start-up, stop and restart.

 6WDUWXS

1. Turn the main switch to position 1 (ON) (ref. A, page 3 - 2).

2. Start the company main pressure

pneumatic system and open the cut-out
valve (ref. B, page 1 - 5) press and turn
$
clockwise the knob $.

3. Start the system for chips suction, to which

the machine is connected, and check that the sectioning guillotine in the connection pipe is
open.

4. Press the start button (green) on the main button pad (ref. B1, page 3 - 3).

Every time the machine is started-up, it is necessary to check the correct operation of the main
safety devices, and to proceed as follows:

n Press the emergency push-button (ref. F, page 3 - 2) and check that the start button (green),
located on the main button pad (ref. B1, page 3 - 3), is switched off. Carry out this operation
on all emergency push-buttons.

n Turn clockwise the orange-coloured knob $ of the cut-out valve (ref. B, page 1 - 5) and then
check that the FR unit pressure gauge (ref. L, page 1 - 3) indicates 0 bar.

n Lift slightly the safety bar (ref. D, page 1 - 5) and check that the start button (green) located
on the main button pad (ref. B1, page 3 - 3) is switched off.

Should one of these devices not operate correctly, please inform the maintenance personnel or the
BIESSE Client Service Department.

BIESSE S.p.A. Woodworking Machinery

(l140h005.fm-141101)

&KDSWHU
%DVLF8VHV

'$1*(5
,WLVVWULFWO\SURKLELWHGWRRSHUDWHWKHPDFKLQHZLWKVDIHW\GHYLFHVGLVHQJDJHG

 6WRS

It is possible to carry out different types of machine stops:

5HJXODUVWRS; this is used when it is necessary to suspend any work cycle in progress or to stop
the blade motors. To carry out these type of stop, press the blade stop button (black) located on
the main button pad. (ref. B4, page 3 - 3).

(PHUJHQF\VWRS; this is used when it is necessary to stop immediately the machine operation. To
carry out this stop, press the nearest emergency push-button (ref. F, page 3 - 2); the program
started with the NC software will immedately stop and, consequently, the machine will stop.

3URJUDPVWRS; this is used when it is necessary to suspend any work cycle in progress without
stopping completely machine operation. To carry out this type of stop, press the working cycle
suspension button (black) located on the main button pad (ref. B7, page 3 - 3), or use the special
function in the NC software (see the Software User’s Manual).

 5HVWDUW

In case of a sudden stop of the machine - whether this occurs intentionally or casually - to reset the
correct operation and restart the working cycle, proceed as follows:

n Should an emergency stop be requested

using the special push-button (ref. F, page
3 - 2), turn the latter in the direction $
indicated by the arrows $ located above
the push-button itself.

n Should the operating section access door be open, close it.

n Press the start button (green) on the main button pad (ref. B1, page 3 - 3).

n Should the stop be caused by an interruption in the mains supply, it is necessary to carry out
the axis reset (or calibration) (see the Software User’s Manual). Moreover, in this case, it is
not possible to restart the working cycle from the point where the machine working cycle has
been interrupted.

n To restart the working cycle:

- Should the blade motors be off, press the blade start button (white) located on the main
button pad (ref. B3, page 3 - 3).
- Restart the program by means of the special command on the NC software.
- Press the working cycle start button (white) located on the above mentioned button pad (ref.
B6, page 3 - 3).

 BIESSE S.p.A. Woodworking Machinery

(l140h005.fm-141101)
 &KDSWHU
%DVLF8VHV

 6ZLWFKLQJ2II

1. Wait until the end of the machine working.

2. Set the control software for switching off.

3. Carry out a regular stop of the machine as described in the paragraph 5.2 “Stop” on page 5 -
2.

4. Turn the main machine switch to 0 (ref. A, page 3 - 2), and lock it, if any, and then do the
same with that of the factory’s general system.

5. Close the pneumatic circuit in the point in which it is connected to the factory’s general
system.

6. Discharge and lock the pneumatic system by using the cut-out valve (ref. B, page 1 - 5) and
then lock the valve, if any.

BIESSE S.p.A. Woodworking Machinery

(l140h005.fm-141101)

&KDSWHU
%DVLF8VHV

 BIESSE S.p.A. Woodworking Machinery

(l140h005.fm-141101)
&KDSWHU 0DFKLQLQJ

This chapter describes the methods and procedures to follow when carrying out machining
operations.

 0DFKLQLQJ0RGHV

The following paragraph contains all of the possible methods for carrying out machining
operations. Indications are given with regard to how to enable functions, specific uses, and the
respective possible loading methods for each machining mode. Procedures for machining mode
execution are also given. For further information about machining enabling, see the Software
User’s Manual.

0DNLQJDQ,PPHGLDWH&XW

This machining mode is used by pressing one of the specific keys on the PLC keyboard (ref. E,
page 3 - 2) and is usually used to make one or more cuts without having to program them into the
numerical control software.

To carry out this type of machining proceed as follows:

1. Make sure that the start button (green) on the button pad (ref. B1, page 3 - 3), is lit.

2. If a piece with specific dimensions is required, place the PUSHING DEVICE axis at the
desired position.

3. Load the piece.

4. Press one of the immediate cut keys on the PLC keyboard to choose and enable (ref. E8,
E10, E12, page 3 - 4) the type of cut required (short, long, complete).

5. Press the blade start button (white) on the main button pad (ref. B3, page 3 - 3).

6. Press the cycle start button (white) on the same button pad (ref. B6, page 3 - 3). Machining
will start and will stop when the presser rises again.

BIESSE S.p.A. Woodworking Machinery

(l133h014.fm-141101)

&KDSWHU
0DFKLQLQJ

0DNLQJDQ,PPHGLDWH&XW8VLQJ)DVW3URJUDPPLQJ

This machining mode can be used through the MANUAL CUTS page of the numerical control (to
open this page, press F2 from the main menu), and is usually used to rapidly program and make
one or more cuts.

To carry out this type of machining proceed as follows:

1. Make sure that the start button (green) on the button pad (ref. B1, page 3 - 3), is lit.

2. Press F5 from the MANUAL CUTS page to enable the ejection and new cycle control.

3. Press the cycle start button (white) on the main button pad (ref. B6, page 3 - 3). The carriage
that drives the pushing devices and the rear collet stops will move into the proximity of the
cutting area. For this reason, if there are any pieces on the wheel supports, these will be
unloaded.

4. Load the piece.

5. Press the cycle start button (white) on the main button pad (ref. B6, page 3 - 3). The collets
on the rear stops will lock the piece into place.

6. Press the blade start button (white) on the same button pad (ref. B3v 3 - 3).

7. Press one of the immediate cut keys on the PLC keyboard to choose and enable (ref. E8,
E10, E12, page 3 - 4), the type of immediate cut required (short, long, complete).

8. From this point onwards the machine will immediately carry out any command enabled from
the MANUAL CUTS page. The first command usually enabled is a panel measure and trim
cut. In this way the machine automatically effects all of the movements required to calculate
the dimensions of the piece and to make the trim cut. Subsequently the length and quantity of
cuts must be selected and lastly, the ejection and new cycle control should be enabled. For
more detailed information about how to use the controls on this page, see the Software User’s
Manual.

0DNLQJ&XWVLQ6HTXHQFH8VLQJ)DVW3URJUDPPLQJ

This machining mode is used from the SEQUENCE MODE page of the numerical control (to open
this page press F3 from the main menu), and it is usually used to rapidly program and make a
sequence of cuts for a given quantity of pieces.

