0% found this document useful (0 votes)
138 views103 pages

Matt

Uploaded by

namubiruelse74
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
138 views103 pages

Matt

Uploaded by

namubiruelse74
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 103

Item Element of Construct Topics

Item one Numbers 1. Number bases


2. Working with Integers
3. Rectangular Cartesian Coordinates in 2-
Di-mensions
4. Fractions,percentages and decimals
5. Numerical concepts 1 and 2
(a) Indices
(b) Surds
6. Ratios and Proportions

Item two Patterns and Algebra 1. Sequence and patterns


2. Equation of lines and curves
3. Algebra 1 and 2
4. Mappings and relations
5. Vectors and translation
6. Inequalities and regions
7. Equation of a straight line
8. Simultaneous equations
9. Quadratic equations
10. Composite functions
11. Equations and inequalities
12. Linear programming
13. Loci
Item three and four Data and Probability 1. Data collection/display and presentation
2. Graphs
3. Set theory
4. Matrices
5. Probability

Item ve and six Geometry and Measures 1. Geometric Constructions Skills


2. Bearings
3. General and angle properties of
geometric
gures
4. Re ection
5. Business mathematics
6. Time and time tables
7. Similarities and enlargement
8. Circles
9. Rotation
10. Length and area properties of
two-dimensional geometrical gures.
11. Nets, areas and volumes of solids
12. Trigonometry
13. Vectors
14. Matrix transformations
15. Circle properties

Page 1 of 103
16. Lines and planes in three dimensions

Item Area of construct Topics covered

SECTION A: compulsory
Item one Numbers  Number bases
 Working with integers
Learner appreciates  Fractions, percentages and decimals
 Numerical concepts 1 and 2
and uses
 Ratios and proportions
computationalskills
to solve problems in
real- life situations.
Item Two Patterns and  Sequences and patterns
algebra  Equations of lines and curves
 Algebra 1 and 2
 Mapping and relations
Learner appreciates  Inequalities and regions
and uses analysis to  Equation of a straight line
solve problems in  Rectangular Cartesian plane
real-life situations  Simultaneous equations
 Linear programming
 Loci
SECTION B
PART I (choose one question)
Items 3 and 4 DATA AND  Data collection and presentation
PROBABILITY  Graphs
 Set theory
 Data collection and display

Page 2 of 103
Learner appreciates  Matrices
and uses logical  Probability
reasoning to solve
problems in real-
life situations

PART II (choose one question)


Items 5 and 6 GEOMETRY  Geometric construction skills
AND  Bearings
MEASURES  General and angle properties of geometric
figures
 Reflection
 Business arithmetic
 Time and time tables
Learner appreciates  Similarities and enlargement
and uses spatial
 Circles
 Rotation
reasoning to solve
 Length and area properties of two-dimensional
real-life situations geometrical figures
 Nets, areas, and volumes of solids
 Trigonometry 1 and 2
 Vectors
 Business mathematics
 Matrix transformation
 Circle properties
 Lines and planes in three dimensions

SECTION A
(Numbers, Patterns and Algebra)
ITEM 1
The new farm manager who started work at Sugar Corporation of Uganda Limited's Lugazi farm on Monday
was unable to access the farm store, which held critical records, due to password–protected locks. He reached
out to the farm owner, who replied with a message revealing that the password was a two-digit base eleven
numeral. The pin had the characteristic that the total of its digits equaled 17, with the first digit being 4 greater
than the second.
He gained entry to the store and obtained access to the records, revealing that the farm had a sizable amount
of land available for crop cultivation. He intended to allocate 14% of the land for corn, 30% for wheat, and
the remainder for soya beans, with a specific focus on planting corn on 42 – acres. Meanwhile, he discovered
that his 12 farm workers could cultivate 15 acres every 4 days.
TASK
a) Educate the new manager on the pin‟s decimal representation.
b) Ascertain the farm‟s total land area and the remaining acres suitable for soybean growth.
c) Help the farm manager understand how long it will take workers to get the land ready for
planting.

Page 3 of 103
ITEM 2
At the beginning of term two, Kumasi secondary school's administration faced a pressing issue: - a shortage of
dormitory space for students. To address this sleeping accommodation deficit, the school's management
developed a plan to construct new hostels with a rectangular design, where the length is
√3 times the width, resulting in a perimeter of (14+6√3) units. To fund this project, the administration required
a 97% collection rate of school fees from students
By the end of the first week of the term, two-thirds of the student body had settled their fees. In the
subsequent week, an additional 100 students paid their fees, resulting in a significant increase in the
proportion of students who had paid their fees, reaching three-quarters of the total student population.
TASK
a) Guide the school management to ascertain the land area, ensuring a surd form solution with
rationalized numerals and simplified radicals.
b) Ascertain the precise number of students in the school.
c) Guide the school administration on whether the construction can be undertaken, withsupporting
reasons.

ITEM 3
Mr. Alex, a seasoned bus driver at the New Taxi Park, was hired to transport 377 students for a field trip from
Mukono to Entebbe. When the geography teacher inquired about the best route, Mr. Alex expertly outlined
two alternative routes, ensuring a smooth and informed journey from Mukono to Entebbe. The shorter route
takes 2 hours and 26 minutes to complete, with the driver maintaining an average speed of 54km/h for the first
x kilometers and 37.5km/h for the last y kilometers. The longer route, which is 5km longer than the shorter
route, takes the driver 2 hours and 12 minutes to complete at an average speed of 60km/h. The driver also
charges a fare of Shs 1000 per student per kilometer.
TASK
a) Create two mathematical models involving x and y which can be used to help in the analysisof the
two routes.
b) Help Mr. Alex by revealing the hidden values of 𝑥 and 𝑦 from the equations in (a) above.
c) Guide the geography teacher on the best route, highlighting the benefits of your proposedoption.
ITEM 4
Garden City Shopping Mall in Kampala is experiencing a massive turnout of customers, leading to acritical
shortage of parking spaces. To address this challenge, the mall's management has planned aninnovative
solution: - a triangular rooftop parking design, exclusively designed for compact cars, each spanning an area
of 0.2 square units, to cater for the growing demand of space. The parking area is bounded by the following
constraints; 𝑥 + 𝑦 < 3 , 𝑥 − 𝑦 + 3 ≥ 0, and 𝑦 + 1 ≥ 0. To capitalize on the high demand for parking, the
mall plans to impose a parking fee of Shs 2500 per vehicle, with calculations indicating that on peak days,
the cars will occupy a total area of 12.4 square units, yielding a significant income source.
TASK
a) (i) Create a graphical representation on paper to help Garden City management accuratelyvisualize
and understand the layout and boundaries of the new parking design.
(ii) Assist the management in identifying the accurate coordinates and size of the new parkingarea in
square units.

Page 4 of 103
Will the new design accommodate the expected maximum number of vehicles? If so, determine the maximum
number of cars that can be accommodated in the new parkingarea at full capacity.
b) Forecast the mall‟s daily highest revenue on a peak day.
ITEM 5

Following the passing away of your cousin's father, the family convened a month later to settle his estate and
read his will, to which you were invited. However, a surprise revelation emerged when the youngest child
revealed a mysterious envelope left by their father, containing a secretive message. The envelope contained a
piece of paper with the number 31, which needed to be converted to a ternary numeral system (base three) to
unlock the secret code to gain access to his office strongbox. But, to their dismay, none of the family
members recalled how to perform the conversion, and they turned toyou for assistance. the secret code to gain
access to his office strongbox.

Upon opening the safe, they discovered a staggering 349 million shillings and a will outlining the distribution
of the wealth. The will stipulated that the wife was to receive 40% of the total, the eldest son was to receive
one-third of the remaining amount, and the two younger children were to share the balance in a 2:3 ratio
according to their birth order. To ensure a fair and impartial distribution, your expertise was sought once
again to calculate the exact share for each beneficiary, preventing any potential disputes or biases.

TASK;

a) Show how you helped your cousins unlock the safe, showing each step clearly
b) Show, with step-by-step calculations, how you helped the family allocate the funds among its
members, and share your thoughts on the distribution's fairness.

ITEM 6

The Uganda Women's Finance and Credit Trust has arranged a group outing for its members, using two
vehicles; a bus and a van. with 171 participants having paid the required fees, a total of UGX 400,000 has
been allocated for transportation costs. Your sister, who is responsible for managing thetransportation, needs
your mathematical expertise to optimize the vehicle hire strategy. She wants tominimize transportation costs
while ensuring the van, which is faster and can carry 19 people at UGX 50,000 per trip, makes more trips
than the bus, which can carry 57 people at UGX 80,000 per trip.

TASK;

(a) Express the information as mathematical statements

(b) Help your sister minimize transportation expenses by determining the number of trips eachvehicle
should make, using the mathematical statements in (a) above.

ITEM 7

Molly started a wholesale business while still at her parent‟s home. Below is how she plans to useher net
profits.

 20% of the net profits to be re-invested in the business.

Page 5 of 103
 Part of the balance is to be saved in her savings account and the rest is to be for her major
personal expenses. This will be in the ratio of 1:3 respectively.

She plans to move out of her parent‟s house if the portion of her net profits that she plans to spendon her
major personal expenses can cover all of them. Her major expected personal expenses are; house rent of
about UGX.300,000, and groceries of about UGX. 200,000 and transport of about UGX. 100,000. The
business made a net profit of one million five hundred thousand Uganda shillings in the first month.
She bought 36 bars of bathing soap and 18 packets of detergent that were all to be packed by her worker in
such a way that each package contained the same number of both items. The packages were to be given to
those who bought goods in plenty as gifts. All packages were given out beforeMolly got to know the
highest number of packages that her worker was able to make out of the bought items.
TASK:

a) (i) How much of her net profit does she plan to re-invest in the business?
b) (ii) How much of her net profit does she plan to spend on personal expenses?
(ii) Will Molly move out of her parents' house? Justify your answer.
c) Help Molly to know the highest number of packages her worker was able to make out of theitems
she bought.

ITEM 8:
James is starting a baking business, selling cakes and cookies. To estimate profits, he consulted a friend in the
industry. The friend shared data from their own experience: Initial phase: 40 cakes, 30 cookies, total profit
UGX 29,000; Later phase: 50 cakes, 20 cookies, total profit UGX 31,000.
James aims to start by producing at least 120 items (cakes and cookies combined). Since cakes sell more, he
wants to make at most 80 cakes and at most 60 cookies. He needs to determine the optimal number of cakes
and cookies to produce initially.

TASK;

a) What are the expected earnings from each cake and cookie, based on his friend's experience?
b) (i) What mathematical inequalities are making decision-making hard for James?
(ii) Use the inequalities to help him decide on the highest number of cakes and cookies he canstart
with.

SECTION B: PART I (DATA


AND PROBABILITY)
ITEM 9
To enhance the yields of Rice, Beans, Sugarcane, and Peas in Iganga district, the Ministry of Agriculture's
Farmer Training and Capacity Building program conducted a survey, yielding the following findings; Among
the 80 rice farmers surveyed, 45 also grow beans, 60 cultivate sugarcane, and 5 focus solely on peas and rice.
Additionally, 5 farmers dedicate their land solely to rice. The number of farmers who grow beans,
sugarcane, peas, and rice is equal to those who grow peas,

Page 6 of 103
sugarcane, and rice. Moreover, the farmers who cultivate rice, and sugarcane only are equal in number to those
who grow rice, peas, and beans, and are 5 fewer than those who grow all four crops.
The ministry plans to provide support to these farmers as follows:

 A farmer who cultivates all four crops (beans, sugarcane, peas, and rice) will receive a package
consisting of 4 tractors and a cash grant of UGX 3,000,000.
 One who plants only three crops will receive 3 tractors and UGX 2,000,000.
 A farmer who grows two crops only will receive 2 tractors and UGX 1,500,000.
 For a single crop will receive 1 tractor and UGX 1,000,000.
This support aims to motivate farmers to diversify their crops and boost their productivity.
The ministry needs to calculate the total cost of tractors for farmers, based on the number of tractors needed
for each group, with each tractor costing UGX 68,000,000.

TASK

a) Assist the ministry in determining:


(i) The total number of farmers cultivating all four crops
(ii) The number of farmers growing only three crops
(iii) The chance of selecting a farmer who grows only two crops in Iganga district
(iv) The likelihood of selecting a farmer who does not grow Peas
b) Set the total funding required for the ministry's farmer support initiative.
ITEM 10
To address concerns about battery durability, Uganda Batteries Limited (UBL), a trusted manufacturer since
1967, conducted a thorough test on a random sample of 50 batteries. Their experts carefully selected and
examined these batteries, yielding the following results (rounded to the nearest minute):

423 369 387 411 393 394 405 369 372 410

371 377 389 409 392 408 409 396 431 391
431 401 363 391 405 382 396 381 438 422
400 381 399 415 428 422 397 399 401 398
396 372 410 419 386 390 362 373 391 402

The director has decided to withdraw batteries with a life equal to or less than the average lifespan of the
tested samples and has directed the experts to manufacture only batteries that achieve at least 99
% of the median life of the 50 tested batteries.

TASK

a) (i) Organize the data into intervals of 10 using a statistical table and analyze the trends to
recommend the most effective battery replacement strategy to the director
(ii) Elaborate on the reasoning that led to your conclusion in a) i)
b) (i) Develop a graphical display to illustrate the data, allowing the director and their team toestimate
the median, visualize and analyze the information
(ii) Identify the target battery lifespan for manufacturing, as recommended by the director.
(iii) Analyze the graph and explain the situation, backing your argument with data and logical
reasoning.

Page 7 of 103
c) Aid the manager in recognizing the chance of selecting a battery with a lifespan greater thanor equal
to the median value.
ITEM 11
The recently concluded Uganda Secondary Schools Sports Association (USSSA) tournament was largely
dominated by schools from the western region, prompting head teachers of participating schools to request
detailed reports from their games‟ teachers on transportation and prize monies received during the football
competition
The four schools that dominated include; Fort Porto SS, Tororo SS, Nyakasura HS, and Kyogera HS. Due to
limited funds, the four schools decided to use two buses; Fort Portal ss and Tororo ss used the Tausi bus which
charges UGX. 24,000 per Km while Kyogera HS and Nyakasura HS used Global coaches that charge UGX.
28,000 per Km.
On the tournament day, Tausi Bus embarked on its journey from Mbarara to Kampala at 4:30 a.m., cruising at
a steady 80 Km/hr and arriving in Kampala at 9:00 a.m. Simultaneously, Global Bus set off from Sanga town,
50 Km from Mbarara, at 4:30 a.m. and traveled at a constant 50 Km/hr for 3 hours and 30 minutes before
pausing for 30 minutes. It then resumed its journey at a steady 67.5 Km/hr until it reached Kampala, with the
bus fare being equally distributed among the participating schools that used the bus.
Upon arrival in Kampala, the four schools competed in a two-round football tournament 1st

round 2nd round


Win Draw Loss Win Draw Loss
Fort Portal 1 3 2 Fort Portal 1 2 3
Tororo 2 2 2 Tororo 2 1 3
Nyakasura 3 2 1 Nyakasura 2 3 1
The tournKaymoegnetrfaollowe0da stand2ar
d point4s system: three points forKayvoigcetorray, one1point for4a draw1,and zero
points for a defeat. Additionally, the four teams shared a prize pot of UGX 24,000,000, allocated
proportionally to their points tally
TASK

a) (i) Assist the games teachers in plotting the buses' routes on a graph, enabling a more helpful
evaluation of their journey.
(ii) Provide the games teachers with the information needed to determine each school's
transportation expenditure.
(iii) Ascertain the first bus to arrive in Kampala and the time gap between its arrival and the
subsequent bus.
b) Ascertain the winning and last teams and amount given to each team that participated in the
tournament.

ITEM 12
The school administration aims to enhance the mathematical abilities of senior 3 students. Last year, the
students achieved an average score of 64% by the end of term one, and this year's performance at the same
stage is as follows;

Page 8 of 103
30 47 26 86 64 87 49 25 26 43
38 52 44 45 56 59 76 46 27 89
57 89 73 90 48 58 51 88 32 56
62 68 52 66 67 69 49 95 92 66
74 36 32 54 39 35 69 92 50 71

The school administration is contemplating either adding another teacher, buying more books, or both. The
school administration will do both if the average for this year‟s performance at the end of term one is lower
than that of the previous year.

According to the library survey report, last year's students primarily utilized three mathematics textbooks:
Longhorn (L), Baroque (B), and Active Mathematics (A). Notably, students who did not use any of these
three textbooks struggled significantly in the subject, resulting in poor grades. This year, out of 35 students,
the textbook usage breaks down as follows: 13 students used Longhorn, 20 used Baroque, and 17 used Active
Mathematics. Additionally, 9 students used both Longhorn and Active Mathematics, 7 used both Longhorn
and Baroque, and 8 used both Baroque and Active Mathematics. Notably, 5 students did not use any of the
three textbooks;

The school administration has a budget to double the number of students who utilize all three
textbooks.