To carry out this type of machining proceed as follows:

1. Make sure that the start button (green) on the main button pad (ref. B1, page 3 - 3), is lit.

2. Press F1 from the SEQUENCE MODE page to enable the required program.

3. Press the blade start button (white) on the main button pad (ref. B3, page 3 - 3).

4. Press the cycle start button (white) on the same button pad (ref. B6, page 3 - 3).

 BIESSE S.p.A. Woodworking Machinery

(l133h014.fm-141101)
 &KDSWHU
0DFKLQLQJ

5. Load the piece.

6. Press the cycle start button (white) again (ref. B6, page 3 - 3).

8VLQJD&XWWLQJ3DWWHUQ

This machining mode is used from the PATTERNS page of the numerical control (to open this
page press F4 from the main menu), and it is usually used to carry out a cutting pattern on a
specified quantity of pieces.

To carry out this type of machining proceed as follows:

1. Make sure that the start button (green) on the main button pad (ref. B1, page 3 - 3), is lit.

2. Press F1 from the PATTERNS page to enable the required program.

3. Press the blade start button (white) on the main button pad (ref. B3, page 3 - 3).

4. Press the blade start button (white) on the main button pad (ref. B6, page 3 - 3).

5. Load the piece.

6. Press the cycle start button (white) again (ref. B6, page 3 - 3).

8VLQJD6HULHVRI&XWWLQJ3DWWHUQV

This machining mode is used from the WORKLIST page (to open this page press F5 from the main
menu), and it is usually used to carry out two or more cutting patterns in succession on a specified
number of pieces.

To carry out this type of machining proceed as follows:

1. Make sure that the start button (green) on the main button pad (ref. B1, page 3 - 3), is lit.

2. Press F1 from the WORKLIST page to enable the list of programs.

3. Press the blade start button (white) on the main button pad (ref. B3, page 3 - 3).

4. Press the cycle start button (white) on the same button pad (ref. B6, page 3 - 3).

5. Load the piece.

6. Press the cycle start button (white) again (ref. B6, page 3 - 3).

BIESSE S.p.A. Woodworking Machinery

(l133h014.fm-141101)

&KDSWHU
0DFKLQLQJ

0DNLQJ&XWVIRU6TXDUHVKDSHG2SHQLQJV RSWLRQDO

This machining mode is used from the BORING EDITOR page (to open this page press ← or F11
and F4 from the main menu), and it is usually used to program and make openings in pieces that
will be used for kitchen work tops where sink units or cook tops will be fitted.

To carry out this type of machining proceed as follows:

1. Make sure that the start button (green) on the main button pad (ref. B1, page 3 - 3), is lit.

2. Press F1 from the BORING EDITOR page to enable the list of programs.

3. Press the blade start button (white) on the main button pad (ref. B3, page 3 - 3).

4. Press the cycle start button (white) on the same button pad (ref. B6, page 3 - 3).

5. Load the piece.

6. Press the cycle start button (white) again (ref. B6, page 3 - 3).

 BIESSE S.p.A. Woodworking Machinery

(l133h014.fm-141101)
 &KDSWHU
0DFKLQLQJ

*URRYH([HFXWLRQ

To carry out this type of machining, proceed as described in the paragraph “Making an Immediate
Cut” on page 6 - 1, or in “Making an Immediate Cut Using Fast Programming” on page 6 - 2.

Before proceeding, it is necessary to set the grooving depth as described in the Software User’s
Manual. In case of manual setting, proceed as follows:

1. Move the blade carriage to the side opposite

to that where blade replacements are made.

2. Take the t-wrench which is housed in $ on

the left-hand side of the machine. In this way $
and for safety measures, all movements of
the blade carriage are locked.

3. Insert the t-wrench in the hole % on the

right-hand side of the machine.

4. Turn clockwise to reduce depth and

anticlockwise to increase it. A full turn of the
%
t-wrench corresponds to a shift of PP. Make
trial grooves to make sure that the adjustment
has been made correctly.

5. When adjustments have been completed,

replace the t-wrench in its housing $.

 0DFKLQLQJ+ROG

For a brief pause during a cycle with automatic loading, proceed as follows:

1. Turn the pushing device selector (yellow) on the main button pad to the right (ref. B8, page 3
- 3).

2. Wait for any cuts in progress to be completed.

3. Press F2 to stop the program that is being executed.

4. Press an emergency button (red mushroom-head button) (ref. F, page 3 - 2).

To restart the machining cycle proceed as follows:

1. Disengage the previously enabled emergency button.

BIESSE S.p.A. Woodworking Machinery

(l133h014.fm-141101)

&KDSWHU
0DFKLQLQJ

2. Press the start button (green) on the main button pad (ref. B8, page 3 - 3).

3. Press F3 to restart the suspended program.

4. Turn the pushing device selector on the main button pad to the left (ref. B8, page 3 - 3).

5. Press the cycle start button (white) on the main button pad (ref. B6, page 3 - 3).

6. Press the blade start button (white) on the same button pad (ref. B3, page 3 - 3).

 3LHFH/RDGLQJ

To load the machine it is necessary to position the piece/s against both the side stop and the rear
collet stops, which, after the desired machining program has been enabled, will have moved into
the proximity of the cutting area.

 BIESSE S.p.A. Woodworking Machinery

(l133h014.fm-141101)
 3DUW2SHUDWLRQV

BIESSE S.p.A. Woodworking Machinery

(a311h002.fm-141101)
BIESSE S.p.A. Woodworking Machinery
(a311h002.fm-141101)
&KDSWHU 0DLQWHQDQFH

This chapter contains the information that is required to keep the machine in perfect working order.

'$1*(5
%HIRUHFDUU\LQJRXWDQ\PDLQWHQDQFHLQWHUYHQWLRQVRUUHSDLUVWRWKHPDFKLQHXQOHVV
RWKHUZLVHVSHFLILHGVZLWFKRIIWKHPDFKLQHDQGEOHHGWKHDLUIURPWKHSQHXPDWLFV\VWHPE\
DGMXVWLQJWKHFXWRXWYDOYH UHI%SDJH 8VHWKHSDGORFNVVXSSOLHGWRORFNWKHPDLQ
VZLWFK UHI$SDJH DQGWKHFXWRXWYDOYHWRSUHYHQWDQ\RQHIURPUHVWDUWLQJWKH
PDFKLQH$OVRPDNHVXUHWKDWDOOPDFKLQHPHFKDQLFDORUJDQVDUHLQWKHVWDQGE\SRVLWLRQ

 0DLQWHQDQFH,QWHUYHQWLRQ6XPPDU\DQG)UHTXHQF\

The following table contains a summary of all foreseen maintenance interventions as well as the
frequency with which they should be effected. Take into account that frequency has been
evaluated according to a 5-day working week of 8 hours per day and to normal operating
conditions. The letter in the 5HI. column is used to locate the points of the machine as illustrated
on page 7 - 2, which require maintenance. The 3DJH column shows, for those interventions that
require it, the number of the page where the intervention procedure is explained.

)UHTXHQF\ 5HI 3DUW 2SHUDWLRQ 3DJH

(YHU\ Whole machine Cleaning 7-2
'D\
$ FR Unit Check condensation in tray; 7-3
drain if necessary
(YHU\ % Blade carriage Clean the guides 7-2
:HHN
& Blade carriage and pushing Clean the racks 7-2
device carriage
' Presser Clean the racks with
compressed air
( Control panel Clean the filters 7-3
) Electrical cabinet Clean the filters 7-4
* Electrical cabinet Clean the air conditioner 7-4

BIESSE S.p.A. Woodworking Machinery

(l107h050.fm-141101)

&KDSWHU
0DLQWHQDQFH

/RFDWLRQRI3RLQWV7KDW5HTXLUH0DLQWHQDQFH

(
)
* ' % &
&

' &

 *HQHUDO&OHDQLQJRIWKH0DFKLQH

If the machine and the surrounding area are kept clean and tidy this will make the working area
safer and more healthy, and will enable commands and indications to be made easily and without
errors.

To remove any possible chips, use a vacuum cleaner; to remove any trace of small powders use a
compressor, always taking care to maintain a safety distance. The chips fallen on the ground must
be removed with a vacuum cleaner or with a broom, since the ground might be slippery.