TASK:

a) Provide a data-driven analysis to inform the school administration's decision on whether tohire an
additional teacher, purchase more books, or implement both solutions.
b) (i) Guide the school administration on the number of books they can purchase, consistent withtheir
initial budgetary framework.
(ii) Do you have any other recommendation to the school administration regarding the book
purchase? Explain your reasoning.

ITEM 13.
A non-governmental organization aims to teach French, German, and English to lower primaryschool
children in its community schools.

The organization intends to offer language instruction in French, German, and English to students in their
schools. They plan to offer permanent positions to candidates who can teach all three languages, while those
who can teach one or two languages will be hired on a contract basis. To fill these positions, they are
soliciting applications from qualified teachers. Out of the applications received, 29 candidates can teach
French, with 7 able to teach French only and 22 able to teach French plus one or both of the other languages.
27 candidates can teach German, with 9 able to teachGerman only and 18 able to teach German plus one or
both of the other languages. 30 candidates canteach English, with 11 able to teach English only and 19 able to
teach English plus one or both of theother languages. The organization will only consider candidates who are
proficient in at least two languages for oral interviews. Your friend has been tasked with identifying the
eligible candidates

Page 9 of 103
and needs your assistance in analyzing the data to determine the number of candidates who meet thecriteria.

TASK

(a) Apply your mathematical expertise to help your friend know the number of candidateseligible
for an oral interview.

(b) The organization has a program for teachers who can teach all three languages (French,
German, and English). They'll be rotated among schools and paid more. What's the likelihood
of a random applicant being in this program?

ITEM 14

In a certain town, there is a section of the road where many accidents occur and the residents believeit is due
to over speeding so they have requested the authorities to build humps along that section, the chairperson of
the roads committee has decided to do some research so a checkpoint has been putat that section to measure
the speed of 50 vehicles passing that point. They will put humps if the research shows that the percentage of
vehicles passing that point at a speed greater than the speed limit is greater than those who abide by the speed
limit. The road sign shows a speed limit of 55km/hr for that section. The results for the 50 vehicles sampled
are shown in the table below.

Speed(km/hr) 20-30 30- 40 40- 50 50- 60 60- 70 70- 80 80- 90 90- 100

Number of 5 8 7 9 6 5 4 6
vehicles

TASK;

(a) Assist the chairperson in determining the average speed at which vehicles pass that point.

(b) Present a graphical analysis to guide the committee's choice of implementing traffic calming
measures.

ITEM 15
The headteacher of a certain school wants to hold a meeting on one of the following days: Monday,Tuesday,
or Wednesday. The purpose of the meeting is to communicate something important.
The headteacher wants to schedule the meeting in a way that the probability of some teachers (out of70) not
attending the meeting is less than 0.5 (or 50%).
The following information shows which teachers attend school on Monday, Tuesday, and
Wednesday and which teachers are absent:10 teachers come on Monday only.

Ten teachers attend school only on Tuesday, twelve teachers attend school only on Wednesday, eightteachers
attend school on both Monday and Wednesday, and Seven teachers attend school on both Monday and
Tuesday. Nine teachers attend school on both Tuesday and Wednesday. Three teachers attend school on all
three days. Some teachers do not attend school on any of the three days

Page 10 of 103
TASK:

a) Is it advisable for the headteacher to hold the meeting on any of the days he has chosen?Support
your answer with a reason.
b) Which day would you recommend out of the three options, and what is the basis for your
recommendation?
ITEM 16.
A sports organization is selecting team members to participate in marathon competitions from a group of 60
individuals. The selection process will occur in two phases. In Phase One, participants who complete the race
within 137 minutes or less will qualify for Phase Two. Then, in Phase Two, those who finish within 122
minutes or less will be selected to participate in the actual competitions,which is the ultimate goal.
The following is a breakdown of the times achieved by the participants in Phase One;

Finish time (mins) 120 - 124 125 -129 130 -134 135 -139 140 -144

Number of people 15 14 13 11 7
TASK:
a) (i) How many participants advanced to Phase Two?
(ii) What is the likelihood that some of the qualifiers from Phase Two will go on to
participate in the final competitions?
(iii) Based on the probability value, what is the likelihood of the organization finding suitable
participants for the competitions from the group?

ITEM 17.

Maria, a surveyor, embarks on a journey from Mukono to a Kampala construction site to perform crucial soil
testing, as the soil's sand content plays a critical role in ensuring foundation stability and preventing potential
settlement or foundation failure due to excessive sand. Maria's journey begins with a 30 Km stretch on a
bearing of 080° to Kalagi, followed by a 330° turn and a 40 Km drive to Gayaza. Finally, she heads on a
bearing of 30° to reach the construction site in Kampala which is on a bearing of 020° from her starting point
in Mukono. Upon arrival, she collects soil samples at variousdepths and records the sand content percentage in
the table below:

Soil depth (x) 35 65 55 25 45 75 20 90 51 60

Percentage of sand (y) 86 70 84 92 79 68 96 58 86 77


Maria needs to create an appropriate graph to visualize the relationship between depth and sand content and
calculate the total cost of surveying materials; including 50 meters of measuring tape at UGX. 10,000, 20 soil
sampling bags at UGX. 5,000 each, and fuel at UGX. 6,000 per Km that she traveled. She will submit the
calculations to apply for funding from her company.

Page 11 of 103
TASK

a) Help Maria draw a precise diagram illustrating her journey, including bearings and distances.
b) (i) Develop a scatter plot to illustrate the relationship between depth and sand content, aidingMaria in
her data analysis.
(ii) Describe the relationship between soil depth and sand percentage, including any trends orpatterns
you observe.
(iii) Plot a line of best fit through the scatter diagram data, and use it to:
- Predict the sand percentage at a depth of 31 cm
- Estimate the depth at which the sand percentage is 54%.
c) Assist Maria in preparing a budget proposal to fund her project activities, including her returntrip to
Mukono via the same route. (20 marks)

SECTION B: PART II GEOMETRY


AND MEASURES
ITEM 18.
The school club is holding a fundraiser by selling chappattis, which they've made and packaged in special
containers. Each chapatti is 14 cm in diameter, has a uniform thickness of 6 cm, and is divided into six slices.
The containers, shaped like a chapatti slice, each have a marked price of UGX 1000 and can hold 14,784
cubic centimeters. The cost of making each slice is UGX 140. By the end of the day, they had sold 2,000
chapattis at UGX 400 per slice, and the seller of the containers gives a 10%
22
discount to whoever buys by cash terms. ( take 𝜋 = )
7

TASK

a) (i) Help the members of a school club to know the number of slices that can be loaded intoeach
container.
(ii) Ascertain the number of containers needed to pack the entire batch of slices.

b) (i) How much money was generated from the fundraising event?
(ii) Provide a calculation-based recommendation to the club on whether to continue this
business venture in the future, given that the containers were bought on cash terms.

ITEM 19
Stanbic Bank, a prominent African financial institution, seeks to revamp its logo to align with its values and
appeal to a newer, younger demographic generation. The current logo, a triangle with

Page 12 of 103
coordinates A(2, 3), B(4, 1), and C(1, 2) on a white rectangular background, is due for a refresh. Thebank's
graphic designer has suggested the following design modifications to enhance the logo;
Keep the original triangle in place, but turn it 90 degrees counterclockwise around the origin. Then, mirror
the resulting triangle across the horizontal axis. Next, scale up the new triangle by a factor of3 about the
center (-5, -2), creating a logo with four triangles. Paint only the enlarged triangle with ared-to-white ratio of
3:5, using red paint that costs UGX 20,000 per square centimeter and white paint that costs UGX 15,000 per
square unit. The bank has set a budget limit of UGX 205,000 per logo for painting.
TASK
a) (i) Assist the designer in creating a precise layout of the logo, showcasing the exact placementof the
four triangles on the same material.
(ii) Specify the exact vertices of the new triangles.
b) Using data-driven insights, recommend to the bank owners whether to adjust their allocationfor logo
painting expenses.
ITEM 20.
Uganda Crop Care Limited (UCCL) has secured a contract to supply liquid fertilizer in Kenya, with a
requirement to package it in cylindrical tanks measuring 15 meters in height and 4 meters in radius.Currently,
the company stores its liquid fertilizer in metallic buckets with dimensions of 10 meters inheight, 1 meter in
lower radius, and 3 meters in upper radius. To fulfill the order, UCCL needs to determine the number of
buckets required to fill 100 tanks. Each metallic bucket costs UGX 8000 to manufacture, and the company
sells the fertilizer at UGX 3600 per liter. The manager at UCCL needs to calculate the number of buckets
needed and evaluate the cost implications.
TASK

a) Ascertain the number of buckets needed to fill all the required tanks.
b) Establish the total cost that will be required to manufacture the required metallic buckets.
c) Based on calculations, evaluate UCCL‟s potential for success.
ITEM 21.
In Mukono town, a mobile vendor, previously operating outdoors, has been hindered by inclement weather
conditions affecting their seating area. To combat this, they have decided to acquire four „three-sided table
surfaces‟, identical in size, to provide a shielded space. Each table will feature a central hole to accommodate
a circular umbrella, covering the tabletop's vertices. With a side that is distinct from the two equal sides,
measuring 4.5 meters, the tables will form isosceles triangles with two equal angles of 65 degrees each. The
furniture maker quotes a price of Shs. 300,000 per table, offering a 5% discount for cash payments, providing
a more conducive and protected environment forthe vendor's operations.

Page 13 of 103
The mobile vendor requires the tables to be fabricated within a tight 48-hour deadline. The furniture maker
began working on the tables on Monday at 7: 30 am, with a schedule of 7:30 am to 4: 00 pm, including a 30-
minute break from 1:30 pm to 2:00 pm. Each table surface requires 5 hours of work tobe completed.
TASK

a) Assist the furniture maker in drafting designs for the tabletop surfaces that meet the mobile
vendor‟s requirements.
b) How much will the mobile vendor pay in cash for the four tables?
c) When will the tables be ready for delivery?
d) Recommend the minimum umbrella radius to the mobile vendor for optimal table shading.

ITEM 22.
James, a petroleum engineering master's graduate from Makerere University, has landed a job at a Ugandan
NGO. The organization offers a comprehensive benefits package, including.

o Housing allowance: Shs. 14,000 per month


o Marriage allowance: y
o Medical allowance: Shs. 50,700 per annum
o Transport allowance: Shs. 10,000 per month
However, James must pay an annual insurance premium of Shs. 68,900. He has five children, with three
under 8, one 16-year-old, and a 20-year-old. The NGO provides a family allowance for four children, as
follows: Shs. 3,400 for each child above 18 years; Shs. 4,200 for each child between 10- 18 years; Shs. 5,400
for each child below 9 years.
The tax rates for working-class citizens in Uganda are shown in the table below:

Income (Shs) per annum Tax rate (%)


1st Shs. 80,000 7.5
Next Shs. 80,000 (80,001 – 160,000) 12.5
Next Shs. 80,000 (160,001 – 240,000) 20.0
240,001 – 320,000 30.0
320,001 – 400,000 36.5
400,001 – 480,000 45.0
Above 480, 000 52
The accountant revealed to James that his annual income taxes would be Shs 100,320. James was confused
because he didn't understand how his income was calculated, and he didn't know how to figure out his gross
annual income. He also learned that his annual total tax free – income would exceed his taxable income by
24%.
James aims to constantly set aside half of his annual net income to purchase a 40 m x 22 m plot in Kayunga
village within the next ten years, taking advantage of the stable land prices. The land is expected to be priced
at UGX 4,000 per square meter within this time frame.

TASK
a) (i) Help James arrive at his accurate taxable income figure through careful calculation andlogical
thinking.
(ii) Assist James in understanding his annual marriage allowance compensation.
(iii) Support James in figuring out his annual take-home pay.
b) Assist James in determining if he can reach his goal of purchasing the land within the desired
timeframe.

ITEM 23

Page 14 of 103
Your sister has started a new role in packaging design, and her boss has given her a new gift-wrappingdesign to
assemble as a sample for a client meeting tomorrow. She's running into trouble and needs your help to get it
finished overnight.

She is also supposed to determine the material that will be needed to make each for her company to plan well.

Your sister also tells you that she will be getting a salary of UGX.1,000,000 per month which includes, a
transport allowance of UGX.200,000 and a lunch allowance of UGX.6000 per day only for the five days she
works.

She wants to open up an insurance policy for her child that will need her to pay a premium of UGX.250,000
per month and also remain with UGX.400,000 for upkeep for the month but also has to pay tax using the rates
below;

Taxable income Tax rates %


0 - 235000 0
235000 - 335000 10
335000 - 410000 20
410000 - 1500000 30
She's uncertain if she'll have sufficient funds left to cover the insurance premium.

TASK

(a) (i) Show her what the pack will look like after it has been assembled.

(ii) Use your mathematics to help your sister determine the material required to make one pack.

(b) Will your sister be able to pay her child‟s premium?

Page 15 of 103
ITEM 24

Your father is one of the organizers of a marathon they want to draw the map of the route that the participants
will during the race.

At their chosen starting point they chose to take a road that turned E30 oS and they moved for 5km where they
set up point B which will be used as a checkpoint, they then turned through 235o moving a distance of 9km to
point C which will be the finishing point, however on returning to the office they decided that the finishing
point should be put at point A to cut costs of organizing the two places but they were not sure of the details of
that route from C to A that had to be included on the map.

They want to hire a vehicle that will be used to film the racers, the vehicle available consumes 2 litres per km
and a litre costs UGX.5500, the owner of the vehicle has asked for UGX.500,000 plus fueling the vehicle for
the total distance to be covered but the vehicle owner plans to buy fuel from the fuel station where he is given
a discount of 5% for every 100,000 worth of fuel he buys since he is a regularcustomer.

TASK;

(a) Help your father determine the direction from point C to the new finishing point A that will beshown
on the map to be drawn.

(b) (i) You are required to determine the total cost of hiring the vehicle.

(ii) Do you think the vehicle owner will save some money on fuel if so how much?

ITEM 25
A man took out a loan of 5,000,000 Ugandan shillings from the bank at a compound interest rate of20% and
was supposed to repay it within 3 years. However, with the deadline approaching, he has yet to raise the
necessary amount.
He decides to sell one of his plots of land for 14,000,000 Ugandan shillings to raise the funds to payoff the
loan. However, the buyer negotiates a 10% discount on the price. If he accepts the offer and sells the land,
the broker will charge a 5% commission on the sale price. Additionally, the LC1 is requesting 350,000
Ugandan shillings to sign the agreements. He is uncertain whether the remainingamount will be sufficient to
cover the loan he needs to repay.
He needs to pick up the child from school by 5:00 pm. However, it's currently 4:45 pm, and he's justleaving
the broker's house, which is located a certain distance away from the school (as shown below). Considering
he drives at an average speed of 50km/h, he's unsure if he'll arrive on time.

16 | P a g e

Page 16 of 103
TASK:

a) (i) What is the outstanding loan amount he needs to settle with the bank?
(ii) Will he be able to pay off the loan if he sells the land?
b) Will he arrive at the child's school on time?

ITEM 26
Moses, an employee at a gift box manufacturing company, has been tasked with designing a foldablegift
box with square faces and a capacity of 2744 cubic centimeters. He's struggling to create a sketch that will
guide him in arranging the faces of the box to fold and close, as well as determining the dimensions of each
cardboard piece to cut and join to achieve the desired outcome.
He normally receives a monthly salary of 300,000 Ugandan shillings with no additional allowances.
However, the company will start deducting taxes from his pay every month, and he needs to determine his
new take-home pay. The company will follow the tax brackets shown below:

Monthly taxable income (Ugx.) Rate(%)

0–100,000 0
100,001–200,000 5
200,001–300,000 10
He needs to deliver the gift box to the customer and charges a delivery fee based on the amount of fuel
used. His motorcycle uses 0.035 liters of fuel per kilometer, and he travels at an average speed of 20 meters
per second. With fuel priced at 5,000 Ugandan shillings per liter, he wants to calculate the delivery fee.
According to the customer, the journey will take 45 minutes.
TASK:

a) Help Moses develop a sketch outlining the specifications he needs.


b) What is the new salary Moses will be receiving monthly?
c) How much will Moses charge the customer for delivery?

ITEM ONE
Mr. Karimthe head of mathematics department organized a mathematics study trip to Namanve
where assembling of Toyota vehicle and manufacturing of Coca-Cola products are done, and in his
report to the members of mathematics department shows the cost of hiring a school bus is
constant for any a bus and other varies as the distance covered by
theb us.H elaterre viledthatifabuscovers100kmthenchargedkshs.4500andkshs.4000 for a distance of
60km. The dista nce between the school and Namanve is 480km and they expected to live the
sch ool at 8:00a m at an average speed of
100 /ha ccord ingtotheschool’sstudytriprulesandproceduresandafterthetripthey students would
rest for forty-five minutes and then proceed back to school.