To clean the guides or the racks, it is recommended to use a clean and dry cloth. In case of
incrustations, it is recommended to use a scrubbing brush with bronze bristles. Subsequently use
a long handled brush to lay a thin layer of MOBILUX EP0 lubricant.

 BIESSE S.p.A. Woodworking Machinery

(l107h050.fm-141101)
 &KDSWHU
0DLQWHQDQFH

 'UDLQLQJ&RQGHQVDWHIURPWKH)58QLW

1. Place a container under the bleeder valve $.

2. Press the bleeder valve $upwards, until all

the condensate has drained out.

&$87,21
7KHFRQGHQVDWHVWDJQDWLRQLQWKH)5XQLW
UHGXFHVWKHOLIHRISQHXPDWLFFRPSRQHQWU\RI $
WKHPDFKLQH

 &OHDQLQJWKH)LOWHUVRIWKH&RQWURO3DQHO

To clean the filters, proceed as follows:

1. Remove each filter $ by unscrewing it.

2. Clean the filter by blowing compressed air

from the inside outwards.
$

&$87,21
1HYHUEORZWKHFRPSUHVVHGDLULQWKHRSSRVLWH
GLUHFWLRQDVWKLVZLOOGDPDJHWKHILOWHU

BIESSE S.p.A. Woodworking Machinery

(l107h050.fm-141101)

&KDSWHU
0DLQWHQDQFH

 &OHDQLQJWKH(OHFWULFDO&DELQHW)LOWHU

The filter is fitted on the electrical cabinet only if the latter is not equipped with the air conditioner
(optional). To clean the filter, proceed as follows:

1. Remove the cover $, by loosening the

relative screws located inside the electrical
cabinet.

2. Prise off cover %, using a screwdriver.

3. Remove the filter & and clean it by blowing A

a jet of compressed air from the inside
outwards.

&$87,21
C
1 HY H U EO RZ WKH  F RPS UH V VH G DL U L Q WKH
RSSRVLWHGLUHFWLRQDVWKLVZLOOGDPDJHWKH B
ILOWHU

 &OHDQLQJWKH$LU&RQGLWLRQHURQWKH(OHFWULFDO&DELQHW

To clean easily the air conditioner, remove the

cover $ , by loosening the relative screws
located in the electrical cabinet.

Air conditioner cleaning is carried out by

cleaning the filter, the capacitor battery and the
fan. The capacitor battery is made of copper A
tubes and aluminium fins and is located near the
fan. The dirt leaves a deposit on the external
side of the blades, making them heavier and
causing a louder sound, a greater electrical input and the motor overheating. Cleaning is carried
out by blowing compressed air while making sure not to damage or bend the aluminium fins. If
required, substitute the filters with original spare parts or with other parts having the same
functions.

&$87,21
8QVXLWDEOHILOWHUVFRXOGOLPLWH[FHVVLYHO\WKHDLUIORZWKXVFDXVLQJLUUHSDUDEOHGDPDJHVWR
WKHFRPSUHVVRU

 BIESSE S.p.A. Woodworking Machinery

(l107h050.fm-141101)
 &KDSWHU
0DLQWHQDQFH

 /XEULFDQWV

The following table lists all of the lubricants used by BIESSE in the different parts of the machine.
Equivalent lubricants, listed in the table, should only be used in the event that it is not possible to
obtain those used by BIESSE. If an equivalent lubricant is to be used, thoroughly clean the part of
the machine concerned, taking care to remove all residues of the previous product in order to
avoid the possibility of chemical reactions that may damage the machine.

/XEULFDQWV (TXLYDOHQW/XEULFDQWV 8VH

MOBILUX EP 0 ESSO BEACON EP 0 n Racks
KLÜBER TRIBOSTAR 0 EP(*)
KLÜBER CENTOPLEX 0 n Guides
EP(**)
(*). For the Italian market only.

(**). For the international market.

BIESSE S.p.A. Woodworking Machinery

(l107h050.fm-141101)

&KDSWHU
0DLQWHQDQFH

 BIESSE S.p.A. Woodworking Machinery

(l107h050.fm-141101)
&KDSWHU 5HSODFHPHQWVDQG$GMXVWPHQWV

This chapter describes how to replace those parts of the machine that, if worn, could cause
machine malfunctioning. Moreover, a few indications are given on how to adjust those parts which,
for different reasons, could be subject to a modification of their initial calibration.

 %ODGHV5HSODFHPHQW

'$1*(5
:HDUJORYHVZKHQFDUU\LQJRXWWKLVLQWHUYHQWLRQ

1. Turn the blade change selector (key) on the

main button pad to the right (ref. B5, page
3 - 3), and remove the key. The motors
switch off, the carriage moves to a pre-set
position and a system which, after a lapse
of time, automatically releases the blade $ $
access hatch, is enabled.

2. Open the blade $ access hatch once the %

lamp on the pushing device selector
(yellow) is lit; this selector is located on the
main button pad (ref. B8, page 3 - 3).

3. Open also the % hatch.

4. Remove the flange & as described in the

paragraph “Disassembling the Blade
Locking Flange” on page 8 - 2.

5. Replace the blade, making sure to install

the new blade in the correct direction (see &
the relative figure). Use only appropriate &
tools for this operation; the technical
specifications are described in the relative
Appendix.

6. Mount the flange & as described in the

paragraph “Assembling the Blade Locking
Flange” on page 8 - 3.

7. Close the % and $KDWFKHV.

BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)

&KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

'LVDVVHPEOLQJWKH%ODGH/RFNLQJ)ODQJH

According to the blade locking system of the machine, to disassemble the flange it is necessary to
carry out one of the following operating procedures:

6WDQGDUG6\VWHP
1 2
1. Hold the flange $ and insert the t-wrench
in the housing %. $

2. Turn simultaneously the t-wrench

clockwise and the flange anticlockwise .
At the completion of the turns, remove the %
flange $.

3QHXPDWLF6\VWHP
&
1. Hold the flange $. '

2. With the other hand, apply pressure on

the lever & to disengage the cutting blade
flange, or on the lever ' to disengage the
scoring blade flange.

3. Remove the flange $.

$

 BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)
 &KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

$VVHPEOLQJWKH%ODGH/RFNLQJ)ODQJH

According to the blade locking system of the machine, to assemble the flange it is necessary to
carry out one of the following operating procedures:

6WDQGDUG6\VWHP
1 2
1. Hold the flange $ and insert the t-wrench
in the housing %. $

2. Turn simultaneously the key anticlockwise

and the flange clockwise until both can
turn freely without any effort; at this point %
the blade has been locked . To avoid any
damages to the locking system, it is
recommended not to tighten deeply.

3QHXPDWLF6\VWHP
&
1. Apply pressure on the lever & for the '
cutting blade flange, or on the lever ' for
the scoring blade flange.

2. With the other hand, replace the flange $

in its housing.

3. Release the lever; the flange is locked.

$

BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)

&KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

 %ODGH%HOW5HSODFHPHQW

1. Turn the blade change selector (key) on the

main button pad to the right (ref. B5, page
3 - 3), and then remove the key. The
motors switch off, the carriage moves to a
pre-set position and a system which, after a
lapse of time, automatically releases the $ %
blade A access hatch, is enabled.

2. Open the blade $ access hatch once the ' &

lamp on the pushing device selector
(yellow) is lit; this selector is located on the
main button pad (ref. B8, page 3 - 3).

3. Switch off the machine.

4. Loosen the % nuts DQGRQHRIWKH&

VFUHZV(it is unimportant whether the
chosen screw is on the left-hand side or on
the right-hand side), then remove the cover
'.

5. Remove the blades as described in the

paragraph 8.1 “Blades Replacement” on
page 8 - 1.

6. Remove the casing (.

(
7. Remove the suction pipe ).