Tasks:
a) AsthetreasureofthemathematicsdepartmenthelpMr.Karimtoknowtotal expenses for
the total journey.

b) Byrepresentingthejourneysonasuitablegraphexplainthemotionofthebustothebus to the school


administrators.

Page 17 of 103
17 | P a g e
ITEM 2

At Elijah‟s enterprise, a company that makes books. A machine produces the least number of books per turn,
that enable packing in boxes in equal numbers of 24, 30 and 32 without any book being left out. On a given
day, a school made an order of 1440 books. Determine the least number of turns the machine has to make in
order to supply the school.
ITEM3
Mutebi had UGX.750,000 on his account and he wanted to buy a Washing Machine. He went at the shop and
the price of the machine was UGX.960,000. He went home and waited. One month later, the price was
decreased by 15% and then 9% in the second month. Was Mutebi able to buy the Machine after the
decreases? If yes, was he able to remain with any balance.

ITEM3
ThepopulationofUgandaisestimatedtobethefastestgrowingpopulationinAfrica. It is estimated to be increasing
by over 1,340,000 people every year Since 2020 whose population was estimated to be 49,718,000 people.
The research team finds it difficult to present such big population values in 2020 and 2022 on a chart.
Advise the search team on some other way they can present these big population values in a reduced way
without changing the meaning.

ITEM 4
Kevin‟s goal is to find a job that provides an income of at least 40 million a year. A glass mart company offers
Her a job paying a basic salary of 12 million a year plus a commissionof6%ofhersales.
Determine what Kevin‟s total sales will need to be for her to have a yearly income greater than or equal to 40
million.

Page 18 of 103
18 | P a g e
ITEM5
Anengineerstandingonarampat(400ft,300ft).theramprises195feetovera horizontal distance of 3000 feet to reach
the top car parking yard.

Determinetheequationthatwouldhelptheengineerknowthedisplacementforany other
positiononthe ramp.

ITEM 6
In the press release by the Uganda bureau of Statistics, presented all Items Index and related Annual Inflation
rates for 3 major components, between February 2015 – February 2016. The Annual Food Inflation decreased
to 10.1 per cent for the year ending February2016 compared to 12.8 per cent recorded forthe year ended
January 2016.Ontheotherhand,theAnnualNon-FoodInflationincreasedto6.7percentfor the year ending February
2016, compared to the 5.8 per cent recorded for the year ended January 2016.
KeyDriversforhigherNon-FoodinflationwereTransport(10.7percent),Clothing and Footwear (13.1 percent)
and Miscellaneous Goods and Services (6.3 per cent).

ITEM 7

Thesmallindividualfarmersinacertainvillagearebeingcheatedbythetradersfrom towns by offering them low


prices for their produce. These farmers decided to form groups and sell their produce through them at better
prices.

Sofar,theyhavetwogroups,Kamukamu andTweziimbe.Inthecurrentseason,they are selling milk, maize grain


and beans. Last month, Kamukamu group had sales of 2,520 litres of milk, 35 bags of maize grain and 10 bags
beans. Meanwhile the Tweziimbe group had sales of 2,314 litres of milk, 41 bags of maize and 9 bags of
beans.

Page 19 of 103
19 | P a g e
Thismonth,theKamukagrouphadsalesof3,254litresofmilk,42bagsofmaizeand 8 bags of beans while the
Tweziimbe group managed to sell 2,719 litres of milk, 32 bags of maize and 11 bags of beans. The price for
1litre of milk, 1kg of maize and 1kg of beans is UGX. 700, UGX.1,000 and UGX.3,500 respectively. A bag
of maize and beans is estimated to have 120kg each.

Organizetheinformationforthetwoperiodsanduseittodeterminethetotalsalesof both groups. (15)

ITEM8

On a certain village of 40 families, it was found out that 12 families keep a dog (D), 18
families keep a cat(C), 10 familieskeepahen(H),5familieskeepDand, 7 keep C and H and 4 keep D
and H. 3 families keep neither of thethree dogs, cats or hens. This data was collected by learners, by use of a
venn – diagram, help them to find the numberoffamiliesthatkeepallthethreeanimalsandbirds.
Ifyou aretaskedtoshare1600kgsoffeedstofamilies
dependingonthenumberofhowmuchanimalsinthatgroup,showeachsectionon the venn – diagram will get.

ITEM 8

Ben and Musa went to borrow money from the same Bank. Benopted forsimple interest of 8%
per annum for two years whileMusaoptedforcompoundinterest of 5% per
annum for two years. If each borrowed 600,000/=. Help them to know who paid more money and
by how much so they can know the cheapest alternative in case they are to
borrow money for the second time.

“Get yourself a Boda – boda cycle on loan term. Pay 600,000/= cash as deposit
and100,000/=perweekfor80weeks.Oneoftheboda-bodaridderhasaskedyouto
help him compute the total cost of the Boda- boda cycle attheendof 80
weeks. Show how you can help him.

ITEM 8
A farmer has a metal sheet of length 12m which must be used toformarightangle. The
hypotenuse of the triangle must be 5m. Help the farmer to get the measurements of the
other twosides of the cage.
(b)In a certain factory the production of product T depends on the amount used of
productX.thesystemofproductionisrelatedbytheequationf(x)=x2+1.Ifduring

Page 20 of 103
20 | P a g e
acertain weekvariablesofx where(3,4,5,6,7,8,9),Helpthefarmerofthe factory to determine the expected
range of product T.

ITEM9
Acensusenumeratorhasbeensenttocountpeopleinyourvillage.Hehasbeengiven an i-pad that is fully charged for
the exercise. Unfortunately, there is a small note of the PIN to help you access the software for the exercise.
The note indicates that the pin
numberisatwodigitnumberinbaseten.Thisnumberisequaltofivetimesthesum of
thedigit.Itisalsoninelessthanthenumberformedbyinterchangingthedigits.The enumeratorcomesto
yourhomeandseeksassistanceto to help himfindthePINfor the i-pad.
ThecensusinUgandaisheldeveryafter10years.Itwaslastheldin2014andthen previously 2004. The census in
2024 has revealed that there are , people in your
village. This has increased by % as revealed by the census in 2014 having been
previouslyincreasedbyby %ea rlierin 2004.
Theenumeratorclaimsfortransportrefundeve ryafterfourdays,forthe4-day journey
madeintheexercise.Hetravelsacerta inamoun tonthefirstday,thenhalfofthaton the second day, third of that the
third day and finally a quarter of that on th e fourth day.
Theenumeratortravelledatotaldistanceof50kmduringthefour-dayexercise.Each kilometer travelled is paid
UGX28,000
Task:
(a) HelptheenumeratorencryptthePIN.
(b) Howmanypeoplewere inthe villagein2004.
(c) Howmuch did shereceiveon each day.
ITENM10
Yourfamilyisdesigningaparkinglotfordayandnightparkingofmotorcyclesusing the piece of land that has been
just been bought in the mi ddle of the city centre. The land is rectangular in shape with a length of 3mlonger
than the width and the a rea of this portion is 2. The other portion of the land is a car park that will have only
taxi and bus. Taxis are allowed 2and buses are allowed 2and there is only

ofparkingspaceavailable.Notmorethan40vehiclesareallowedatatime.There are

alwaysbo tht ypes ofvehiclesandatmost15taxisareallo wedata time.T heparking fee for


taxisis ,andthatofa bus is ,.

Page 21 of 103
21 | P a g e
Each bus carries passengers when full. The bus has a total of seats,someof the
seatsarefor pa ssengers andothersarefor passengers.
Task:
(a) Findthedimensionsoftheportionoftheparking spacefo rthemotorcycles.
(b) Howmanyvehiclesofeachtypeshouldbeparkedintheparkinglotto maximize income?
(c) Determinethenumberofseatsforthethreepassengersandforthetwo passengers.
(d) Inyourviewwhatprecautionsshouldbetakenwhenputtinginplacetheparking lot.

Item11
Your father has decided to explore other options for your A-level education since the expenses at
thepreviousschoolwerebeyondthebudget.Aftersomeresearch,hehasfoundanotherschoolthat
offersamoreaffordableoption.Hedrove30kmeastand40kmnorthtoreachtheschoolandfound out that the details
of the new school were as follows:
□ TheschoolfeesareShs750,000perterm,anadmissionfeeofShs80,000andtheuniformcostis Shs 300,000.The
school offers a 60% bursary on the school fees for students who scored a first grade in their O-level exams,
and you qualify for this bursary.
Yourfatherisconsideringthefollowingtwopaymentplansofferedbythenewschool:
□ Payingthefullamount(schoolfees,admission,anduniform)atthebeginningoftheterm.
□ Payingtheschoolfeesinthreeequalinstalmentsatthebeginningoftheterm,onvisitationday, and at the end of
the term, while paying the admission and uniform fees upfront.
Tasks:
(a) Calculatethetotalcostofattendingthenewschool,consideringthatyouqualifyforthe bursary.
(b) Determinewhichpaymentplanwouldbemoresuitablefor yourfather'sbudgetandexplain your
reasoning.
(c) If yourfatherchoosesthethree-installmentplan,calculatetheamounttobepaidineach installment.
(d) Howfarisitfromyourhometoschoolifyoutravelthroughthe directroute?

Item12
BasogaBainho(BABA)FMishostingahighlyanticipatedconcert,Ekituudha,atKyabazinga Stadium Bugembe.
The concert is expected to attract a large audience and the organizers
havesettwodifferentticketpricestocaterfordifferentincomelevels.Theconcertticketsarebeing sold at two different
prices:
- TicketsfortheVIPseatingareaarepricedatSh.10,000each.
- TicketsforthegeneralseatingareaarepricedatSh.5,000each.
Theorganisershaveatotalof30ticketsavailablefortheconcert.Aftertheinitialsales period, the total
amount raised from the ticket sales is Sh. 800,000.
Task;
AsthefinancemanagerfortheEkituudha,determinehowmanyticketsweresoldatthepriceofSh. 5,000 and Sh.
10,000.

Item 13

Page 22 of 103
22 | P a g e
Walugosi is a middle-class employee working in a private company in Uganda. He earns a gross monthly income
of UGX 1,200,000. Walugosi is married and has four children-
twoaged6and8,oneaged15,andoneaged19.Walugosireceivesvarious allowances from his employer, including:
- Insuranceand relief:UGX222,000per annum
- Waterand electricity:UGX21,000permonth
- Medical:UGX318,000perannum
- Housingallowance:UGX55,000permonth
- Transportallowance:UGX42,000permonth
- Familyallowanceforthethree childrenunder18 years old.
Walugosiisconcernedabouttheamountofincometaxhehastopayeachmonthand wants to understand how it is
calculated based on the tax structure below;
Taxableincome(UGX)permonth Taxrate(%)
1 - 40,000 8.0
40,0001 - 100,000 16.5
100,001 - 200,000 24.0
200,001 - 350,000 32.5
350,001 - 510,000 43.0
Above510,000 48.5
Task;
Walugosiapproachesyou,anexpertintaxcalculationstohelphim determine, i)The income tax he has
to pay monthly.

ii) Hisnetincome
iii) Whatpercentageofhisgross monthlyincomegoestotax?
iv) Withthehelpoftworelevantexample(s),helpWalugosiunderstand why it is important to pay
tax.

Page 23 of 103
NUMBERS

1. During their baking lesson , the students were given a recipe for 10 scones using the following
ingredients:

• 80g butter
• 350g self-raising our
• 30g sugar
• 2 eggs
However the student has the following ingredient and is preparing for the exhibition due to take
place at school and wishes to bake 25 scones for the exhibition because he expects parents and
visitors to support his entrepreneurial venuture.

• 100g butter
• 1kg self-raising our
• 50g sugar
• 4 eggs
Task:

(a) Determine if the student has enough of each ingredient to bake 25 scones based on the recipe.
(b) Determine how much more of each ingredient the student needs to buy.
(c) If the prices of the ingredients are as follows:
• Butter: 5,000 shillings per 100g
• Self-raising our: 6,000 shillings per kg
• Sugar: 1,000 shillings per 50g
• Eggs: 500 shillings per egg
Calculate the total cost for the additional ingredients needed.

(d) Determine how much the student should sell each scone .Electricity and other expenses are
provided free by the school.

2. Your aunt is planning to enroll you in a boarding school for your O-level education. She has a
budget of Shs 5,000,000 for your school expenses. To visit the school, she decides to take a boda -
boda. The boda-boda travels 3 km west from your home to the main road, then 4 km south to
reach the school. However, you later realize there's a shortcut path that leads directly from your
home to the school. Upon reaching the school, your aunt learns that the school fees are Shs
3,000,000, boarding fees are Shs 1,500,000, and the cost of school supplies is Shs 500,000.
Fortunately, the school o ers a scholarship program. Students with excellent primary school leaving
exam results receive a 50% discount on school fees, a Shs 200,000 reduction in boarding fees, and a
Shs 150,000 voucher for school supplies. You are

S.4 Virtual Seminar Ⓒ


c 2024 3

Page 24 of 103
eligible for this scholarship based on your outstanding performance. The school also o erstwo
payment options for school fees:

• Option 1: Two Installments - Pay two- fths of the school fees at the beginning of theterm
and the remaining balance before the midterm exams.

• Option 2: Four Installments - Pay equal amounts at the beginning of the term, before
midterm exams, after midterm, and before nal exams.

Task:

(a) What is the distance from your home to the school using the direct path?
(b) i. Considering the scholarship, calculate the total amount your aunt will pay for yourschool
expenses.

ii. Can your aunt a ord the school expenses based on her budget?
(c) i. For those paying the full school fees amount, calculate the amount paid per in-
stallment for each payment option.

ii. Which payment option would you recommend and why?

PATTERNS AND ALGEBRA

3. Your uncle owns a small bakery and plans to bake two types of loaves of bread: whole wheat bread
and white bread. Due to the bakery's oven capacity, your uncle can bake at most 15 loaves of bread
in a day. He wants to bake at least 3 loaves of whole wheat bread. Additionally, he wants to bake
more whole wheat bread than white bread because it is more popular among his customers. The
selling prices are as follows:
Whole wheat bread is sold at Shs 6500 per loaf.
White bread is sold at Shs 5000 per loaf.
To cover his costs and make a pro t, your uncle needs to earn more than Shs 30,000 fromthe sales
each day.
Task:

(a) Write mathematical statements that show the relation between the whole wheat breadand
white bread.

(b) Show the feasible region of the relation on the Cartesian plane.
(c) How many loaves of each type should your uncle bake in order to make the maximumpro t?
(d) What is the minimum number of loaves he can bake and still make a pro t?

4 S.4 Virtual Seminar Ⓒ


c 2024

Page 25 of 103
4. The company manager is organizing a party for her colleagues. The cost of renting a local hall is
UGX 2,000,000 for the evening. She then has to budget for food, which will cost approximately
UGX 20,000 per person. The manager needs to ensure that the total cost of the evening stays within
her budget.The manager has a maximum budget of UGX 5, 000, 000

Task:

(a) Write down a formula connecting the total cost of the evening with the number of people
attending .

(b) Find the total cost for the evening if 25 people attend.
(c) Find the greatest number of people she is able to invite.
(d) In the end, only 16 people will attend. Calculate how much each person should be charged so
that the manager covers her costs.

5. Your friend is shopping at a supermarket in Kampala during a clearance sale. He wants to buy a
calculator that originally costs 120,000 UGX. The store has reduced the price of all calculators by
35% for the sale. Additionally, today there is an extra markdown of 40% applied to the sale price of
all calculators.
Task:

(a) Develop a function that calculates the sale price of the calculator today, where x is the original
price of the calculator.

(b) Using the function from (a), determine the nal price your friend will pay for the calculator.
6. A manufacturer considers that men and women workers are equally e cient and so he pays them at
the same rate. He has 30 units of male workers and 17 units of female workers and capital
respectively, which he uses to produce two types of goods, A and B. To produce one unit of A, 2
workers and 3 units of capital are required, while 3 workers and 1 unit of capital are required to
produce one unit of B. Goods A and B are priced at UGX 100,000 and UGX 120,000 per unit
respectively.
Task:

(a) Write mathematical statements that show the relation between the units of goods A and B
produced

(b) Show the feasible region of the relation on the Cartesian plane
(c) How should he use his resources to maximize the total revenue?
(d) Do you agree with this view of the manufacturer that men and women workers are equally e
cient and so should be paid at the same rate?

Page 26 of 103
7. In preparation for the annual sports day that takes place in second term of every year , your school
has marked lines with ash powder at intervals of 1 meter on a rectangular sports eld ABCD. The
eld is 100 meters long (AD) and 50 meters wide (AB). To make the event more exciting, the school
has set up a challenge where students need to post ags at speci c locations on the eld.