)
8. Remove the casings * and +.
*

+
+

 BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)
 &KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

9. Loosen slightly the screws which hold in

place the belt tightener -.

10. Replace the cutting blade belt . with a new

one. .

11. Vary the position of the belt tightener -LQ -

RUGHUWRWHQVLRQWKHFXWWLQJEODGHEHOW.. /
To obtain the precise belt tension, it is
recommended to adopt the methods
described in the paragraph “Measuring the
Blade Belts Tension” on page 8 - 6.

12. In order to remove the scoring blade belt /,

disassemble the cover 0 located on the
back of the base and access the rear part
of the operating section (after having
moved it manually).

13. Loosen slightly the screws which lock the

motor 1.

14. Adjust screws 2 and 3 to lift the motor 1 at

such a height as to be able to remove the
belt /.

15. Move to the front part of the operating

section and replace the belt / with a new
2
one.

16. Adjust screws 2 and 3 to tension the

scoring blade belt /. In order to obtain the
precise belt tension, it is recommended to 3
adopt the methods described in the
1
paragraph “Measuring the Blade Belts
Tension” on page 8 - 6.

17. When tensioning has been completed,

tighten the motor locking screws and
reassemble all hardware.

BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)

&KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

0HDVXULQJWKH%ODGH%HOWV7HQVLRQ

$VSULQJORDGHGF\OLQGULFDOG\QDPRPeteror an electronic device to measure tension is required

for making precise checks of the tensioning of the blade belts $7KLVSDUDJUDSKGHVFULEHVthe
indispensable requirements of these instruments as well as how to use them.

'\QDPRPHWHU

It is possible to use two types of dynamometer ($ and %), with the characteristics listed in the table
here below. For each type of dynamometer, two are indicated, each with different characteristics.

5HTXLUHPHQWV $ %
For loads of kg 0-5 0-10 N 0-3000 0-5000
Scale g 50 200 N 100 200
Length (unloaded) mm 245 255 mm 525 525
Length (loaded) mm 355 316 mm 585 585
Net Weight kg 0.150 0.150 kg 5.000 5.000

$ - Dynamometer with hook and ring in $ %

nickel-plated steel.

% - Dynamometer with two hooks in forged

steel.

To check the tensioning of the belts, proceed as follows:

1. Hook the dynamometer $ or % onto the

central area of the belt and apply a load )
shown in the table on page 8 - 7. This
procedure requires the use of a tool '
similar to the one shown in the figure
opposite.

2. Use a gauge to measure the belt F

S
displacement. Tensioning is correct if the
displacement is 6 as shown always in the
table on page 8 - 7. '

$ %

 BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)
 &KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

(OHFWURQLF7HQVLRQ0HDVXULQJ'HYLFH

BIESSE recommends the use of an electronic measuring device made by the company “*DWHV”.
The following is a description of the use and the correct theoretical values for belt tensioning with
this instrument.

1. Insert the connecting cable into the

instrument socket.

2. Switch on the instrument. &

3. Position the head $ next to the belt %, as

shown in the figure opposite. $

,1)250$7,21
'RQRWEULQJWKHKHDGLQWRFRQWDFWZLWKWKHEHOW
%
4. Use a finger to pluck the belt % (as if it
were a guitar string).

5. Read the frequency on the display & and

compare it with the theoretical values shown in the following table. If the read frequency is
higher than the theoretical frequency, it means that the belt is too tight; on the contrary, if the
read frequency is lower than the theoretical frequency, it means that the belt is not sufficiently
tight.

7DEOHRI7HQVLRQLQJ9DOXHV

%ODGH7\SH 6 PP ) 1 7KHRUHWLFDO)UHTXHQF\
+]
Scoring Blade 9.6 26.6 67.4
Cutting Blade (Ø 300 mm - 50 Hz) 9.2 13.2 29.5
Cutting Blade (Ø 300 mm - 60 Hz) 9.3 11.7 27.4

BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)

&KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

 6FRULQJ%ODGH$GMXVWPHQW

This adjustment is made to restore perfect scoring and is usually carried out after one or both of
the blades has been replaced. Make several trial cuts to make sure that the adjustment has been
made correctly.

The machine can be set for a manual or an automatic adjustment. The following procedures
concern manual adjustment. For automatic adjustment, please see the Software User’s Manual.

1. Move the blade carriage to the opposite side

to that where the blade change is carried out.

2. Remove the t-wrench from its housing $ on

the left-hand side of the machine. In this way $
and for safety reasons, all movements of the
blade carriage are stopped.

3. To adjust the alignment of the scoring blade

with that of the cutting blade, insert the
t-wrench in the hole % and turn it. If the
direction of the turn is clockwise, the blade
%
moves towards the front part of the machine.
If the direction of the turn is anticlockwise, the
blade moves in the opposite direction. One
turn of the t-wrench corresponds to a shift of
PP.

4. To adjust the scoring blade depth, insert the

t-wrench in the hole & and turn it. If the
direction of the turn is clockwise, the scoring
depth decreases. If the direction of the turn is
anticlockwise, the scoring depth increases. &
One turn of the t-wrench corresponds to a
shift of PP.

5. Once adjustments have been completed,

replace the t-wrench in its housing $.

 BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)
 &KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

 3QHXPDWLF6\VWHP3UHVVXUH5HJXODWRUV

If the values for pressure, supply and for the various devices of the pneumatic system should vary
from those set at the time of installation, machine operation anomalies may occur. The figure here
below shows the positions of the pressure regulators, while the table contains the minimum (0LQ)
and maximum (0D[) pressure values as well as the values set when the machine was tested
(6HW). Should there be any anomalies, check that the value given in the table corresponds to that
on the machine and if necessary, adjust the pressure (see page 8 - 9).

5HI 3UHVVXUH5HJXODWRUIRU 9DOXH EDU

0LQ 0D[ 6HW
$ Supply 6.5 7 7
% Side Pusher 2 3 3

3UHVVXUH$GMXVWPHQW

To adjust pressure proceed as follows.

1. Grip the knob $ and pull it upwards until it

releases.
A
2. Tighten the knob to increase pressure and
loosen it to reduce pressure. Pressure is
displayed on the pressure gauge %. B

BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)

&KDSWHU
5HSODFHPHQWVDQG$GMXVWPHQWV

 BIESSE S.p.A. Woodworking Machinery

(l138h009.fm-141101)
 $SSHQGLFHV

BIESSE S.p.A. Woodworking Machinery

(a306h003.fm-141101)
BIESSE S.p.A. Woodworking Machinery
(a306h003.fm-141101)
$SSHQGL[$ 6DIHW\LQIRUPDWLRQ

The machine will operate in safety if it is used by qualified personnel in compliance with the
recommendations and instructions provided in this manual or supplied by BIESSE’s technical
engineers at the time of installation. BIESSE declines all responsibility for any damage to persons
or goods resulting from use of the machine by unqualified operators or from failure to observe the
following recommendations.

Never remove or tamper with guards and protections in order to carry out unforeseen operations,
as this will result in serious risks for the operator. BIESSE declines all responsibility for damage to
persons or goods resulting from incorrect use or deliberate misuse of the machine.

$ 7UDQVSRUWDQGPRYLQJ

1. When lifting and moving the machine, either as a whole or in part, operations must always be
carried out by suitably qualified and experienced personnel, using lifting devices with an
adequate capacity.

2. Never stand within range of the crane when the machine is being lifted.

3. Only lift the machine as described in this manual.

$ ,QVWDOODWLRQ

1. Installation operations must always be carried out by qualified personnel who have been
authorised to do so by BIESSE.

2. Before starting work, check that the various parts of the machine are free from any physical
damage caused by bumping, tearing or abrasion. Damage to electrical cables or sheathing
will compromise the safety of the machine’s electrical system.

$ 7RROV

When choosing tools to be installed in the machine, the operator is advised to follow the
recommendations given below.

1. Never use deformed or cracked rotating tools.

BIESSE S.p.A. Woodworking Machinery

(l109h012.fm-141101)
$
$SSHQGL[$
6DIHW\LQIRUPDWLRQ

2. Check for perfect balance of rotating tools and make sure they are perfectly sharp and
suitable for the work to be performed.

3. Never use tools beyond their speed limit, which is impressed on the surface of the tool or
indicated in some way by the manufacturer.

4. Before installing any tool in its seating make sure that the guide and centring surfaces have
no dents and are perfectly clean.

5. In each tool apply only the prescribed torque to screws, bolts, nuts and rings.

6. Always make sure that the direction of rotation of the tool is the same as that of the spindle in
which it is mounted.

7. Never exceed the limits indicated in this manual or otherwise prescribed by BIESSE.

$ 3UHSDUDWLRQDQGPDFKLQLQJ

1. Wear protective clothing of the approved type (glasses, gloves, helmet and footwear) in
compliance with the standards and regulations in force on the essential health and safety
requirements in the workplace.

2. Never attempt to modify the programs managing safety devices. BIESSE declines all
responsibility for any damage to persons or goods resulting from unauthorised modifications
of this kind.

3. The machine must be set up by one person only. Ensure that nobody else approaches the
machine during setting up operations.

4. When entering the area inside the safety fence, remove the key from the limit switch on the
door, to prevent anybody from restarting the machine.

5. Never leave tools on the machine when setting up has been completed.

6. Before starting work, check that there is nobody within the danger area.

7. Make sure that nothing is likely to impede normal movement of the machine along the axes,
and that all casings, doors and protective covers are properly in place and safely fastened.

8. Before starting work, check to make sure that the tools installed in the machine have not been
tampered with in any way.

9. Never operate the machine while under the influence of any medicine, drugs or drink that may
reduce levels of vigilance and reflexes.

10. Always keep the working area clean and tidy.

11. Never place hands inside blade passage openings.

12. Never mount the machine.

$ BIESSE S.p.A. Woodworking Machinery

(l109h012.fm-141101)
 $SSHQGL[$
6DIHW\LQIRUPDWLRQ

13. Never leave the machine unattended when it is operating.

$ 0DLQWHQDQFH

1. Before carrying out any maintenance interventions, first make sure that the machine has been
isolated from all sources of electric or pneumatic energy by using the main electric switch and
the pneumatic switch on the machine. These should be padlocked in the safety position,
using a suitable chain and lock (not supplied by BIESSE) from which the key should then be
removed. As far as regards the pneumatic system, make sure also that all mechanical organs
controlled by pneumatic actuators are in the lowest gravitational position and therefore, not
dangerous (null potential energy).

2. At the end of all maintenance interventions, take care to replace all guards, fixing them into
place with the relevant mechanical locking devices.

3. Always wear protection goggles to protect from flying dust and chips when using compressed
air. Use a suction device in place of compressed air wherever possible.

4. Wait at least 5 minutes before approaching electronic equipment. This is to allow the
condensers to discharge residual energy.

5. Do not allow unauthorised persons to carry out maintenance or repairs.

6. Read the relevant chapter in the manual before carrying out any maintenance to the machine
or systems.

7. Do not lubricate, repair or adjust the machine when it is operating, unless expressly indicated
in this manual. This is to avoid becoming entangled in moving parts.

8. When carrying out maintenance interventions or repairs in areas that are not easily
accessible from the ground, use a ladder or platform that complies with the safety regulations
in force, to reach the area concerned.

9. Do not smoke, eat or drink when handling lubricants. Always comply with current regulations
regarding handling and use of mineral oils and greases.

10. To prevent irritation or allergy, always wear protective goggles or mask, oil-proof gloves and
oil-proof overalls when handling lubricants.

11. Store lubricants in a room with natural ventilation, well away from heat sources (electrical
panels, open flames, etc.).

12. It is recommended that lubricants should not come into contact with pure oxygen and acids.

13. All used lubricants must be entrusted to the Authorities responsible for disposal of used oils
for treatment.

BIESSE S.p.A. Woodworking Machinery

(l109h012.fm-141101)
$
$SSHQGL[$
6DIHW\LQIRUPDWLRQ

14. In case of lubricant overflowing, clean the place by sprinkling sand on the surfaces. Then
remove the sand with a spatula and dispose of it for incineration at duly authorized Special
Waste Disposal Centers.
Wash surfaces with solvents (chlorinated or aliphatic) taking care that the fumes are not
allowed to accumulate in the working area.

15. Those who are particularly sensitive to lubricants may be subject to an allergic reaction or
oil-related acne, particularly if their skin has previously been subjected to damage by abrasive
substances (cleaning paste or injuries) or chemicals (solvents, extremely alkaline detergents,
etc.). Irritations may result from contact with the eyes.

16. Incorrect handling of lubricants may result in overexposure, for example slight irritation of the
eyes or skin; if this occurs, move away from the site of exposure and call a doctor.

17. Should lubricants come into contact with the skin, wash well with soap and water.

18. Should lubricants come into contact with the eyes, rinse well with water only.

19. If a lubricant in the “oils” category is swallowed, do not induce vomiting and call a doctor
immediately.

20. If a small amount of lubricant in the “greases” category is swallowed, call a doctor
immediately. If the amount swallowed is larger, administer 1 or 2 glasses of water and call a
doctor immediately. Do not induce vomiting or administer anything orally if the person in
question has fainted.

$ 'HPROLWLRQ

1. All operations must be carried out by qualified personnel only.

2. Turn the machine off, disconnect it from the power supply and discharge all the air from the
pneumatic system.

3. Remove any tools that may still be installed and put them away.

4. Fix all parts capable of moving by inertia or by gravity.

$ BIESSE S.p.A. Woodworking Machinery

(l109h012.fm-141101)
$SSHQGL[% 7HFKQLFDO&KDUDFWHULVWLFV

% *HQHUDO,QIRUPDWLRQ

2SHUDWLQJ6HFWLRQ

n Cutting blade projection (mm): 70

n Blade carriage movement speed (m/min.): 50

3XVKLQJ'HYLFHV

n Forward feed speed (m/min.): 25

n Return speed (m/min.): 40

6LGH3XVKHU

n Forward feed speed (m/min.): 12

n Return speed (m/min.): 12

BIESSE S.p.A. Woodworking Machinery

(l110h046.fm-141101)
%
$SSHQGL[%
7HFKQLFDO&KDUDFWHULVWLFV

% %ODGHV

Scoring Blade Cutting Blade

D

Ø8,4 Ø8,4
C
A

100 110

$ % & '
6FRULQJ%ODGH (mm) 200 65 3,5 4,4
6FRULQJ%ODGH SRVWIRUPHGFRQLFDOWRRWK (mm) 300 65 3,5 4,4
6FRULQJ%ODGH SRVWIRUPHGIODWWRRWK (mm) 300 65 3,5 4,6
&XWWLQJ%ODGH (mm) 300 65 3,0 4,4

The following section shows some types of blade tooth together with the respective uses on
various materials.

7\SH 0DFKLQDEOH0DWHULDOV
Crossed Tooth Unfaced plywood, layer-wood, and rough
chipboard

Flat/Trapezoidal Tooth Faced (laminate, melamine) chipboard and

MDF

Trapezoidal Tooth Postformed material

Conical Tooth Chipboard and faced panel scoring

% BIESSE S.p.A. Woodworking Machinery

(l110h046.fm-141101)
 $SSHQGL[%
7HFKQLFDO&KDUDFWHULVWLFV

% 1RLVH/HYHO

Sound pressure data are as follows:

Equivalent sound pressure level in position in the work area during dB(A) 79.1
machining (LpA)

Environmental correction factor (K) dB(A) 1.4

Sound power level during machining
(LwA) dB(A) 98.6
(wA) mW 7.2

Weighted peak instantaneous sound pressure in the work area dB(C) 104<130
during machining

Tests were carried out in accordance with ISO 3746 and ISO 11202 Regulations.