• 100 ower pots are placed at 1-meter intervals along the length AD.
• Two di erent lines (second and eighth) running parallel to AD are speci cally used forthis
challenge.
1 th the length of the eld along the 2nd meter line and posts a green
• One student runs 4
ag.
1 th
• Another student runs 5 the length of the eld along the 8th meter line and posts a
red ag.

Taking one corner of the eld (point A) as the origin, with the x-axis along the width (AB)and the
y-axis along the length (AD), answer the following questions:
Task:

(a) Find the coordinates of the green ag.


(b) Find the coordinates of the red ag.
(c) Find the distance between the two ags.
(d) If a blue ag is to be placed exactly halfway between the green and red ags, whereshould
it be placed?

(e) Draw the locus of points that are equidistant from both the green and red ags and
nd it is equation.

Page 27 of 103
8. A cooperative society of farmers has 50 hectares of land to grow two crops A and B. The pro ts
from crops A and B per hectare are estimated as Shs 10,500,000 and Shs 9,000,000 respectively. To
control weeds, a liquid herbicide has to be used for crops A and B at the rate of 20 litres and 10
litres per hectare, respectively. Further not more than 800 litres of herbicide should be used in order
to protect sh and wildlife using a pond which collects drainage from this land. Keeping in mind that
the protection of sh and other wildlife is more important than earning pro t respectively.
Task:

(a) Write mathematical statements that show the relation between the hectare of land tobe
allocated to crop A and B respectively

(b) Show the feasible region of the relation on the Cartesian plane
(c) How much land should be allocated to each crop so as to maximize the total pro t?
(d) Do you agree with the message that the protection of wildlife is utmost necessary to
preserve the balance in environment?

DATA AND PROBABILITY

9. In a school survey, 200 students were asked about their internet usage habits. They were asked to
choose from three activities: Social Media (like Facebook and TikTok), Academic Work (such as
research and homework), and Playing Games. The results showed that 165 students use the internet
for Social Media, 130 use it for Academic Work, and 100 use it for Playing Games. Among them,
70 students use it for both Social Media and Academic Work only, 60 use it for both Social Media
and Playing Games, and 50 use it for both Playing Games and Academic Work. Additionally, no
students exclusively use the internet for playing games. Now, the school needs to decide whether
to set rules if more than 60%of students spend their internet time on Social Media.

Task:

(a) Calculate how many students use the internet for at least one of these activities.
(b) Determine how many students don't use the internet at all.
(c) Estimate the percentage of students who use the internet solely for Academic Work.
(d) Based on the ndings, advise the school on whether to implement rules or not.
10. A certain company in Kampala is analyzing the optimal departure time for its 40 employees to
ensure they reach home by 6:00 PM, minimizing their commute time and avoiding peak tra c
congestion. The company conducts a survey to track the times employees typically arrive home
after work, measured in minutes past 5:00 PM.

15 20 25 30 35 40 45 50 55 60
65 70 75 20 25 30 35 40 45 50
55 60 65 70 75 80 25 30 35 40
45 50 55 60 65 70 75 80 30 35

Page 28 of 103
Task:

(a) Based on calculations using the collected data, suggest an optimal departure time for
employees to begin their commute home.

(b) Following advice to allow employees to leave work when at least 50% of them have already
arrived home, determine the optimal departure time.

(c) As the company management, which of the two suggested departure times from (a) and (b)
would you choose to ensure employees reach home by 7:00 PM, and why?

11. A baker is preparing for a local community event. She needs to bake several types of cakes,
however she has to ensure she has the correct quantities of ingredients for each. Below are the types
of cakes she plans to bake and their required quantities of ingredients:

• Chocolate Cake: Requires 3 cups of our, 2 cups of sugar, 4 eggs, and 1 cup of mixed
ingredients per cake.

• Vanilla Cake: Requires 4 cups of our, 3 cups of sugar, 3 eggs, and 2 cups of mixed
ingredients per cake.

• Red Velvet Cake: Requires 5 cups of our, 2 cups of sugar, and 1 cup of mixed
ingredients per cake.

• Lemon Cake: Requires 2 cups of our, 2 cups of sugar, 3 eggs, and 1 cup of mixed
ingredients per cake.

The baker has been asked to bake a total of 10 Chocolate Cakes, 8 Vanilla Cakes, 6 RedVelvet
Cakes, and 5 Lemon Cakes.
Task:

(a) Form a matrix to show the quantities of ingredients required for each type of cake.

(b) She wants to calculate the total quantity of each ingredient she will need for the event. Help
the baker using your knowledge of matrix multiplication.

(c) If each kilogram of our goes for UGX 8000, each kilogram of sugar goes for UGX 5000,
and each egg goes for UGX 300, and a cup of mixed ingredients goes for UGX 6000. Find
out how much she will spend on making the cakes considering that each cup with the
ingredient weighs 250grammes.

12. A layer chicken farmer decided to weigh a sample of 800 eggs on his farm and classify them
according to their mass (m grams) to optimize the packing process. The frequency distribution of
the egg masses is as follows:

Mass in grams Number of eggs


40 − 44 36
45 − 49 142
50 − 54 286
55 − 59 238
60 − 64 76
65 − 69 22

Page 29 of 103
The farmer's plan is to pack eggs in given weights.
Task:

(a) Determine the median mass of an egg from the given frequency distribution to under- stand
the central tendency of the egg weights.

(b) What would be the percentage of eggs which would be classified as large(over 62 grams)
(c) The farmer plans to pack eggs that weigh over 62 grams, with each pack containing 12 eggs. If
each pack costs UGX 12,000, calculate the total revenue the farmer will earn from selling all
the large eggs and compare the revenue earned from selling the same eggs to a middle man
who he is buying at UGX 9000.What advice will you o er to the farmer.

13. In preparation for the upcoming national voter registration drive in Uganda, the Electoral
Commission needs to determine the optimal opening time for registration centers across various
districts. This decision aims to facilitate maximum voter registration and ensure e cient
processing of the data of the citizens eager to participate in the upcoming elections. Here are the
arrival times of citizens at a sample voter registration center in minutes past the scheduled
opening time (8:00 AM):

11 66 21 88 33 67 41 45 47 41
27 62 32 43 31 34 66 20 21 36
26 75 80 45 12 44 58 48 42 38
56 63 68 24 21 65 68 63 72 38

Task:

(a) Based on calculations using the collected data, suggest an opening time for voter reg- istration
centers.

(b) Following advice to open registration centers when at least 50% of expected citizens have
arrived, determine the opening time.

(c) As the Electoral Commission of Uganda, which of the two suggested opening times from (a)
and (b) would you choose, and why?

GEOMETRY AND MEASURES

14. Your relative, is planning to start a small bakery business and seeks your advice on nancial matters
related to her venture. She plans to invest a total of $10, 000 into the business and wants to
understand the nancial implications of di erent nancing options. She has approached two money
lenders and she is asking for your input before she takes on the decision.
Lender 1 : Your relative ,wants to borrow UGX 50,000,000 from a local bank to purchasebaking
equipment. The bank o ers her two di erent repayment plans:

• Option 1: Simple Interest - The loan is o ered at an annual interest rate of 20% andto be
paid after 2 years.

Page 30 of 103
- Option 2: Compound Interest - The loan is o ered at an annual interest rate of 4%
and is to be paid after 2 years
Lender 2: Your relative is considering a hire purchase agreement with a bakery equipment supplier.
The total cost of the equipment is $5, 000, and the hire purchase agreement speci esa down payment of
$1, 000 followed by monthly payments of $400 for 24 months.The supplier will consider a constant
dollar rate at 1$ = UGX3, 800

Task:

(a) Calculate the total repayment amount for each nancial option over the loan term and compare
them to determine which option would be more cost-e ective for your relativebakery business.

(b) Analyze the monthly cash ow implications for your relative, under each nancing option,
considering her ability to manage operational expenses alongside loan repay- ments.

(c) Based on your calculations and analysis in (a) and (b), provide your relative, with a
recommendation on which nancial option would be optimal for her bakery business, taking
into account both total repayment amount and monthly cash ow considerations.

15. A group of tourists has just arrived at Entebbe International Airport in Uganda for a safari
adventure. They are interested in reaching the source of the Nile in Jinja. The touring company
has approximated the distance from Entebbe to Jinja to be about 94 km, which should take
around 3 hours without tra c, assuming an average speed of 30 km/h for the whole journey.
Here are the directions they are following:

• From Entebbe Airport, travel north for 35 kilometers to reach Kampala, the capital city.
• From Kampala, head east on the Jinja highway. As they approached Mukono, approx- imately
25 km from Kampala, the guide was alerted by a friend coming from Jinja to change the
route and use the Kayunga road due to an accident in Mabira. The driver changed the
route at Mukono and went in the northeast direction to Kayunga, approximately 45 km away.

• From Kayunga, they headed to Jinja on a bearing of 1300, which took them 1 hour and 44
minutes as they enjoyed the scenery along the roadside.

Task

(a) Describe the direction from Jinja to Entebbe.


(b) How far is it from Mukono to Jinja using the direct route instead of the Kayunga route?
(c) How long does the journey from Entebbe to Kampala take?
(d) If each liter of fuel costs UGX 4900 and the car van consumes 1 liter per 10 km, how much
fuel and money would they have saved if there was no accident in Mabira?

(e) How much extra time did they spend on the road due to the detour, and what recom-
mendations would you make to avoid such delays in the future?

Page 31 of 103
16. Your neighbor runs an industry in a shed that is in the shape of a cuboid surmounted by ahalf-
cylinder. The dimensions of the cuboid base are 15 m by 7 m, and the height is 8 m.

Your neighbor wants to install air conditioning units in the shed. The installation company o ers
two types of units: Type X and Type Y. Each Type X unit costs $2, 500 and each Type Y unit costs
$3, 200. The Type X unit covers 100m3 of air, while the Type Y unit covers 150m3 of air. For bulk
purchases, the company o ers a 5% discount on the total cost for every 10 Type X units purchased
and a 7% discount on the total cost for every 8 Type Y units purchased. The neighbor plans to
buy enough units to cover the entire volume of the shed. He intends to borrow money from a
bank to buy the air conditioning units but isunsure of the amount needed.

Task:

(a) Find the volume of the air that the shed can hold.
(b) If the industry requires machinery which would occupy a total space of 300m3 and there are
20 workers each of whom would occupy 0.08 space on an average, how much air would be in
the shed when it is working?

(c) Calculate the number of air conditioning units required for both Type X and Type Y units
based on the usable air volume.

(d) Estimate the total cost and the amount of money your neighbor needs to borrow for purchasing
the required air conditioning units for both Type X and Type Y.

(e) Advise your neighbor , with reasons, on the type of air conditioning units to buy.

Page 32 of 103
17. The sprinkler needs to be strategically placed to ensure e ective coverage
Parks without wasting water on the pathways.
Depart
ment
in a
Ugand
an
village
has
acquir
ed a
new
sprink
ler
syste
m to
water
their
ower
equilat
eral Diagram not on scale
triang
ular
Task:
lawn ,
which (a) Explain whether or not you think all of the lawn in the triangle
is
can be watered witha circular sprinkler
essenti
al for (b) Determine the best location inside the equilateral triangular lawn
mainta where the sprinklershould be positioned to maximize the watering
ining
coverage while avoiding the pathways.
the
village (c) Estimate the area of the lawn that will not receive water e ectively
green- once the sprinkleris optimally placed.
ery.
The
equilat
eral
triang Question 1
ular
lawn,
with
each
side
measu
ring
10
meters
, is
surrou
nded
by
pathw
ays,
and
the

Page 33 of 103
KarynownsabakeryinKampala. Sheusesa baseeightsystemtodisplaythepricesof different prices of bread in
dollars. In her display, each digit from 0 to 7 represents a specific price value as shown in the table below

Digit Pricevalueindollars
0 2.5
1 3.0
2 3.5
3 4.0
4 4.5
5 5.0
6 5.5
7 6.0
She sells each loaf of bread at 256 base eight. Oscar is a business man who buys 100 loavesof
breaddailyfromthe bakeryand sellseachloaf atUGX70000.Heisgivena discount of 5% on every loaf of bread.

Task

a) Determinethepriceof1loafofbreadindollars
b) Giventhat1USD=UGX3800,HelpOscartodeterminehispercentageprofit.
Question2
Your mathematics teacher has promised to award his best three students Maria, Monica
andMariamwith126counterbooks.EachcounterbookcostsUGX12000inthe market. Maria will receive 42
counter books in base 6. Monica will receive 36 counter books in base 8. Mariam will receive the share of
her counter books in base 10.To provide accountabilityto the school head teacher, the mathematics
teacher intends to present the data on appropriate chart to the head teacher.

Task

a) DeterminehowmuchmoneywasspentinbuyingMariam‟sCounterbooks
b) Helptheteachertopresentthedatatotheschoolheadteacher.
Question3

Page 34 of 103
WilsonandRonaldarestudentsofthesameschool.Theyareworkingonamathematics assignment that involves
number bases. Wilson is working in base 6 while Ronald is working in base 8. Wilsons number is 24
written on a white cardboard while Ronald‟s number is 32 written on a blue cardboard. They are all
aiming at find the least number that can divide all the two numbers. Wilson′s class has 5 streams with 15
students each
whileRonald‟sclasshas2streamswith24studentseach. Theschoolwishestodetermine the minimum number of
students each stream should have so that they contain the same number of students.

Task

a) HelpWilsonandRonaldtodeterminetheleastnumberthatcandivideallthetwo numbers
b) Helptheschooltodeterminethenumberofstudentseachstreamshouldhave?
Question4
Yourschoolhasreceivedanewsetofmathematicsbooksforthelowersecondaryschool curriculum from the
ministry of education and sports. The school is arranging the books into boxes to hand them over to the
school librarian. The school decides to arrange the books in rows on different number bases. The first box is
arranged in base 2, the second box in base 3 and the third in base 5. Each box has equal number of books in
each row.
Thefirstboxcontainsrowsofbooks.Thesecondboxcontains9rowsofbooksandthe third box contains 8 rows of
books. The librarian is creating selves and each self will contain equal number of books. Each book costs
UGX25000

Task

a) Determinethetotalnumberof booksthattheschoolreceivedfromtheministryof education and sports.


b) Howmanybookswillthelibrarianarrangeineachshelf?
c) Determinetheamountofmoneyspentinbuyingeachboxofbooks
Question5
Scovia locks her phone with a password “MATH” after using it. Each letter in the
passwordrepresentsanumberinbasefive.Mrepresents13,Arepresents1,Trepresents 20 and 8 represents 8.
Ruth wants to use the phone but needs to combine the numbers in base 10 to unlock the phone. Scovia
bought the phone at UGX780000. She plans to sell the phone to Ruth at UGX1080000. Scovia plans to
use part of the moneyto buy a crate of soda that has 24 bottles for her birthday and save the rest. Each
bottle of soda costsUGX12000.

Page 35 of 103
Task

a) WhatnumbershouldRuthusetounlockthephone?
b) DetermineScovia‟spercentageprofit
c) Expresstheamountofmoneythatwillbeusedtobuythecrateof sodaasa percentage of the
amount of money that will be save.

Question6
A telecommunication company in Uganda offers a special promotion to all customers
havingtheirbrandsmartphone.Thepromotionallowscustomerstoconverttheirloyalty points to a specific
amount of money in US dollars and finally to Ugandan shillings (UGX)basingona uniquenumber
basesystem. Inthis system, thedigit3intheloyalty
pointsisequivalenttothedigit5inthedecimalsystem.Joshuaaccumulates243loyalty points every week. Each
loyalty point can be converted to UGX 11400. The company sells each phone at a profit of 5%. They sell
each phone at UGX585000.

Task

a) DeterminetheamountofmoneyJoshuareceivedforhisloyaltypointsinUSdollars for last week. Hence


determine the total amount of money he will receive within 6 weeks.
b) Determinethecostpriceofeachphone.
Question7
James and Joan are students in the same school. James is holding a white card with numbers 24 and 45
written in base 6 on it. Joan is holding a blue card with the same numberswritteninbase8onit.Theyallwant
tofindtheleastnumberthat candividethe two numbers on their respective cards. James claims that he will be
the first to obtain the correct answer since he is 5 years older than Joan.

Task

a) DeterminethecorrectanswerJameswillfind
b) HowoldisJoanifthesumoftheagesofthetwostudentsis39.
Working with integers

Question1
YourschoolplanstoraiseUSD1100thatwillbeusedintheconstructionofanewschool library. The school
organized a school carnival to raise moneythat will enable it achieve

Page 36 of 103
thetarget.ThetablebelowshowstheincomegeneratedandtheexpensesforinUS dollars for the school
carnival.The expenses are indicated in brackets

Games Sports Donations Flyers(expenses) Decorations(expenses)


650 530 52 28 75
Theheadteacheroftheschoolplanstopresenttheabovedatatotheschoolmanagement committee in one of the
meetings this Saturday.