The noise levels given here are emission levels and do not necessarily represent safe working
levels. In spite of the existence of a relationship between emission levels and exposure levels, this
cannot be used reliably to establish whether or not other precautions are necessary. The factors
that determine the levels to which the workforce is exposed include: the length of the exposure, the
characteristics of the workplace environment, other sources of dust, noise, etc.; that is, the number
of machines and other processes in adjacent areas. In any case, this information allows the
machine user to be able to carry out a better evaluation of risks or danger.

% 'XVW(PLVVLRQ

The machine has passed the test for dust emission from woodworking machinery. This test is
carried out in accordance with the standard DIN 33893. The amount of dust issued into the
environment was less than 2 mg/m3. The certificate was issued by the FPH body on 10-09-2001
(reference FPH-AZ 010/2001).

BIESSE S.p.A. Woodworking Machinery

(l110h046.fm-141101)
%
$SSHQGL[%
7HFKQLFDO&KDUDFWHULVWLFV

% BIESSE S.p.A. Woodworking Machinery

(l110h046.fm-141101)
$SSHQGL[& 7UDQVSRUWDQG,QVWDOODWLRQ

'$1*(5
5HDGFDUHIXOO\WKHIROORZLQJLQVWUXFWLRQVEHIRUHFDUU\LQJRXWDQ\RSHUDWLRQZKDWVRHYHU

The machine may be shipped using different means of transport (road, rail, air, and sea), and this
is usually established with the customer at the time of purchase. The machine is split into different
parts in order to facilitate transport and in this appendix there is a list of the parts that are
transported (see page C - 2) together with their weights.

The lifting operations that are necessary for unloading the machine must be carried out by suitably
qualified personnel who shall follow the indications given in this appendix on page C - 2.

The machine installation area must be aired and lit, and appropriately dimensioned as well as
equipped with suitable points to connect the different systems (electric, pneumatic, etc..). With
regard to this, please see the paragraph “Machine Configuration, Connection Points, and Overall
Dimensions” on page C - 5. The machine connection systems and the relative installation area
shall meet the requirements described in page C - 6.

The machine assembly, levelling and connection operations are the responsibility of BIESSE
assistance service personnel. Therefore, it is strictly prohibited to remove the packaging, to open
any boxes containing any equipment and, above all, to start the machine without the prior approval
of the above mentioned qualified expert personnel.

BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
&
$SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

& 0DFKLQH3DUWV7R%H7UDQVSRUWHG

Given the variety of optional fittings and possible machine configurations, the following list is
indicative. It refers to a machine model that is equipped to machine 3200 x 3100 mm pieces and
with 6 rear collet stops, 3 air jet panel supports and 9 wheel panel supports.

$ % &

5HI 'HVFULSWLRQ :HLJKW NJ

$ Base - Guides - Pushing device supporting beam 2600
% Electrical cabinet - Control equipment 330
& Wheel supports - Air jet supports - Columns - Guards 420

& 8QORDGLQJWKH0DFKLQH

To unload the machine, read the following lifting instructions. It is recommended to unload firstly
the lighter parts and then the heavier parts. Before lifting any component, discard all fixing
equipment such as rivets, ropes, etc... found on the carrier and which were used to fasten the
machine parts for transportation.

/LIWLQJ

The illustration below shows how to carry out lifting operations for each part of the machine. Use
suitable means and equipment (rods, ropes, etc...) to carry out these operations.

& BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
 $SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

%DVH*XLGHV3XVKLQJ'HYLFH6XSSRUWLQJ%HDP

$ %

% %
1400 mm
$
$

Material $ %
Quantity 2 2
Already fitted yes no

(OHFWULFDOFDELQHW&RQWURO(TXLSPHQW

BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
&
$SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

(OHFWULFDOFDELQHW&RQWURO(TXLSPHQW

& 6KLIWLQJ

Base shifting is a complex operation and requires the intervention of qualified expert service
engineers from BIESSE’s assistance service, as well as the use of a lift truck and relevant
equipment. On the other hand, shifting of the other machine parts may be carried out using a lift
truck and following the lifting methods explained above.

& BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
 $SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

& 0DFKLQH&RQILJXUDWLRQ&RQQHFWLRQ3RLQWVDQG2YHUDOO
'LPHQVLRQV

The following section contains the configuration of the machine, the mains power connection
points, and data relevant to the overall dimensions.

% 

PLQ 



PLQ 

'
&
Ò

Ò 
PLQ 
$ 





connection point for the electric system

connection point for the pneumatic system (Ø 12 mm)

connection point for the suction system

control panel

BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
&
$SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

The table below contains data relevant to the overall dimensions (see also the previous figure).
These data vary according to the maximum measurements of the pieces to be machined (length
and width) and for which the machine has been equipped. The values are given in millimetres.

0D[3LHFH0HDVXUHPHQWV $ % & '

3200 x 3100 4220 6488 3247 5422
4400 x 4250 5420 7688 4347 6522

& ,QVWDOODWLRQ$UHD5HTXLUHPHQWV

The basic requirements to install the machine are described hereunder: These requirements apply
to the different connection systems as well as to the installation area of the machine.

(OHFWULF6\VWHP5HTXLUHPHQWV

The quality of the electric system must guarantee the essential requirements as stated in the CEI
60204-1 and IEC 204-1 standards, unless otherwise agreed with the customer.

n Supply Voltage: (see rating plate) with a tolerance of ± 10%

n Supply Voltage Frequency: (see rating plate) with a tolerance of ± 2%

n Max. Electrical Input: (see rating plate)

n Harmonic Distortion: from the second to the fifth < 10% + from the sixth to the thirtieth < 2%

n Three-phase Supply Voltage Imbalance: < 2%

n Voltage Impulses: duration less than 1.5 ms and < 200% of supply voltage

n Voltage Interruption: duration < 3 ms; period > 1 second

n Voltage Drops: value < 20% of peak supply voltage; period > 1 second

n System compliance with standards: CEI 64-8, IEC 364

Machine protection against indirect contacts has been designed for mains supplies of the rated
voltage type. Therefore, no differential guard has been fitted. In the event that the machine is to be
connected to a different supply mains (TT, IT) or if foreseen by local laws or regulations, it is
necessary to fit differential guards according to the characteristics of the system and taking into
account the following conditions:

1. Measures to contain electromagnetic interference may cause high levels of high-frequency

dispersion current along the earth wire. For this reason it is necessary to choose a differential
switch that is not affected by high frequencies.

& BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
 $SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

2. Machine failures towards earth may occur even when using DC power (IEC 755).

3. The differential switch must be highly resistant to impulse overvoltage caused by atmospheric
electricity or manoeuvres (EN 61008-1) and to the 8/20 µs >1000A (VDE 0432 T2) wave test.

We recommend the use of the SIEMENS 5SZ3466-0KG00 or 5SZ6466-0KG00 differential

switches that should be fitted according to the instructions given by SIEMENS, or of other devices
with the characteristics listed here above.

For connection voltages of up to 400 V, the electrical cabinet of the machine is fitted with the
general disconnecting switch that is released automatically for short circuit currents of up to 10 KA
R.M.S. or 17 KA peak.

For connection voltages of more than 415 V, the disconnecting switch is able to withstand short
circuit currents of up to 5 KA.

If the presumed short circuit current at the supply point is higher, it must be limited.

&RQQHFWLQJ&DEOH

The cable connecting the machine to the supply mains shall be screened or shall pass in a metal
pipe in order to reduce the electromagnetic interferences. The screened cable or the metal pipe
shall be earth connected. The minimum section for the connecting cable shall be equal to 25 mm2
(220 V - 230 V), or 16 mm2 (400 V).

(OHFWULFDO,QVWDOOHG3RZHU

The machine is equipped with many electrical components. In order to know the electrical installed
power, see the machine identification plate.

3QHXPDWLF6\VWHP5HTXLUHPHQWV

The pneumatic system shall assure a supply pressure of 6.5 to 7 bars.

The compressed air consumption of the machine is equal to 100 Nl/min. It is crucial to know this
value in order to adapt the system.

6XFWLRQ6\VWHP5HTXLUHPHQWV

The suction system shall be connected permanently to the machine and shall always operate with
the machine. Moreover, it shall constantly supply a min. flow speed of 30 m/sec.

'$1*(5
3RRUSHUIRUPDQFHVRIWKHV\VWHPPD\EHLQMXULRXVWRWKHKHDOWK

BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
&
$SSHQGL[&
7UDQVSRUWDQG,QVWDOODWLRQ

A sectioning guillotine device shall be installed on the pipe connecting the suction system to the
machine in order to disconnect the machine from the general supply system. This device shall be
located in a highly visible position so that the operator shall have prompt access to it.

The air consumption for suction is equal to 2,500 m3/h. It is crucial to know this value in order to
adapt the system.

& BIESSE S.p.A. Woodworking Machinery

(l111h044.fm-141101)
$SSHQGL[' 'HFRPPLVVLRQLQJ'HPROLWLRQ

During the life cycle of the machine it may become necessary to dismantle it for transfer to another
site. If this is the case, proceed as indicated below.

1. Turn the machine off and disconnect it from all power sources.

2. Remove and put away all the tools that are in the machine.

3. Clean the machine and protect parts that are subject to corrosion using suitable products.

4. For transport and installation of the machine at the new site, use the methods and procedures
described in this manual.

The machine uses lubricating oil and grease. To neutralize the lubricant fluids which remain
attached to parts of the machine and cannot be re-used, use degradable solvents of an approved
type. For evacuation of recoverable lubricant fluids empty the tanks and deliver the fluids to the
local authority in charge of disposal. Any batteries, accumulators, buffer batteries for electronic
cards and conditioners that may be found in the machine must also be disposed of in a suitable
manner.

When the machine reaches the end of its technical working life it must be totally decommissioned
so that it can no longer be used for the purposes for which it was designed and built. This
procedure allows for re-use of the parts and raw materials contained in the machine. If any parts
are used again it must be for purposes other than those for which the machine was originally
constructed.

BIESSE declines all liability for damage to persons of things that may derive from any secondary
use of single parts of the machine for functions or assemblies other than those originally
contemplated. BIESSE recognizes no implicit or explicit suitability for specific purposes of any
parts of the machine which are used again after final decommissioning in view of demolition.

BIESSE S.p.A. Woodworking Machinery

(a112h005.fm-141101)
'
$SSHQGL['
'HFRPPLVVLRQLQJ'HPROLWLRQ

' BIESSE S.p.A. Woodworking Machinery

(a112h005.fm-141101)
$SSHQGL[( *XDUDQWHHDQGFOLHQWVHUYLFLQJ

( &RQGLWLRQVRIWKHJXDUDQWHH

BIESSE S.p.a. guarantees that the machine was tested at its own premises and that a positive
result was obtained.

The guarantee shall remain valid for a period of 12 months starting from the date of delivery unless
there is an agreement between BIESSE S.p.a. and the purchaser to define the commissioning of
the machine at the latter’s premises. When, however, it is agreed between both parties that
commissioning shall be performed at the purchaser’s premises, the guarantee shall be valid for a
period of 12 months starting from the date of commissioning of the machine at the purchaser’s
premises and, in any case, for a period of no longer than 9 months following the date of delivery.
Working hours over 48 hrs./week shall result in corresponding reductions in the period of validity of
this guarantee.

BIESSE S.p.a. shall be also considered liable for defects in electric and electronic parts of the
machine. The guarantee shall not cover defects caused by normal wear and consumption of those
parts which, by their very nature, are subject to rapid and continuous consumption e.g. gaskets,
belts, brushes, fuses etc. The guarantee for replaced or repaired components shall expire on the
same as expiry of the guarantee of the machine itself.

Furthermore BIESSE S.p.a. shall not be liable for any lack of conformity of the machine deriving
from a failure to observe regulations indicated in the instructions manuals and in any case due to
inappropriate use or treatment of the machine. The purchaser may thus demand that any parts
found to be faulty be replaced provided that such faults are not attributed to mis-handling and, in
the case of modification, provided that BIESSE S.p.a. has issued prior written consent.

The purchaser shall lose any right to this guarantee if he or she does not provide BIESSE S.p.a.
with a detailed written account of the nature of any defects of conformity found in the machine
within 15 days following discovery of the fact. Moreover, the purchaser shall lose his or her right to
this guarantee if he or she does not allow the vendor to perform all checks required or if, the
vendor having requested the return of a faulty component at its own expense, the purchaser fails
to return the component as soon as possible after such a request.

The technical documents which accompany the machine are prepared with close reference to the
content of the corresponding Directives and current safety regulations. It is therefore of the utmost
importance that the user read completely all volumes of the same in order to obtain from the
machine the best possible performance and to ensure the maximum lifetime to its component
parts.

The configuration of some parts or devices described or illustrated in the documents may differ
from the configuration actually present in the machine in a specific version designed and prepared
for particular requirements or safety standards. In this case, certain descriptions, references or
advised procedure may be of a generic nature although their effectiveness shall remain valid. The
supply of tools or special equipment with the machine is conditioned by the specific characteristics

BIESSE S.p.A. Woodworking Machinery

(a113h004.fm-141101)
(
$SSHQGL[(
*XDUDQWHHDQGFOLHQWVHUYLFLQJ

and safety regulations in force in each country. The drawings and photographs are supplied with
the sole aim of providing examples as a point of reference for a more complete understanding of
the text.

BIESSE products are constantly developed and updated and therefore the firm reserves the right
to modify functional or aesthetic characteristics of its machinery, to make variations in drawings of
any functional part or accessory or suspend production and supply without giving prior notice to
anyone and without incurring any obligation. BIESSE S.p.a. furthermore reserves the right to make
any structural or functional modification besides modifying the supply of spare parts and
accessories without any obligation on its part to inform anyone for any reason whatsoever of such
changes.

( &OLHQWVHUYLFLQJ

BIESSE S.p.A. provides a service department for clients, based in Pesaro, ITALY, which also has
service workshops all over the world (BIESSE Authorised Service Centres).

The whole structure forms a highly efficient integrated network, which the client can contact for any
problem, information, advice or news.
The service department employs technicians with a high level of knowledge and experience on the
models manufactured, obtained through special training in our factory, who are able to service
machines on site.

The BIESSE Authorised Service Centres are listed in the introduction the machine’s Spare parts
catalogue.

For further information, please send a fax message to the BIESSE Service Department, at the
following number: (+39) - 0721 - 439761.