Task

a) Didtheschoolreachits goal?
b) Usingtwodifferentcharts,helptheheadteachertorepresentthedatatotheschool management
committee
c) Giventhat1USD = 3800UGX,determinethetotalamountofmoneytheschool remained with after
expenses in UGX.

Question2
A football team gains 3 points on the first tournament, loses 6 points on the second tournament, loses 3
points on the third tournament and gains 4 points on the fourth tournament. Each point gained is awarded
UGX54500 and each point lost is deducted UGX12500.Theteamhas40playerswho are
eitherleftfootedorrightfooted.28players
arerightfootedwhile17playersareleftfooted.Aplayerwhoisbothleftandrightfooted is awarded UGX 258000
by the football association.

Task

a) Determinethetotalamountofmoneythefootballteamobtainedfromthefour tournaments
b) Howmuch moneydidthefootballmanagementspendinawardingtheplayerswho are both right and
left footed? (write your answer in words)

Question3

You are playing a game on your computer using a spinner. You start with the spinner at
blueandscore48,andspinthespinnerfourtimestoorange,spinthe spinnerthreetimes again to green and finally
spin the spinner 6 times to red. Each spin gives a score of 4.

Task

a) Writeyourtotalscoreinwords
b) Usingtwodifferentcharts,displaythescoresatblue,orange,greenandred
Question4

Page 37 of 103
James bought three bags at UGX 45000 each after being given a discount of 5% on the original price of
each of the bags from a shop in Kampala. He bought oranges at UGX500 each and put in the bags. Each
bag contained 8 oranges. James then decided to
sharethemwithhisfourfriendJoshua,Jakin,JackandJadonbydividingthemequallyin to four groups. He
bought 10 more oranges later on and added them to the total number of oranges he had. James realized
that he had to multiply the sum of the oranges by 2 to determine the final count. Joshua being the oldest of
the other four friends by 2 years claims that he should be given more oranges. The sum of the ages of the
five people when pressed on a calculator was found to be 77.

Task

a) Determinethetotalamountofmoneyofthefinalcount.
b) Whatistotaloriginalcostofthethree bags
c) Determinetheagesofthefivepeople.
Question5

Your sports teacher is organizing a sports event this Saturday. He wants to buy sports equipment sets that
include basketballs and footballs for their activities. He has three different sets to choose from: Set A
includes 8 basketballs and 12 footballs, Set B includes 6 basketballs and 18 footballs and Set C includes
10 basketballs and 15 footballs. Each ball in set A costs UGX80000, each ball in set B costs UGX 8000
more than that in Set A and each ball in Set C costs UGX12000 more than that in Set B.The
sportsteacherwantstofigureoutthetotalnumberofeachtypeofballheneedstobuyto ensure that each activity
group has the required number of balls without shortage or wastage.

Task

a) Determinethetotalamountofmoneyhemustspendinbuyingtoballstoachievehis target.
b) ThesportsteacherhasUGX7800000forbuyingtheballs,hewantstouse10%ofthe balance to purchase
mineral water. Determine how much he has to spend on mineral water.

Question6
Your high school friend spent UGX15000 in buying apples. He wants to distribute the apples
equallyamong his other friends. If he gives each friend 𝑥 apples , he will have 3 apples remaining. Each
apple costs UGX1000. Emily, Michael and Sophia are among
yourbestfriendsaswell.Emilyhas18applesinherbag.Michaelhas24bagsinhisbag

Page 38 of 103
whileSophiahas30applesinherbagtoo.Theywanttofindthehighestequalnumberof apples that should be put in
each bag and the least equal number of apples each bag can contain.

Task

a) Determinethenumberofapples(𝑥)eachfriendwillreceivefromyour friend.
b) HelpEmily,MichaelandSophiatoaddressthechallenge.
Question7
Your brother went to school to do mathematics practice on the chalkboard. During his practice, he
pressed a number on a calculator, added the square of 5 to the number. He
laterrealizedthatwhenhedividestheresultby4,hegets5timesthenumber.Afterthe practice, your brother left
school and walked 5 kilometers to a trading centre to buy
water, he then walked in the north east to his friend‟s home and rested there for some
hoursbeforewalking6kilometersinthewesterndirectionto asupermarkettobuysome scholastic materials for
mathematics practice in the coming days. Your home is 5 kilometers due south of the supermarket.

Task

a) Helpyourbrothertofindoutthenumber.
b) Howfaris yourhomefromtheschoolusingthedirectroute?
Fractions,percentagesanddecimal

Question1
Youruncleworksasasalesagentinacementmanufacturingcompany.Heispaidabasic monthlysalaryof
UGX1800000. He is paid UGX400000 for every 25 bags of cement he sells. Your uncle sells 400 bags of
cement in a month. He decides to save 20% of total salaryeverymonth and share the 10% of it among his
four children in the ratio of 2:3:4:1 accordingto theirages. Theeldestchildreceivesthehighestamountof
money.Hisdaily expenses are UGX 20000. The rest of the money is invested in to the family business.

Task

a) Howmuch moneyisinvestedintothefamilybusinesseverymonth?
b) Workouthowmuchmoneytheyoungestchildgets
Question2

Page 39 of 103
Annetboughtfruitsconsistingof mangoes,guavas,orangesandpassionfruitsintheratio
of2:4:4:2fromafruitstore.Heate1ofthefruitsandgaveaway40%of theremaining
4
oranges to his friends. She sold the rest of the fruits to his neighbor at UGX1500 each.
Eachfruitinthefruitstorecostsa UGX800.Shebought14passionfruitsfromthefruit store.
Task

a) Determineherpercentageprofit.
b) Displaytheinformationusinganappropriatechart.
Question3
A secondaryschool consists of 24 lower secondaryschool prefects. The prefects plan to
holdameetingthisSaturdayinoneoftheschoolhall.Theschoolhallcanaccommodate many people as it has single
seats arranged in 8 rows and 12 columns. The school has bought 48 bottles of mineral water, 120 bottles of
soda and 84 cups of juice. 17 prefects drink soda, 12.5% of the prefects do not drink soda or juice and 9
prefects drink juice.
EachbottleofthedrinkscostsUGX4000
Task

a) Usingappropriatechart,displaythecategoriesofdrinksbought
b) Workouthowmuchmoneywasusedtobuybottlesofdrinksforpeoplewhodrink both soda and juice if
they will drink two bottles each.

Question4
Oscar wants to design a triangular garden in her backyard. The base of the triangular gardenis12metres
longandtheheightis8metres.Heplanstodividethegarden into
threeequalsectionstoplantdifferentflowers.Oscardecidestoallocate1ofthegardento
3
1
roses, totulipsandtheremainingsectiontosunflowers.Oscarrealizesthattheroses
4
need 40% of their section to grow properly, the tulips need 25% and the sunflowers
require35%.Oscardecidestoinstalladecorativeborderaroundtheperimetersothatit just touches the edges of
the garden and the border costs UGX50000 per metre.

Task

a) Whatisthetotalcostofinstallingthedecorativeborder?
b) Whatistheareainsquaremetersallocatedtoeachtypeof flower?

Page 40 of 103
c) Findouthowmanysquaremetresofeachflowerbedshouldbeallocatedforoptimal growth.
Question5
The village hunters standing by the roadside need to navigate through the game park to find three different
wild animals, cob, rhino and porcupine resting at three different places. The village hunters need to move
northeast to find the cob and turn southward to find the rhino before turning southwest to find where the
porcupine is resting. The distancefromtheroadtothecobis25%ofthetotaldistanceandthedistancetotherhino is
40% of the total distance. The remaining distance to the porcupine accounts for the remaining 35%. The
distance to the cob from the village hunters is 500 metes

Task

a) Workoutthetotaldistancethevillagehuntersneedtocover.
b) Whatangleshouldthehuntersturnthroughiftheyaretomovefromtheroadtothe porcupine?
Question6

Mr.Amara isavillage farmer.He ownsatriangulargardenwithsidesmeasuring (𝑥 +2) metres, 𝑥 + 5) metres


and (𝑥 + 8) meters. Mr. Amara wants to build a circular fence around the garden in such a way that it just
touches the corners of the garden without
enteringittokeepoutanimals.ThefencingmaterialcostsUGX7800permeter.Hewants
tofence3oftheperimeterofthegardenandleavetheremainderunfencedforan
4
entrance.Theperimeterofthegardenis45metres.Thegardenwillbeusedtogrowtrees and each tree will occupy
2𝑚2of space of the garden

Task

a) Determinethecostoffencingthegarden
b) Workoutthetotalnumberoftreesthatcanbeplantedinthegarden
Question7
Your sister, Mercy works in one of the non-governmental organizations in Uganda. She is paid a monthly
salary of UGX8800000. Your sister decides to invest a portion of her
totalsavingsinafixeddepositaccountthatoffersasimpleinterestrateof5%permonth.
Sheinvests1ofhertotalsavingswhichamountstoUGX1400000.Mercysaves30% of
3
hermonthlysalaryandusestheremaindertopayschoolfees.

Page 41 of 103
Task

a) Determinetheamountofmoneyshewithdrawsfromthefixeddepositaccountafter4 years.
b) Workouthertotalsavingsin2 years.
Coordinate plane

Question1
You and your friend have tickets to watch a football match in Kampala in which only
12500spectatorsareexpectedtoattend.YousitinsidetheVIPsectionand yourfriend sits at (−5,−3). The
football pitch is located at positions
(−4,−3),(4,3),(−4,3) 𝑎𝑛𝑑 (4,3). Each unit is equal to 20 metres. The football match
hasbeenorganizedbythefootballassociationtoraisefundsrequiredtofencethefootball pitch where by each
spectator will pay UGX1000. UGX 20000 will be used to fence every 2 meters of the perimeter of the
pitch and 40% of the balance will be distributed equally by the football association to the 46 football
players that will participate the football match and the remainder will be saved in a bank account that
offers a 8% simple interest rate per month.

Task

a) Usingasuitablegraph,displaythepositionofyourfriendanddeterminetheareaof the football pitch.


b) Workouttheamountofmoneythefootballassociationwillwithdrawfromthebank after 3 years
Question2

Yourschoolislocatedat(2,−1),whichis2blockseastand1blocksouthof thecentre of town. To get from your


house to the school, you walk 5 blocks west and 2 blocks north. The school is near the houses of four of
your friends Alex, Bernard, Cathy and
Dalton.Alex‟shouseis600metersnorthoftheschool,Bernard‟shouseis300metreson
60° east of north of the school. Cath‟s house is half kilometer on south of east of the
schoolwhileDalton‟shouseissouthwestoftheschool.Dalton‟shouseis400metres from the school.

Task

a) Isyourschooloryourschoolclosertothecentreoftown?useasuitablegraph
b) Showaccuratelythepositionofthehousesofthefourfriendsanddeterminehowfar Dalton‟s house is from
Alex‟s house

Page 42 of 103
Question3

Three people Amon, Anthony and Mark are village friends. They decided to go hunting for wild animals
in a village forest.They left their bottle of water at point A(2,4) and theirspearsatpointB(-
1,1)andstartedtracingthewildanimalsfrompointC(5,3).While exploring the area the next day, they
discovered a mysterious circular rock enclosing the area formed by three points just touching the tips of
the three points

Task

a) Usingagraphandsuitablegeometricinstruments,showthedesignofthearea covered by circular


rock
b) Workouttheareaofthecircularrock
Question4
Jerome is a village farmer in Iganga district. He has rectangular farm land whose corners are at points
𝐴(2,3),𝐵(2,7),𝐶(8,7),𝑎𝑛𝑑 (8,3). He bought the farm land from his neighbor2
yearsagoatatotalcostofUGX8400000.Jeromeplanstosellthefarmlandto his friend Destiny. He wants to sell
each square meter of the farm land at UGX120000 and save the profits obtained in a fixed deposit account
that offers a 2% simple interest rate per month for 2 years. Each unit of the length or width of the farm
land represents 5 metres of the actual size.

Task

a) Usingasuitablegraph,presentthedesignofthefarmland
b) HowmuchmoneywillJeromewithdrawfromthebankafter2years?
Question5
Your school has designed a rectangular meal card whose corners are at points P(2,7), Q(6,7)R(6,-
2)andS(2,-2)tohelpinschoolfeescollection.Themealcardisuniquewith a triangular design whose tips are at
points (1,2),(3,4) and (5,6) inside it. A student in senior one has drawn a circular design that just touches
the three edges of the triangular design.

Task

a) Presentthedesignofthecardonasuitablegraph
b) Workouttheareaofthecardcoveredbythecirculardesign
Question6

Page 43 of 103
A new football coach of an English premier club is designing a new style of play for his team on a coordinate plane
that represents a football pitch. The goalposts are located at points 𝐴(2,4) and
𝐵(2,−4).Thefootballcoachwantstheteamtopracticerunninga play to facilitate counter attack against the opponent
where the centre back starts the ball at point 𝑄(−3,1) and throws the ball in a straight line to the wide midfielder at
point
(4,−2).The football club has a total of 40 players. 28 of the players can defend, 14 can
attackwhile2oftheplayerscanneitherattacknordefend.Aplayerwhocanbothdefend and attack receives a weekly
bonus

Task

a) Thefootballcoachwouldliketopresenthisnewstyletotheboardofdirectorsofthe club, help him to address this


challenge.
b) Writeanequationthatrepresentsthepathoftheball
c) Howmanyplayersreceivetheweeklybonus?
Question7
Your school has planted trees in a rectangular pattern to beautifythe school compound.
ThedesignoftheplantedtreesshowstreeAatpoint(3,5),TreeBatpoint (−2,4), Tree C at point (1,−1) and Tree D at
point (−3,−2). The school wants to create a walking
paththatconnectsallthetreesinthemostefficientwaypossibleandastraightroadthat passes diagonally from a tree at
one corner to the tree in the other corner.

Task

a) Usingasuitablegraphshowthedesignoftheplantedtrees
b) Findthetotaldistanceofthewalkingpaththatconnectsallthefourtrees
c) Determinethelengthofthediagonalpathandwriteitsequation.

Page 44 of 103
SECTION A
Answer all items in this section.
Item 1 (20 scores)
You decided to have a joint graduation party with your family members which will cost atotal of Uganda shilling
four million. You are nearing a D-day and you want to find out whether you have enough required amount of
money or not. And below are the contributions.
- your parents promised to contribute 30% of the money.
- Your friends promised 10% more than that your parents promised.
- And since you are the owner of the party, you contributed 20% of the requiredamount.
When you went for shopping, you moved 6km due East from your home and the 8km dueSouth to reach the
market, but the old man on the way told you that there is a shortest route you would use to reach the market
directly to save time. And you made a booking of shillings, one million, seventy five thousand for all items
required for the party.
Task
a) How far is it from your home to the market if you used the shortest route as the oldman told you?
b) Make a simple budget for the party according to the booking.
c) Do you have the required amount for the party? Justify.
d) How much would you remain with according to the budget?
e) What advise can you give the party organizing committee?
Item 2 (20 scores)
Your friend would like to continue with his studies at A-Level. But he is challenged with raising tuition of UGX
200,000. He is gifted with a skill of making jewelry craft. He has saved some money that can only help him buy
glue and strings. So moves to different homes requesting for old calendars from which he makes jewelry. A
necklace takes him an hour to make and sells a profit UGX 800. The pair of earrings takes him two hours to make
but he gets a profit of UGX 2000. He likes to make a variety by making at least as many necklaces as pairs of
earrings. He has approximately 40 hours per week for creatingjewelry. He also knows that the crafts vender wants
sellers to have more than 20 items ondisplay at the training of the show, he likes to make a variety by making at
least as many necklaces as pairs of earrings. Assuming he sells all his inventory. Help your friend to find:
Task
a) How many of each of the necklace and earrings he should make so as to make asmore profits as
possible?
b) How much profit he makes a week?
c) How many weeks he requires to raise his tuition?
d) Which amounts will you choose to charge amongst the above and why choosethat?