( BIESSE S.p.A. Woodworking Machinery

(a113h004.fm-141101)
 $QDO\WLFDO,QGH[

$QDO\WLFDO,QGH[ blade 

enabling scoring with the Ø300 mm
blade 
locking the blades 
measuring the blade belts tension 
pneumatic unlocking device 
projection optimising control 
regulator of the cutting blade vertical
stroke 
replacement 
$ scoring blade 
adjustment scoring blade for postformed pieces 
of the blade alignment  start 
of the grooving depth  stop 
of the pneumatic system pressure  technical characteristics %
of the scoring depth  button
air conditioner on the electrical cabinet blade start 
cleaning  blade stop 
air for suction (see the suction system) emergency stop 
air jet panel support  start 
axes  stop 
CARRIAGE  working cycle start 
manual movement  working cycle suspension 
movement control (JOG) 
PUSHING DEVICE 
speed variation 
&
CARRIAGE, axis 
CE
% mark 
base  cleaning
shifting & electrical cabinet filters 
blade belts the air conditioner on the electrical
measuring the tension  cabinet 
replacement  the filters of the control panel 
blade belts tensioning  the machine 
dynamometer  client service department (
electronic tension measurement device collet (see rear collet stop)
 compressed air (see the pneumatic system)
blade carriage  connection
axes and origins  connection point for the electric system
technical characteristics % &
blades connection point for the pneumatic
adjustment of the blade alignment  system &
adjustment of the scoring depth  connection point for the suction system
belt replacement  &
blade access hatch opening control  connection points on the machine &
cutting blade  control panel , 
disassembling the blades  cleaning the filters 
electronic regulator for scoring blade main button pad 
 override 
enabling postformed pieces scoring  PLC keyboard 
enabling scoring with the Ø200 mm controls

BIESSE S.p.A. Woodworking Machinery

(l5801l0015IX.fm-141101)
L
$QDO\WLFDO,QGH[

automatic blade projection key  machine overall dimensions &

blade change selector  piece 
blade start button  draining condensate from the FR unit 
blade stop button  dust emission %
collet pressure selector  dust produced by the machine %
control panel  dynamometer 
cutting area laser selector 
emergency stop button 
immediate complete cut key 
immediate long cut key  (
immediate short cut key  electric system
JOG- key  connecting cable section &
JOG+ key  connection point &
key for piece side pushing  installed power &
key for pieces with projecting facings system requirements , &
 electrical cabinet 
key for scoring postformed pieces  cleaning filters 
key for scoring with the Ø200 mm blade cleaning the air conditioner 
 electrical cabinet filters
key for scoring with the Ø300 mm blade cleaning 
 electronic tension measurement device 
layout of the controls  emergency
main button pad  button 
main switch  emergency stop 
override  restart the machine 
PLC keyboard  encoder 
pushing device selector 
rear collet stop key 
RESET key 
start button  )
stop button 
filters of the control panel
ventilating fan start key 
cleaning 
working cycle start button 
foreseen machine use 
working cycle suspension button 
FR Unit 
cross cuts 
FR unit
cut-out valve 
draining condensate 
cuts for square-shaped openings 
cuts in sequence using fast programming 
cutting area 
cutting area laser 
on control 
*
cutting patterns  grooving 
using a cutting pattern  adjusting the depth 
using a series of cutting patterns  description of the device 
execution 
grooving device 
guarantee (
'
danger area 
decommissioning '
demolition '
,
safety information $ identification plates 
dimensions immediate cut 

LL BIESSE S.p.A. Woodworking Machinery

(l5801l0015IX.fm-141101)
 $QDO\WLFDO,QGH[

immediate cut using fast programming  machine shipment &

installation area & machine’s year of construction 
requirements & machining
cross cuts 
cuts of variable angular direction 
groove execution 
- grooving 
JOG+, key  immediate complete cut enabling 
JOG-, key  immediate long cut enabling 
immediate short cut enabling 
machining hold 
machining modes 
. machining start button 
machining suspension button 
key
making an immediate cut 
automatic blade projection 
making an immediate cut using fast
for piece side pushing 
programming 
for pieces with projecting facings 
making cuts for square-shaped
for scoring postformed pieces 
openings 
for scoring with the Ø200 mm blade 
making cuts in sequence using fast
for scoring with the Ø300 mm blade 
programming 
immediate complete cut 
piece loading 
immediate long cut 
possible machining types 
immediate short cut 
rip cuts 
JOG- 
square-shaped openings 
JOG+ 
using a cutting pattern 
rear collet stop 
using a series of cutting patterns 
RESET 
machining hold 
ventilating fan start 
machining modes 
main button pad 
location 
main switch 
/ maintenance intervention frequency 
lifting maintenance intervention summary 
the machine & maintenance interventions
list of the machine parts to be transported safety information $
& manufacturer
loading and unloading area  address 
lubricants  logo 
lubrication manufacturer’s address 
lubricants used  manufacturer’s logo 
mark CE 
movement area 

0
machine assembly &
machine configuration & 1
machine connection & NC 300 numerical control 
machine levelling & NC300 (see numerical control)
machine models noise emitted from the machine %
identification of model  noise level %
machine operation 
machine serial number 

BIESSE S.p.A. Woodworking Machinery

(l5801l0015IX.fm-141101)
LLL
$QDO\WLFDO,QGH[

2 3
operating section  panel support 
access door  piece
adjustment of the blade alignment  characteristics 
adjustment of the scoring depth  dimensions 
axes and origins  piece loading 
belt replacement  on the right-hand side 
blade belts tensioning  PLC keyboard 
blade carriage  location 
blades replacement  pneumatic pressure
cutting blade  supply pressure &
description of parts  pneumatic system
disassembling the blades  compressed air requirements &
electronic regulator for scoring blade connection point &
 cut-out valve 
grooving device  pressure adjustment 
locking the blades  pressure regulators 
pneumatic unlocking device for blades supply pressure &
 system requirements , &
regulator of the cutting blade vertical pneumatic system pressure regulators 
stroke  postformed pieces
regulator of the stroke  scoring blade 
scoring blade  scoring enabling control 
scoring blade for postformed pieces  presser 
technical characteristics % regulator of the vertical stroke 
operating section access door  safety bar 
opening control  pushing device 
optionals axes and origins 
air jet panel support  movement suspension control 
cutting area laser  technical characteristics %
electronic regulator for scoring blade PUSHING DEVICE, axis 

grooving device 
pneumatic unlocking device for blades
 5
rear collet stop for pieces with projecting rear collet stop 
facings  axes and origins 
regulator of the cutting blade vertical collet opening and clamping control 
stroke  working pressure setting control 
regulator of the operating section stroke rear collet stop for pieces with projecting
 facings 
regulator of the presser vertical stroke enabling control 
 regulator
right-hand side machine  for scoring blade (electronic) 
scoring blade for postformed pieces  of the cutting blade vertical stroke 
side pusher stroke regulator  of the operating section stroke 
side pusher with front roller  of the presser vertical stroke 
stop for cuts of variable angular of the side pusher stroke 
direction  replacement
origins  blade belts 
override  blades 
RESET, key 
restart

LY BIESSE S.p.A. Woodworking Machinery

(l5801l0015IX.fm-141101)
 $QDO\WLFDO,QGH[

the machine  air required for suction &

right-hand side machine  connection point &
rip cuts  minimum flow speed &
system requirements , &
switching off
the machine 
6
safety $
during tool installation $
machine demolition $ 7
machine maintenance $ tool
safety (see also safety devices) safety information $
safety bar  transport
safety curtain  list of the machine parts to be
safety devices  transported &
cut-out valve  weights of the machine parts to be
emergency button  transported &
operating section access door 
safety bar 
safety curtain 
selector 8
blade change  unloading
collet pressure  the machine &
cutting area laser 
pushing device 
shifting
the machine & 9
side pusher 
ventilating fans
enabling control 
start control 
pressure regulator 
stroke regulator 
technical characteristics %
with front roller 
side stop 
:
square-shaped openings  weight
making  of the machine 
start weights of the machine parts to be
blade start control  transported &
cutting area laser start control  wheel panel support 
machine start control  work area 
ventilating fan start control  working cycle suspension
working cycle start control  button 
start-up procedure 
of the machine 
stop
blade stop control 
of emergency 
of program 
stop control 
the machine 
types of machine stops 
stop for cuts of variable angular direction 
suction system

BIESSE S.p.A. Woodworking Machinery

(l5801l0015IX.fm-141101)
Y
$QDO\WLFDO,QGH[

YL BIESSE S.p.A. Woodworking Machinery

(l5801l0015IX.fm-141101)
%,(66(6S$
6LWR&KLXVDGL*LQHVWUHWR
9LDGHOOD0HFFDQLFD
3HVDUR ,WDO\
7HO
KWWSZZZELHVVHLW
KWWSZZZELHVVHFRP