Page 45 of 103
SECTION B
This section has two parts; I and IIPart I
Answer one item from this part
Item 3 (20 scores)
So as to boost the mathematics performance in your class, the head of mathematics department want to motivate
learners but she wants to set a pass mark such that most ofthe learners are awarded the mathematics test was given
and the following are the marksscored. It was noted that 60% of the students failed.
86 85 56 59 67 62 63 50 91 62
56 27 50 54 80 61 52 52 16 28
66 46 55 58 56 77 26 40 42 51
35 45 68 51 49 40 93 84 79 63
52 53 25 93 27 71 66 52 30 12
The motivates as shown in the table below.
On the day of the academic assemble, the class teacher went for shopping and he found out that it is possible to
buy 5 counter books and 7 rulers at a total cost of 11,800 from thestaff stationary shop or 6 rulers and 8 counter
books at a total cost 14,000 from the same the staff stationary shop. The teacher is interested in buying 5 counter
books and five rulers.
Task:
a) Help the head of mathematics department determine the score to base on.
b) Assist the departmental head find the pass mark for the class.
c) help the head of department to determine the items.
Item 4 (20 scores)
The Ministry of Health in Uganda is conducting a survey about the existence of malaria in three districts: A, B
and C. The ministry will then come up with control measures if thechance of a person testing positive having
visited at least one of the districts is above 50%. The Ministry has intentionally selected a sample of people who
visited the three districts and tested them for malaria. The test results have revealed that 50 people who visited
district A, 60 people who visited district B and 40 people who visited district C tested positive for malaria.
Additionally, 20 people who visited both districts A and B, 10people who visited districts A and C, and 15 people
who visited districts B and C tested positive for malaria. The Ministry has also discovered that 20 people who
only visited district C tested positive for malaria and 40 people who visited the three districts tested negative for
malaria.
Task:
(a) Determine the number of people that were tested for malaria by the ministry ofhealth.
(b) Calculate the probability of a person testing positive having visited at least one ofthe three districts.
(c) Advise the Ministry of health, with a reason based on calculation, whether to comeup with control
measures or not.

Page 46 of 103
Part II
Answer one item from this part
Item 5 (20 scores)
In preparation for S.4 prom party, you were chosen by your fellow candidates to be a
chairperson of organizing committee. You moved from school to Town A for shopping of
party items which is 160km north of your school. From town A you moved west wards 150km
to town B. from B you headed to town C in the direction S75OW which is 90km from B. from
C you continued to town D which is 148km and south of B. but after you discovered that there
is the shortest route you could use to move directly from school to town D.

In the shopping, you bought 400 chicken and each cost UGX 35,000. The farmer gave you
2% discount on each chicken. You also bought two identical jerry cans of cooking oil. The
larger being of height 30cm and smaller of 25cm. the larger has a capacity of 10liters and
the smaller 5 litters. And you bought 4 smaller and 2 larger jerry cans.
Task
a) With relevant sketch and calculations, determine how far you would move if you usedthe
shortest route.
b) Determine the total cost incurred in purchasing chicken.
c) What is the maximum amount of cooking oil you bought for the party?
Item 6 (20 scores)
The youths of a certain village have been playing football on Mr. Kizito‟s land. Of recent,Mr.
Kizito has decided to cultivate his land to plant cassava and the youths are no longer having
where to play football from. On reporting to the chairperson and the aspiring M.P of their
area, the chairperson has promised them land that measures 60m by 120m and theaspiring
M.P, a tractor to level this land into a football pitch. The youths are therefore to contribute for
the fuel to be used by the tractor.
Support material
• The dimensions of the pitch should be 100m by 50m.
• Scale 1cm represents 10m
• The cost of fuel by liter is 5000/=
• The tractor uses 10 liters every after 30minutes.
Task:
(a) Help the youth leader of the village to:
(i) Design the given piece of land.
(ii) Determine the area of the proportion of land that remains after
theconstruction of the football pitch.
(iii) Decide on what the remaining land should be used for
(b) If the tractor levels 100m2 in one hour, how much money should be raised by the
youth to level the ground.
END

Page 47 of 103
Page 48 of 103
Page 49 of 103
Page 50 of 103
Page 51 of 103
Page 52 of 103
Page 53 of 103
Page 54 of 103
Page 55 of 103
Page 56 of 103
Page 57 of 103
Page 58 of 103
Page 59 of 103
Page 60 of 103
Page 61 of 103
Page 62 of 103
Page 63 of 103
Page 64 of 103
Page 65 of 103
Page 66 of 103
Page 67 of 103
Page 68 of 103
Page 69 of 103
Page 70 of 103
Page 71 of 103
Page 72 of 103
Page 73 of 103
Page 74 of 103
Page 75 of 103
Page 76 of 103
Page 77 of 103
Page 78 of 103
ITEMONE:
A certain member of your family re-wrote each digit of his 4-digit 𝐀𝐓𝐌 card pin from
numbersystemten(baseten)toanothernumbersystemlessthanfour.Hedidthisinfear oftheft.Nowheissick in
thehospital,hecanneithertalk norwritebutthemoneyon his account is needed to finance hospital bills. Here is how
he wrote the pin: 12 20 22
10.Assumingthatyouhavebeenabletoencryptthe𝐀𝐓𝐌 pinforthefamilyandfundsare
availabletotakecareofhim.Thehospitalhasanursewhotakeschecksonhimafterevery two hours and a medical doctor
who checks on him after every four and half hours. Both medical personnel last checked on him together at
𝟗:𝟑𝟎𝐚𝐦. He was treated well and discharged and advised as follows. He was advised to spend three−eights of the
day resting, one sixth of the day eating, two thirds of the remainder having a healthy diet and the rest of time of the
day visiting the hospital for further checkup.
TASKS:
(a) (i) Whichnumbersystemdoyouthinkheusedtore-writethepinandwhy?
(ii) Usetheidentifiednumbersystemtohelpyourfamilymembersto regenerate the original
pin.

(b) (i) Atwhattimedidwillboththenurseandmedicaldoctorcheckonhim again at the same time.


(c) Howmanyhoursofthedayinaweekdoeshehavespendonvisitingthe hospital.

ITEMTWO:
AproducewholesaledealerinKalerweFarmersMarkethasabroker whohasbeenhelping him order for his produce on his
half. However he has been informed that his broker left for Saudi Arabia in quest for greener pastures, he is much
troubled yet he wants to order for 𝟏𝟐𝟎𝟎 𝐛𝐚𝐠𝐬 of produce. He visited his business books and noticed that in
January,when he bought 𝟑𝟎𝟎 𝐛𝐚𝐠𝐬, the cost of transporting each bag was 𝐔𝐆𝐗𝟒𝟓𝟎𝟎 and in Februarywhen he
bought 𝟕𝟎𝟎 𝐛𝐚𝐠𝐬, the costof transporting each bag was 𝐔𝐆𝐗𝟖𝟓𝟎𝟎. He has resorted to do the ordering and buying
by himself.
In preparation for Easter he went to Luuka Village to buy some produce with his lorry. Unfortunately his Lorry
broke down and opted for two vehicles a Pickup and an Isuzu Diana.Thepickupcantransport𝟏𝟖𝐛𝐚𝐠𝐬
whiletheIsuzuDianacantransport𝟑𝟎𝐛𝐚𝐠𝐬. The number of bags to betransported mustexceed 𝟏𝟐𝟎.Each tripthe
Pickup and Isuzu Diana makes cost 𝐔𝐆𝐗𝟐𝟒𝟎,𝟎𝟎𝟎 and 𝐔𝐆𝐗𝟑𝟎𝟎,𝟎𝟎𝟎 respectively yet he has allocated
𝐔𝐆𝐗𝟐,𝟒𝟎𝟎,𝟎𝟎𝟎tocaterfortransport.

Page 79 of 103
ThenumberoftripsmadebythepickupsshouldnotexceedthosemadebytheIsuzuDiana by more than 𝟐.
TASKS:
(a) Determinethecostthewholesaledealerwillpayforthe 𝟏𝟐𝟎𝟎𝐛𝐚𝐠𝐬.
(b) Helpthedearobtainhowmanytripseachvehiclewillmakeinorderto minimize the cost of
transport.
ITEM THREE:
There is a quarantine of all cattle and goats in some parts of Western Uganda especially Mbarara District. The area
honorable Member of parliament (M.P) wants to throw for his constituents a celebration party for the success of the
Parish Development Model (PDM) andhehasinvitedalotofguests.Howeverduetthequarantinehecannotbuyanyanimals
from Mbarara and he has been advised to go to Kayunga where cheap cattle and good Yoghurt can be found. He
moves from Mbarara to Masaka which is 𝟏𝟔𝟎𝐤𝐦 North of Mbarara. From Masaka he moves west wards 𝟏𝟓𝟎𝐤𝐦
to Kampala. From Kampala he heads to Mukono which is in the direction 𝑺𝟕𝟓𝑶𝑾 which is 𝟗𝟎𝐤𝐦 from Kampala.
From Kampala he heads to Kayunga which is 𝟏𝟒𝟖𝐤𝐦 and south of Mukono.
WhenhereachedKayungahebought𝟒𝟎𝟎cowsandeachcosts𝐔𝐆𝐗𝟖𝟓𝟎,𝟎𝟎𝟎percow.
Thefarmerandownerofthecowfirstgivesa𝟓%discountoneachcowplusanadditional
𝟏𝟎%discountforanynumberofcowsboughtinexcessof 𝟐𝟓𝟎.
Inordertopackagetheyoghurt,heboughttwoidenticaltypesofbuckets.Asmallerbucket with a base radius of 𝟑𝟎𝐜𝐦 and
alarger bucket with a base radius of 𝟓𝟎𝐜𝐦. He intends to use the buckets to keep the Yoghurt for his guests. The
capacity of the smaller bucket is
𝟒𝟓𝐥𝐢𝐭𝐫𝐞𝐬andheistobuy𝟒smallerbucketsand𝟐largerbuckets.
TASKS.
(a) DirectthehonorableMPontheshortestrouteheshouldtakeandtheshortest distance between Mbarara
and Kayunga.
(b) Findthetotalcostheincurredinpurchasingthecows.
(c) WhatisthemaximumamountofYoghurtbeboughtforhis guests.

ITEM FOUR:
Holy Prayers Ministries International for a long time has been soliciting money to construct a church which can
congregate all the church members. The Senior Pastor has a vision of a Hexagonal church which can fit exactlyin
theplot of land available. He wants to know the actual cost of constructing the church. He also has to buy a Sino
Truck to transportallbuildingmaterialsandrequirements.Thecontractorinformshimthatthearea of each triangle that
can be formed from the hexagonal church will cost him
𝐔𝐆𝐗𝟏𝟐𝟖,𝟎𝟎𝟎,𝟎𝟎𝟎.

Page 80 of 103
He then proceeded to Nina Motors to buy the Sino truck. A brand new Sino Truck costs
fourhundredeightymillionsoncash.Itcanalsobeboughtbypayingadepositofaquarter of the cash price value and either
pay 𝐔𝐆𝐗𝟕.𝟓 𝐦𝐢𝐥𝐥𝐢𝐨𝐧𝐬 weekly for 𝟓𝟎 𝐰𝐞𝐞𝐤𝐬 or pay
𝟐𝟒.𝟓𝐦𝐢𝐥𝐥𝐢𝐨𝐧𝐬 monthlyfor𝟏𝟓𝐦𝐨𝐧𝐭𝐡𝐬.Thepastordoesnothavetherequiredmoneyto obtain the Sino Truck on cash.
TASKS:
(a) Helpthepastordeterminethecostofthechurch.
(b) HowmuchextrawillhepayfortheSinoTruckandexplainwhy.(25scores)

ITEM FIVE:
A school head teacher isthinkingof how he canboostthe mathematicsdepartment ofyour school. He can either add
another teacher or buy more books or both. He has decided that he will do both if the average performance for this
year‟s performance for the 40 students islowerthanthatofthepreviouswhichwas 𝟒𝟕.
Heaskedthedepartmenttogiveatestand the these were the student‟s marks.
50 71 40 48 61 70 30 62

44 63 60 51 55 25 32 65

54 45 65 50 45 40 25 45

48 45 30 38 30 28 24 48

30 48 28 35 50 48 50 60

Healsovisitedthelibraryandfoundoutthat theprevious‟scandidatesusedthreebooksfor there revision. Longhorn,


Baroque or Maths Clinic. Fromthe librarian‟s records its is clear that all the candidates that did not use any book
failed the subject greatly. Out of the 𝟑𝟓 candidates this year 𝟏𝟑 used Longhorn, 𝟐𝟎 used Baroque and 𝟏𝟕 used
Maths Clinic.
𝟗 used Longhorn and Maths Clinic, 𝟑 used Longhorn and Baroque while 𝟖 used Baroque and Maths
Cliniconly.Therecordsshowthat 𝟐 used allthethreebooks.Heobservedthat
heshouldreplaceonebooktypeofthethreewithFountainpublishersincenostudentread it only alone.
TASKS:
(a) (i) Helptheheadteachergroupthemarkstomakeaninformeddecision one the fate of the
department and defend it.
(ii) Displaythestudentsmarksingroupsonasimplestatistics diagram.
(b) (i) Helptheheadteacheridentifythebookheshouldreplaceandexplain why?
(ii) Findtheprobabilitythatastudentselectedfromtheclass failed.

Page 81 of 103
ITEMSIX:
Three schools from a Gayaza region want to participate in the National Schools Football
SportsGalatobeheldinLyantondedistrictplayground.Unfortunatelynoneoftheschools has a school bus and they want
to hire a bus for the one day for the activity. The bus charges 25,000km per km moved. The three schools through
there Sports master agreed to share the cost of the bus equally amongst them selves. One that day they hired a bus
from your school in Gayaza and they set off at 𝟒:𝟑𝟎𝒂𝒎 and increased the speed gradually to
𝟏
𝟗𝟎𝒌𝒎/𝒉𝒓 reachingMpigiat𝟔:𝟒𝟓𝒂𝒎. Fromtherethebusdriver maintainedthissame speed for 𝟐 hours reaching
Masaka. From Masaka the he reduced slowly in speed
𝟒
reachingLyantondeat 𝟗:𝟑𝟎𝒂𝒎.Thegamesstartedat𝟏𝟎:𝟎𝟎𝒂𝒎sharpandeachteam
playedsixgames.
School Awon𝟑 games,drew𝟐 andlost𝟏 game.School Bwon𝟒 games andlost𝟐 games. School C won 2 games and
drew 𝟒 games. The organizers award three points for a win, one point for a draw and no point for a loss. They
declared these schools the first three schools in order of their points they obtained from the games. They were to
receive the price money of sixteen millions five hundred thousand shillings.
TASKS:
(a) Findhowmucheachschoolpaidforthebus.
(b) Decidethecashprizefor school.
ITEM SEVEN
A man intends to plant trees on the two sides of the road which leads to his land. On one side of the road, he is to
plant a tree every after 𝟓𝒎yet on the other side he is to plant a tree every after 𝟔𝒎. at the start of the road, two trees
are to be planted directly opposite each other. In the first phase of planting trees, he will plant trees, until another
pair of tress is againdirectlyopposite.His land has an areaof 𝟓𝟎𝟎𝒎𝟐.Heplanstouse 𝟐𝟓% oftheland to plant maize,
one fifth of the land for beans and 𝟐𝟎𝟓𝒎𝟐dor growing ground nuts.

Tasks:
(a) Helpthemandeterminehowmanytreeseedlingsheneedstobuytojust plantthis first phase.
(b) Determinein𝒎𝟐thesizeoftheland tobeusedforgrowingmaize.
(c) Determinein𝒎𝟐thesizeofthelandtobeusedforgrowingbeans.
(d) Expresstheareatobeusedforgrowinggroundnutsinstandardform.
(e) Doyouthinkhepartitionedtheentirelandproperly?Giveareason.

ITEM EIGHT
Amathematician gaveyourfriend acarpenteratask ofmakingarectangularground floor of a rabbit house. The length of
the house is to be (𝒙 + 𝟑)𝒎 and the width is to 𝒚𝒎. Its perimeter should be 𝟐𝟓𝒎 and its area msut be 𝟐𝟓𝒎𝟐. The
mathematician adds that he needstheworktobefinishedinonedaybuthehasevercontracted 𝟑𝒎𝒆𝒏 workingatthe

Page 82 of 103
samerateand theyonlymanaged to workon 𝟓𝒎𝟐.Tobegiven this contract,yourfriendis required to make a clear
diagram showing the numerical sizes of the length and width but fails to do so and comes to you for help.
Tasks:
(a) (i) Determinethelengthandwidthofthefloortobeoccupiedbythe house.
(ii) Makeasketchoftheflooryourfriendcanpresenttothemathematiciantoget the contract.
(b) Determinethenumberofworkerswhoareneededtocompletethehouseiftheyall work at the same rate as the
group the man has ever used.

ITEMNINE
A friend of yours wanted to participate in the National Ludo Champions competitions. During his practice, he
rolled a die several times and kept on taking a picture of each
occurrence.Heneedstofindoutwhetherhewillcompetefavorablybutheisunabletodo so. He gives you the diagram
below showing his scores so that you can guide him.

Tasks:
(a) Usetheinformationaboveandclearlyshowhowtodeterminethescorewith the highest chance of
occurring on top. Which score is it?

Page 83 of 103
(b) Findtheprobabilitythatanoddnumberoccurredwhenthediewas rolled.
(c) Presenttheinformationoftheabovescoresonastatisticalgraph.
(d) Willyourfriendcompetefavorablyinthecompetitions?Giveareason.

ITEMTEN
Anorganizationwantstobuildaschoolinacertaincommunity.Belowwerethereasons they identified as to why
children were not schooling.
𝐀=schoolisboring. 𝐁=noschoolfees. 𝐂=wewant to work.
They carried out research on a sample of 𝟓𝟎 children in that community to find out which
reasonhasthehighestprobabilityamongsttheaboveandhencebaseonthattoeitherbuild the school or not. Children gave
one reason, others gave two and the others gave three as shown below.
A B,C B A,C A B,C B A,C A,B,C B

C,B B B,C A,B,C A,C B C B C B

B A,B,C B,A A B A C,B A,B B,A C

C A,C B,A B C,B C C A B B,C

A,C B A A C B,A C B A A,C

Tasks:
(a) Presentthedatainsuchawaythatthetotalresponsesforeachreasons𝐀,𝐁and
𝐂respectivelyareclearly shown
(b) (i) Whichreasonhasthehighest probability?
(ii) Whatisthe probability?
(iii) Basingonthevalueofprobabilityshouldtheybuildtheschoolornot? Give a reason for your
answer.
ITEM ELEVEN
A carpenter is re-known for crafting traditional wooden doors with elaborate geometric patterns. The carpenter
wishes to make a door with a circular design at its center. The
carpenterneedstoensurethedesignfitsperfectlywithintherectangularframeofthedoor. The door frame available is
rectangular with dimensions 𝟐.𝟓𝐦𝐞𝐭𝐞𝐫𝐬 in height and
𝟏.𝟓𝐦𝐞𝐭𝐞𝐫𝐬 inwidth.Thecirculardesignshouldbetouchingthetwoparallelsidesofthe door frame. Vanish is packed in
tins of a litre and the cost of one litre of vanish is
𝑼𝑮𝑿𝟗,𝟎𝟎𝟎.Itisknownthatonelitreofvanishcanbeusedtopaintonesquare meter.

Page 84 of 103
Tasks:
(a) (i) Helpthecarpenterdeterminehowmuchofthedoorwillbecoveredby the circular design so that
it fits perfectly within the door frame.
(ii) Willonetinofvanishbeenoughfor thecirculardesign?Giveareason for your response.
(b) Withareason(s),helpthecarpenterdeterminehowmuchwillbespenttobuy vanish that will paint the
entire front face of the door.

ITEM TWELVE
Youareanathleteandsooncompetingwithsomeone.Youwantedtotestyourchancesof winning the racebytesting yourspeed
and time in relation tothat of your competitoryou started to run at 𝟒:𝟓𝟎𝐩𝐦.Fromyour home where you started from, you
ran a distanceof
𝟓𝐤𝐦 north−westtoplace𝐏,thenfrom𝐏,youturnedsouthandran𝟒𝒌𝒎 untilyouwereat place 𝐐 that is west of your home
and then ran back and arrived at 𝟓:𝟏𝟐𝐩𝐦. Your competitor ran the same distance during training at a speed of
𝟏𝟎𝐦/𝐬.
Tasks:
(a) Whatisthetotaldistancethatyouran?
(b) Whatisthetotaltimeyoutooktorunthatdistance?
(c) Howfastwereyou?
(d) (i) Doyouthinkyouwillwintheraceornot?
(ii) Whydoyouthinkthat way?
ITEM THIRTEEN:
A school head teacher isthinkingof how he can boostthe mathematicsdepartment ofyour school. He can either add
another teacher or buy more books or both. He has decided that he will do both if the average performance for this
year‟s performance for the 50 students islowerthanthatoftheprevious whichwas𝟔𝟒.
Heaskedthedepartmenttogiveatestand the these were the student‟s marks.
86 30 26 64 87 47 49 26 43 25
45 38 44 56 59 52 76 27 89 46
90 57 73 48 58 89 51 32 56 88
66 62 52 67 69 68 49 92 66 95
54 74 32 39 35 36 69 50 71 92
Healsovisitedthelibraryandfoundoutthattheprevious‟scandidatesusedthreebooksfor there revision. Longhorn,
Baroque or Maths Clinic. Fromthe librarian‟s records its is clear that all the candidates that did not use any book
failed the subject greatly. Out of the 𝟑𝟓
candidatesthisyear𝟏𝟑usedLonghorn,𝟐𝟎usedBaroqueand𝟏𝟕usedMaths Clinic.

Page 85 of 103
𝟗 used Longhorn and Maths Clinic, 𝟑 used Longhorn and Baroque while 𝟖 used Baroque and Maths
Cliniconly.Therecordsshowthat 𝟐 used allthethreebooks.Heobservedthat
heshouldreplaceonebooktypeofthethreewithFountainpublishersincenostudentread it only alone.
TASKS:
(a) (i) Helptheheadteachergroupthemarkstomakeaninformed decision one the fate
of the department and defend it.
(ii) Displaythestudentsmarksingroupsonasimplestatistics diagram.
(b) (i) Helptheheadteacheridentifythebookheshouldreplaceand explain why?
(ii) Findtheprobabilitythatastudentselectedfromtheclass failed.

ITEM FOUTRTEEN
St. JULIAN is to transport its S. 4 students for fieldwork in Kasenyi.All the 400 students
aretobetransportedusingeithercoastersorbuses.Eachcoastercancarry40peoplewhile
eachbuscancarry80people.Thetransportdepartmentof theschoolhasonly8driverson duty and up to four coasters.If the
cost of hiring a coaster is shs. 150,000 and that of hiring a bus is shs. 300,000.
While in Kasenyi their geography teacher Mr Kefa visited Mr Sembatya‟s shop fromwhichhefoundthat
threeshirtsandtwotrouserscostshs.105,000atMr.Sembatya‟s shop. Two shirts and five trousers cost shs. 180,000 at
the same shop;
Task:

(a) (i) Writedownthefiveinequalitiesrepresentingtheabove information.

(ii) Representtheinequalitiesonagraphpaper.

(iii) Find the possible number of coasters and buses that can be used and
hence determine the minimum cost.
(b) Findthecost of;

(i) eachshirtandeachtrouser.

(ii) threeitemsofeachtypeatthe shop.

Page 86 of 103
ITEM FIFTEEN:
Simon is the district inspector of schools in Butambala district found that his causal
workersuseonethirdofhisfarmforbananas,onequarterforcoffeeandtwofifthofthe remainder for mixed farming.She
still has some six acres of unused land.
Buddo S.S has a student population of 1200 students.On a particular day Simon invited

theentirefora,1⁄5oftheboysand1⁄4ofthegirlswenttoWAKISSHAresourcecentre for a sports meeting.If 936


students were left behind.
ThepriceofSimon‟shousewasvaluedat45millionshillings.Itincreasedby25%after the first year but in the second
year, the value of the house depreciated by 10%.
Task:

(a) Findthesizeofhis farmandclearlyillustrateitonadiagram.

(b) Findhowmanymoreboysthangirlsattendedthemeeting.

(c) Findthevalueofherhouseattheendofthesecond(2nd)year.

ITEM SIXTEEN:
Kampala (K) and Arua (A) are about 450km apart.At 7:30 a.m, a bus starts from Arua and
moves towards Kampala (K) at a steady speed of 100km/hr while a lorry starts from Kampala (K) an hour later
moving at an average speed of 60km/hr to Arua (A).At 10.00 a.m, the busisstopped attown C bypoliceand ordered
to reduce speed.After 30 minutes atC,itresumesitsjourneyatareducedaveragespeedof50km/hruntilitreachesKampala
(K).
Task:

(a) Statethedifferenceintimewhenthetwovehiclesarriveattheirdestinations.

(b) DeterminewhenandatwhatdistancefromAruathetwovehicles meet.

(c) Findtheaveragespeedofthebus.
ITEM SEVENTEEN:
You are only two children in the family and the chairperson of your village has come to your home to register the
details of you and your sibling. Unfortunately both parents are
notaroundandyouhegivesthemacalltofindyourpresentages.Themotherinformshim that the two ages differ by 4. the
father informs him that the sum of the squares of your ages is 136.

Page 87 of 103
Your neighbor makes a rectangular flower bed by taking two meters off its length and adding three meters to its
breadth. Byso doing, he increases the area by 20 square meters. Mosesis1.5mtall and standingontopofabuilding
34mtall.In astraight linefromwhere he is standing he can see a car and bicycle at angles of depressions of 50o and
65orespectively.
A magician on Easter day organized a presentation in your village to entertain the village. Hehadabadthat
containsxredballsand(x -8)whiteballs.Iftheprobabilityofdrawinga
2
redball is .
3

Tasks:
(a) Helpthechairpersongettherightagesofyouandyoursibling.

(b) Whatisitsfinalareaoftheflowerbed?

(c) Howfaristhebicyclefromthecar?

(d) Findthenumberofballsinthebag.
ITEM EIGHTEEN
The cost of manufacturing Blue band in a factory is determined by the components milk x and flavor y.If the
constraints for the production are3y2x15,2x 3y 5,x1andy  0. The factory has only chicken and goats. When
the manager counted the heads of the stock inthe farm, the number totalledto200. When thenumber oflegs was
counted, the number totalled to 540.

Task

(a) Giventhatthecostfunction fortheproductionofbluebandis cx2yfindthe;

(i) Minimumcost

(ii) Maximumcost

(b) Howmanychickenswerethereonthefarm?
ITEM NINETEEN
Yourparentsareorganizingtocelebrateyour18thbirthdayandwantottobeamemeorable one. They went to Akamwesi
mall which has a CINEMAX and it has two tickets.
Ticketstoaplaycost9𝑑𝑜𝑙𝑙𝑎𝑟𝑠 foradultsand5𝑑𝑜𝑙𝑙𝑎𝑟𝑠 forchildren.Iftheshowsold180 tickets and earned 1380 dollars,
George your brother has neen planning for this birthday for three weeks. He buys the
followingitemsinthreeweeks.Weekonehebuys2packetsoftea,2tinsofmargarine, 3 kgof sugarand4 packetsof biscuits.
Week twohe buys2 tinsof margarine , 3 kg

Page 88 of 103
of sugarand4 packetsof biscuits . Week three he buys2 packetof tea , 2 kgof sugar and
3packetsofbiscuits.Apacketofteacostsshs 1,000 ,atinofmargarinecostsshs 2,500,akilogrammeof sugarcostsshs
3,500and apacketofbiscuitscostsshs2000. Your parents then demarcated the land they are to use for the party and
plan to demarcate
it.representedtheplotoflandheinheritedusingthefollowinginequalities.40x60y480

…(i) 30,000x45,000y600,000…(ii) x12…(iii) y2x…(iv)


Hewantstofenceitusingpoles(x)andbarbedwire(y)andthecostfunction isgiven by

C45000x30,000y

Task;

(a) howmanyofeachtypeofticketswere sold?

(b) Findhistotalexpenditureinthethreeweeks.

(c) findthemaximumcost.

ITEM TWENTY
Thelength ofarectangularplotofland exceedsthewidthby7𝑓𝑡 andits areais 60𝑠𝑞.𝑓𝑡. Three business partners
Wambusa, Aisha and Wekesa contributed Shs 300.000, 500.000

and 700.000 respectivelytostart abusiness.Theydecided that1oftheprofit wastobe


3
ploughedbacktothebusiness,1oftheremainderwould bekept foremergencies andthe
5
resttobesharedintheratiooftheircapitalcontributions.Inthatyeartheprofitrealized was one and a quarter times that of
capital.
Task:

(a) Findthedimensionsoftherectangle

(b) Determinetheamountreceivedbyeachpartnerthat year.

Page 89 of 103
ITEMTWENTYONE
A bucket is in shape of a frustrum with an open end of diameter 30cm and a bottom
diameterof20cm.thebucketwhichis42cmdeepisusedtofillanemptycylindricaltank of diameter 1.8m and Height 1.2m

30cm

42cm

20cm

Taking𝜋=3.142.

Threehundredandsixtylitresofahomogeneouspaintismadebymixingthreepaints A,B and C. The ratio by amount of


point A to point B is 3:2 and that of B to C is 1:2. Paint A costs shs 1800 per litre paint B costs shs 2400 per litre
and paint C shs 1,275 per litre

Task:

(a) (i) Determinethecapacityofthebucketinlitrescorrectto3dp.

(ii) Thecapacityofthetankinlitrescorrectto2dp.

(iii) Thenumberofbucketthatmustbedrawntofillthe tank.

(b) (i) Theamountofeachpaintinthe mixture

(ii) Theamountofmoneyneedtomake1litreofthe mixture

(iii) Thepercentageprofitmadebysellingthemixtureatshs2,210perlitre.

ITEMTWENTYTWO
Thereareveryfewteacherswhohavethreeteachingsubjects.Asurveywasdoneinyour
schoolanditwasfoundthattheschoolhasateachingstaffof22teachers8ofthemteach mathematics, 7 teach physics and 4 teach
Chemistry. Three teach both mathematics and Physics and one teaches Mathematics and Chemistry. No teacher teaches
all the three

Page 90 of 103
subjects.ThenumberofteacherswhoteachPhysicsandChemistryisequaltothatofthose who teach Chemistry but not
physics.

Intheschoolstaffroomtherearetwosimilarcansthahavedifferentheights.One6cmand the other one 9cm. If the surface


area of the larger can is 840 cm2.
Task

(a) Findthenumberofteacherswhoteachnoneofthethree subjects.

(b) Findtheprobabilitythatateacherpickedatrandomteachesonlyonesubject.
(c) Findthesurfaceareaofthesmallercan.
ITEMTWENTYTHREE
The traffic police arrests all motorists travlelling along Kampala-Jinja highway with a speedgreaterthan80km/hr.
Amotoristtravelledthefirst90kmatanaveragespeedof60
1
km/hrandforthenext3 hourshetravelledatanaveragespeedof80km/hr.
2
Onacertaindayacartravellingat𝑠km/hrcanbestoppedwithinadistance𝑑metres
𝒔𝟐 𝒔
where 𝒅= + Thetablebelowgivessomevaluesof𝒅against𝒔.
𝟐𝟎𝟎 𝟏
𝟎

𝑠 0 10 20 30 40 50 60 70 80 90 100
𝑑 0 7.5 31.5 60
(a) Findoutifthemotoristwillbe arrested.
(b) Findthestoppingdistanceforacarmovingat46km/hrandat85km/hr.Alsofind the speed at which a car is
moving if its stopping distance is 35 metres.
ITEMTWENTYFOUR
In a survey 100 people were asked which form of transport they used. 46 people only used
bicycles(M).21peopleonlyusedbuses(N).11peopleonlyusedmotorbikes(P).5people used buses and bicycles but not
motor bikes. 3 people used buses and motor bikes. 6people used bicycles and motor bikes. 9 people declined to
respond.
Customsdutyandpurchasetaxareleviedoncertainimportedgoodsas Customs duty = 35% of the value
of the good.
Purchasetax=15%of(value +duty)
Task
(a) Findthe;
(i) numberofpeoplewhousedallthethreeformsoftransport.

(ii) percentageofpeoplewhousedonlytwoformsof transport.

Page 91 of 103
(b) Findthetotalamountleviedonadiscodeckvaluedat1.7millions.

ITEMTWENTYFIVE
ThefigurebelowshowsanetofarightpyramidwitharectangularbaseABCD.

D C

V
A B

IfVisthevertexofthepyramid VABCDabovethebaseABCD, and the slant sides of AB16cm,BC12cm,


each triangle measure 26cm.
a) Drawtherightpyramidshowingclearlypoints VABCD,
b) Findtheheightofthepyramid.
c) Findtheareaofplane VAB
d) Findtheanglebetween;
(i) EdgeVAandthebase
(ii) FaceVABandthebase.

ITEMTWENTYSIX

Mr kyeswa is buying aconatinertostartahardwareinKisoobaVillagetosellbagsof


cement.Eachbagoccupiesanareaof0.8cubicmeters.Thecontaineris𝐴𝐵𝐶𝐷𝐸𝐹𝐺𝐻with
𝐴𝐵=12𝑚,𝐵𝐶=9𝑚,𝐴𝐷𝐸𝐹isasquareand𝑂isthepointofintersectionof𝐴𝐶and𝐵𝐷.

Page 92 of 103
(a) Findthedistances;
(i) 𝐵𝐸,
(ii) 𝑂𝐻.
(b) Determinetheangleformedbetween;
(i) line𝐵𝐸andthe base,
(ii) plane𝐵𝐷𝐻andthebase.
(c) Calculatethecapacityofthecuboidaboveinlitres andhowmanybagscanbe accommodated.

ITEMTWENTYSEVEN
Pamungu bought a car in January 2017 from his friend at shs. 12,500,000. If the car
depreciatesatarateof10%perannum.CalculatethevalueofPamungu‟scarbyJanuary 2020.
AUgandantouristleftGermanyforUgandathroughSwitzerland.WhileinSwitzerlandhe bought a watch worth 54 Deutsche
Marks (Germany currency).

1SwissFranc=1.28DeutscheMarks

1SwissFranc=1,350Ugandan Shillings
AsecondaryschoolteacherasarequirementbythegovernmentpaysPAYEeverymonth according to the tax structure below.

Income(shs)per month Taxrate(%)


01-50,000 5%
50,001-100,000 9.5%

100,001-180,000 15%

180,001-300,000 18%

Page 93 of 103
300,001-400,000 23%

400,001-500,000 30%

Above500,000 35%

TheteacherearnsShs.760,000andhisallowancesinclude
Marriage allowance - shs.50,000permonth
Waterandelectricity - shs.60,000permonth
Housingallowance - shs150,000per month
Medicalallowance - shs.300,000perannum
Transport allowance - shs.3,000 per day Paying
for insurance and relief - shs.180,000perannum
Familyallowanceforonlythreechildren.Forchildrenintheagebracket 0 to 10 years, shs
12,000 per child,
Between10-15yearsshs.9000perchild 15 years and
above shs 5000.
Giventhattheemployeehasfivechildren,twoofwhomareagedbetween0and10,the other two aged between 10 and
15 while the other 18 years. (A month has 30 days

(a) Findthevalueofthewatchin;
(i) SwissFrancs
(ii) UgandanShillings.
(a) Determinetheteacher‟sNet-income

(b) Determinethepercentageofhisgrossincomethatgoestotax.

Page 94 of 103
SECTIONA
Answerallitemsinthis section.
Item1. (20scores)
Number plates, also known as license plates or registration plates are typically manufactured using a combination
of digital printing technology and specialized equipment. Your guardian has three taxis that travel along Kampala-
Gulu high way registered 𝑼𝑩𝑨 𝟒𝟒𝟑𝑻, 𝑼𝑩𝑩 𝟐𝟐𝟑𝑹 and 𝑼𝑩𝑫 𝟏𝟑𝟐𝑽, the numerical digits on the number
plateswerefoundtobeinquinarybaseandheisinterestedin knowingwhichvehiclehas digits which are a multiple of
three so that he can paint that vehicle with a red color for easy identification.
All thethree taxisleave Namayiba taxipark at 𝟔:𝟎𝟎𝒂𝒎 for their first route to different
destinations,howevertheyentertheafteratdifferenttimeintervals.Thefirsttaxienters the taxi at 𝟖:𝟑𝟎𝒂𝒎, the second
taxi at 𝟗:𝟎𝟎𝒂𝒎 and the third one enters at 𝟗:𝟏𝟓𝒂𝒎.
The fuel consumption rate for all the three taxis is the same and it was observed that when anyofthetaxihadcovered
𝟔𝟎𝒌𝒎,thefuelconsumedcosted𝑼𝑮𝑿𝟏𝟔𝟎,𝟎𝟎𝟎 andwhenthe taxi had travelled 𝟏𝟓𝒌𝒎, the fuel consumed was 𝑼𝑮𝑿
𝟒𝟎,𝟎𝟎𝟎.
Task:

(a) Helpyourguardianknowwhichtaxihewillpaintthered colour.

(b) AtwhattimewillthethreetaxisenterNamayibataxiparkallatthesametime.

(c) Whatistheestimatecostonfuelconsumptionifthetaxiplanstotakeyourschool for a tour to Jinja which is


approximately 90km from Namayiba taxi park.
Item2. (20scores)
Afamilyofyourfriend agreedtohavefamilyplanningsothattheycaneffectivelyplanfor their children. They agreed to have
a child spacing of two years so that their business of drinks (water and soda) can pick up with time. They had their
first born in 2020.
Attheirdrinksshop theyselltwotypes ofwaterbottles,typeAand typeBand theymake the water bottles by themselves.
The same equipment can be used to make either water bottle.In making type Awater bottles,oneman can supervise10
machines andthis batch

Page 95 of 103
willgivethemaprofitof𝑼𝑮𝑿𝟓𝟎,𝟎𝟎𝟎perday.TypeBwaterbottlesyieldaprofitof
𝑼𝑮𝑿𝟐𝟓𝟎,𝟎𝟎𝟎 adayusing25 machinesand8men.Thereare200machines and40men available.
Theproducedwaterisparkedincartoonsandyourschool hadathanksgivingfunctionand budgeted for 5 boxes of water
type A and 4 boxes of water type B at a cost of
𝑼𝑮𝑿𝟗𝟐,𝟓𝟎𝟎. However,thebodabodamanthatwassenttobuythewaterbrought4 boxes of water type A and 5 boxes of
water type B and was given a demand note of
𝑼𝑮𝑿𝟒𝟎𝟎𝟎asbalanceremainingtobepaidforwhathebought.
Task.

(a) Inwhichyeardoyouthinkyourfriend‟sfamilyhavetheirsixth born.

(b) (i) ShowthefeasibleregionoftherelationonaCartesianplane.


(ii) Helpyourfriend‟sfamilydeterminethemaximumprofittheywillreceive from the sale of the water
bottles.

(c) Whatdoyouthinkistheactualpriceofeachcartonofeachwatertype.
SECTIONB
Thissectionhastwoparts;IandII Part I
Answeroneitemfromthis part
Task3. (20scores)
Your school demonstration farm holds monthly sales of cattle on the first Saturday of
everymonth.Howthefarmcaretakerhasnoticed thatthereis atrendofthesameanimals remaining un sold every month
because the farm attendants just select the animals which are near, and so he wants to obtain the average weight of
all animals at the farm. He has agreed that this month all animals with a weight greater than the average weight of
the animals be sold each at UGX 890,000 per animal. The data in kg of the weights of the animals is given in the
table below.

Page 96 of 103
86 85 56 59 67 62 63 50 91 62
56 27 50 54 80 61 52 52 16 28

66 46 55 58 56 77 26 40 42 51

35 45 68 51 49 40 93 84 79 63

52 53 25 93 27 71 66 52 30 12

Additionallyheisgoingtosell15goats,25sheepand10duckseachat𝑼𝑮𝑿𝟏𝟒𝟎,𝟎𝟎𝟎
pergoat,𝑼𝑮𝑿𝟐𝟏𝟓,𝟎𝟎𝟎persheepand𝑼𝑮𝑿 𝟑𝟔,𝟎𝟎𝟎perduck respectively.
Task

(a) Givingareasonbasedoncalculations,usingthedatacollected,suggestthemost minimummass that can be


accepted tobesold on this first Saturdaythis month.
(b) HowmanycattlewillbesoldonthisfirstSaturdaythismonth.

(c) Helpthefarmcaretakerknowhowmuch moneyheexpectstoget fromthesales this month.


Item4. (20scores)
Malaria is a life threatening disease spread through mosquitoes that feed on humans, with symptoms such as high
fevers and shaking chills. As one of the top diseases impacting Ugandans, it is at a risk to cover 90% of the
Ugandan Population and is a leading cause of sickness and death especially in children. The mosquitoes breed
easily in bushy areas and instagnantwaterandinordertopreventit,healthofficialhaveadvisedthatwesleepunder a
mosquito net, slash all the bush around us and remove all stagnant water around us.
In a bid to curb the disease, health officials from your district visited your village to
distributemosquitonets,howevertheyfoundthatsomehomeswere harboringmosquitos around us.
Fifty two homes were visited in your village, it was found that only four homes had mosquito nets, had cleared all
the bushes around and had no stagnant water around and thus had managed to control malaria, the other homes had
problems of malaria. It was found that equalnumberofhomes had neithermosquito netsnorhadslashed theirbushes,
ofwhichtwelvehomeshadnomosquitonetsandhadnotslashedtheirbushesroundthem,
thusharboringmosquitoes.Twentyfourhomesalltogetherhadstagnantwateravailable in

Page 97 of 103
theirsoakpitsandopenmanholes,ofwhomelevenhadneithermosquitonetsnorremoved thestagnant water. Thirteen
homes hadbushes around and alsohad stagnant water present in their homes. Eight homes had no single mosquito
net, had huge bushes around and had stagnant water in their homes.
Task:

(a) Determinethenumberofmosquitonetstobedistributed,ifeachhomethatlackeda mosquito net was to be given


exactly four nets.
(b) Calculatetheprobabilitythatahomevisitedneededalsotohavetheirbushes slashed.
(c) Displaythedataonastatisticaldiagram.

(d) Advisethedistrictofficialswithreasonbasedoncalculationstocomeupwith control measures for


malaria.
PartII
Answeroneitemfromthis part
Item5. (20scores)
National Medical Stores (NMS) is a government parastatal mandated to procure, store and distribute essential
medicines and medical supplies to all public health facilities in the country. It uses trucks and lorries to do the
distribution. However there is concern about delay of the trucks to return to the parking lot in Wandegeya. On a
particular day a lorry and a truck are sent to deliver drugs to Hoima Regional referral hospital and Kiryandongo
hospital respectively. Theywere expected to return to the parking lot in Wandegeya which
isexactlyhalfwaybetweenHoimaandKiryandongo. Bothvehiclesdriveatasteadyspeed of 𝟖𝟎𝒌𝒎/𝒉𝒓 and set off at
𝟑:𝟎𝟎𝒂𝒎 from the NMS offices in Entebbe. From the point of setting off the lorry turns in the direction of 060o and
drives with a steady speed reaching Hoima at 𝟔:𝟎𝟎𝒂𝒎. The lorrysetsoff fromNMS offices and movesto
Kiryandongo whish is 330km the offices in the direction of 200o. each spends averagely two and half hours off
loading the drugs.

Page 98 of 103
Task.

(a) Helpthemanagerrecordthetimeeachvehicleis expectedtoreturntotheparking lot in Wandegeya.


(b) WhatisshortestdistancebetweenEntebbeandWandegeya.

(c) Inyourviewhowcanthehealthsystembeimprovedinyour area.


Item6. (20scores)
Your is starting a poultry farm after getting funds from the parish development model
PDM.Yourneighborborrowed𝐔𝐆𝐗𝟒𝟖.𝟓𝟐𝐦𝐢𝐥𝐥𝐢𝐨𝐧𝐬 from𝑷𝑫𝑴 tobereturnedafterone and half years at a rate of 𝟎.𝟓%
per month simple interest a so he has ordered for chicken drinkers from Biyinzika Poultry Farmers with the shape
ABCD in which ABCD is a rectangle and ADE is a semi-circle of diameter AD.BC= 20cm,AB= 10cm andCH =
50cm.

BiyinzikaPoultryfarmers sellstheeachdrinkeratUGX21,500,butoffersadiscountof 10 percentage onthetotal cost


for everyfiftydrinkers and an additional 5% on thetotal costonanyexcessof50drinkersbought.
Becauseyourneighborisbuyingfivehundred

Page 99 of 103
birds,heintendstobuy80drinkersbutdoesnotknowthecapacityofeachdrinker which will help him buy water tank to
harvest the water for the business.

Task:

(a) HelpyourneighborestimatehowmuchmoneyhewillreturntothePDMafterthe one and half years.

(b) Howmuchwillhespendonbuyingthedrinkers.

(c) Estimatethecapacityofeachdrinkerandadviseyourneighbor,withreasonsonthe capacity of the tank to buy.

1. BbulaisanislandfoundonlakeZzibi,therehasbeenaseriousproblemof poornetwork on the island for a long time.


The government together with the Network providers are planning to establish a Mast with the frequency
that can cover the whole island. According to Engineers, the island is in a shape of a triangle ABC with
𝐴𝐵= 10𝑘𝑚 as the main landing site. Side 𝐵𝐶= 8𝑘𝑚 and 𝐴𝐶= 6𝑘𝑚.
(a) Byscaledrawing,helpEngineerstocomeupwithanaccuratedrawingofthe island and use it to find;
(i) TheangleABC
(ii) GiventhattheMastmustbeestablishedwheretwoperpendicularbisectors meet, establish with
point M where the mast must be and find its perpendicular distance from the main landing
site.
(iii) Itisknownthatthefrequencymustcovertheisland,drawthelocusofthe frequency and measure
its radius.
(b) Two points P and Q are 1000m apart. The angles of elevation of the top of the
MastfrompointsPandQare60° and30° respectively.Calculatetheheightof the Mast if;
(i) ThepointsareonthesamesideoftheMast
(ii) ThepointsareonoppositesideoftheMast.

Page 100 of 103


2. (a) A senior four student, was given three points A(4,0), B(0,3) and C(4,3) of a
triangleABCandaskedtoenlargebybothascalefactor2andascalefactor -2onthe same axes with the center as
the origin, the learner could not distinguish between a positive and negative scale factor!Guide the
learner through and state the images;
(i) Of triangle𝐴𝐼𝐵𝐼𝐶𝐼,scalefactor2
(ii) Oftriangle𝐴2𝐵2𝐶2,scalefactor-2
Iftriangle𝐴𝐼𝐵𝐼𝐶𝐼isan imageoftriangle 𝐴2𝐵2𝐶2underenlargement,statethe center and scale factor of
enlargement.
(b) You aregiven two cylinders oneoflength12cmandvolume 630𝑐𝑚3,another with length 14cm and
volume 420𝑐𝑚3.
Statewithreasonswhetherthecylindersaregeometricallysimilar.
Whatwouldhavebeenthevolumeofthesmalleroneforthe cylinderstobe similar?
PartIII (PatternsandAlgebra)

3. InaPhysicspracticalattemptedbyaseniorfourclass, TheforceYneededtomovethe load X by a machine is


determined by a law 𝑌= 𝑎𝑋 + 𝑏, where a and b are constants. The table below shows results which were
obtained by one of the students.

Load(X) 1 2 3 4 5
Force(Y) 4 4.8 5.5 6.7 7.2

(a) Plotthescatterdiagramfromthetableabovei.e Force(y)againsttheLoad(x)


(b) Drawthelineofbestfitanduseittofind;
(i) TheForcecorrespondingtoaLoadof3.5
(ii) Theloadcorrespondingtoaforceof6.2
(iii) TheForcecorrespondingtotheloadof0(zero)
(c) Takeanytwopointsonthegraphandusethemtofindtheslope/gradientofthe line of best fit.
(d) Compareyourfindingswiththeequationoftheform𝑦 = 𝑚𝑥 +𝑐 ,hencefindthe law connecting Y and X,
where 𝑎=𝑚 and 𝑏=𝑐and state 𝑌=𝑎𝑋 + 𝑏.

4. Duringfootballtraining,thecoachmarkedthreepointsonthegroundformingatriangle OPQ, he labelled


displacement OP as vector p, and displacement OQ as vector q.
HefurthermarkedpointRonOQsuchthat𝑂𝑅:𝑅𝑄=3:1,andSonOPsuchthat
𝑂𝑆:𝑆𝑃=1:2.HestationedpointTasthepointofintersectionofPRand SQ.
(a) Usingtheknowledgeofvectors,expressPRandQSintermsofvectorspandq.
(b) Giventhat𝑷𝑻=𝝀𝑷𝑹and𝑸𝑻=𝜷𝑸𝑺,expressOTintermsof;
(i) 𝝀,𝒑and𝒒
(ii) 𝜷,𝒑and𝒒
Hencefindthevalueof𝝀and𝜷

DeterminetheratiosinwhichTdividesSQandPR.

Page 101 of 103


PartIV (DataandProbability)

5. A private company was hired to administer an interview for World Food Program.
50 candidates sat for an aptitude test which was made up of Sections A, B and C.
Two candidatesdidnotattemptanyquestion
fromanyofthethreesections.Threeattempted
questionsfromsectionAonly,fivefromsectionBonlyfourfromsectionAandConly
while5 attemptedquestions fromall the three sections. Thosewhoattempted questions
fromA and Bonlywere3 less than thosewho attemptedquestionsfromsections Band C
only and three timesthose who attempted questions from section C only.
Asaseniorfourstudent,help;
(a) Showtheaboveinformationusinganappropriatediagram
(b) Findhowmanycandidatesattemptedquestions
(i) fromeachsection
(ii) fromsectionConly.
(c) Ifacandidateisselectedatrandom,whatistheprobabilitythatheorsheattempted
questions from at least two sections?
(d) Giventhatthosewhoattemptedatmostonequestion,didnotmakeittooral
interviews, how many candidates were they?
(e) Inyouropinion,whydoyouthinktheWorldFoodProgramhiredaprivatecompany
to carry out interviews?

6. Thetablebelowshowsthecumulativefrequencyofmarksobtainedbyagroupofsenior four
students in a Mathematics test to be presented to the academic committee.
Onthedayofpresentation,theteacherinchargecouldnotmakeit.
Youareaskedtoanalyzethedatafurtherforthelayman‟sunderstandingwithvisualaid of a
graphical representation.

Marks 10-19 20-29 30-39 40-49 50-59 60-69 70-79 80-89


Cumulative 18 52 110 152 176 186 192 200
frequency(F)

Carryoutthefollowingforthecommittee
(a) Findthemeanandthemodal mark.
(b) The80th percentile.
(c) Drawacumulativefrequencycurveanduseittoestimate the;
(i) median
(ii) rangeofthemiddle50%ofthemarks
(iii) numberofstudentswhowouldpassifthepassmarkwasfixedat45.

Page 102 of 103


Page 103 of 103

You might also like