Geologic
Geologic
Pretest: Read the sentences or questions carefully. Choose the letter of the
correct answer.
4. This is a type of cell that lacks a true nucleus and membrane-bound organelles.
b. Copernicus
c. Charles Darwin
d. Gregor Mendel
iii
Unifying Themes in the Study
Lesson of Life
1
What I Need to Know
The study of life in general is very wide. And to help us understand this
vastness, are what we call themes. Themes are distinct characteristics, pattern, and
or quality. To help us understand better the study of life, we can look at themes
individually and as a collective. In this way, we can easily digest the commonalities of
those exhibiting life.
The unifying themes in the study of life are an organization, information, energy
and matter, interactions, and evolution. The study of organisms ranges from macro to
micro or vice versa. This means that the study of life can be from the planet earth as
a planet that can host life to the molecular level that comprises that life. The good
thing, however, is that these large chunks of concept can be broken into smaller ones.
Let us explore quickly these levels in the table below:
1
8. Communities These are the variety of species inhabiting a specific area.
An example would be a coastal community. In this
community, we would expect to see a variety of animal
and plant species that thrives in coastal areas. Thus, a
community is a combination of different populations.
9. Ecosystems These refer to the biotic and abiotic factors in an area. This
includes not only the interaction between living things but
also the interaction between living and nonliving.
10. Biosphere This consists of all the livable parts of the earth, by livable,
we are referring to all spaces which is inhabited by life.
This includes spaces in land, water, and air.
Source: https://www.simply.science/index.php/organization-of-life
2
What’s New
Activity 1: Designing an Experiment for Life
Procedure:
1. Propose a hypothesis
From common knowledge, you already have an idea as to what plants need
to grow healthy, like water and sunlight. Think of other factors or substances
that will affect plant growth (suggestions: type of soil, fertilizer type, music
or human voice). Choose a variable, then propose a hypothesis about how
the presence and absence of that factor affects the growth or survival of a
plant.
4. Draw conclusion
Did the presence of your experimental variable make a difference in the
growth of the experimental and control plants? Was the effect more or
less than you had proposed?
3
What Is It
In this activity you are made to design an experiment that will allow you to
observe the growth of a plant in relation to several variables of your choosing. In this
activity you were expected to determine the themes of biology in relation to the growing
plant. You are expected to have observed the organization, interaction, matter and
energy, information, and evolution. Organization is when from a seed, the mung bean
sprouted and grew to another definite structure with differing functions. Interaction is
when during its growth, the mung bean internally maintained homeostasis for optimal
growth while interacting with external factors. Growth is a complex and energy
consuming process, therefore, the growth of the mung bean had to be supplied with
energy coming from the nutrients in the soil and water, among others. Information and
evolution in this activity are indirectly observed by whatever the mung bean is
presently. This pertains to its physical features, functions, and molecular make-up.
What’s More
Complete the concept map below by adding the following terms: adaptation,
atom, cell, community, ecosystem, energy, development, growth, individual, molecule,
organ, organization, organ system, population, reproduction, response, tissue.
organisms
4
What I Need to Know
Recall in your grade 8, you learned about the two mechanisms in cell division,
mitosis and meiosis. Before each process happens and or is completed, the very first
thing that occurs is the replication of genetic materials. The replication or copying of
the DNA is to ensure that the daughter cells will receive the same complete set of
chromosomes with that of the parent cell. These DNA will then contain sections called
genes. This replication of the DNA prior to cell division will eventually be the template
for the trillions of cells that will make up an organism.
The structure of the DNA is responsible for its ability to store information. It is a
double helix of strands of building blocks called, nucleotides. The following
nucleotides are adenine, thymine, cytosine, and guanine – aptly abbreviated as A,
T, C, and G, respectively. The different sequence of these four nucleotides accounts
for the encoding of information in the DNA. Think of it this way, the way we arrange
the alphabet to form words is, in a way, like how these nucleotides are sequenced for
encoding information as shown in figure 2.
https://ghr.nlm.nih.gov/primer/basics/dna
5
The sequencing provides for a blueprint for most genes to make proteins. In
turn, these proteins accounts for different function in the body and in different
organism. Like for example, a single-celled gene may specifically create a protein that
will be able to breakdown a carbohydrate molecule, while a human gene may specify
a protein to act as an antibody to help fight off infections.
Evolution is said to be the scientific thought that would explain or make sense
of all the organisms now. Fossil records show that organisms have been evolving for
billions of years now, and that this accounts for the vast diversity and variation of
organisms in the past and present. Fossil records also show evidences of unity aside
from variation. There are animals presently that may seem different from one another,
let’s take for example the arm of a human being, wing of the bat, leg of a dog, and
flipper of a whale, they might have different uses but their underlying anatomy are
similar to one another. They considered homologous structures.
One notable evolutionary view emerged in the 1800s, when the father of
evolution, Charles Darwin, published the book, “The Origin of Species”. This book
contained Charles Darwin’s studies and observations, which expressed two main
points. One, that “contemporary species arose from a succession of ancestors that
differed from them”. This is what we call, descent with modification and accounts for
the dual nature of life’s unity and diversity. Second, that “natural selection is the
primary reason of descent with modification”.
Natural selection sprung from Darwin’s observations from his studies. It states
that species with inherited traits are more adaptive to the environment which means
they are more likely to survive and reproduce than those who are not. This is because
the environment constantly selects for the production of traits from the random variant
traits naturally occurring within a population.
6
https://geneticliteracyproject.org/2018/07/23/evolution-is-aimless-how-do-we-explain-external-testicles/
What’s New
In this activity, you will determine the degree of relatedness among some species
based on their amino acid sequences of cytochrome-c.
Objectives:
1. Compare the amino acid sequences of cytochrome-c of some organisms.
2. Calculate the degree of relatedness among some species based on the amino acid
sequences of cytochrome-c in their proteins.
Materials:
Procedure:
1. Refer to the following table of amino acid sequences of cytochrome-c. compare the
amino acid sequences of the following pairs of organisms by encircling the portions
of the sequences where they differ. For each pair, count the total number of differing
amino acids.
7
Amino Acid Sequences of cytochrome-c
Human GDVEKGKKIFIMMKCSQCHTVEKGGKHKTGPNLHGLFGRRTGQAPGYSYTAAN
KNKGIIWG
Chimpanz GDVEKGKKIFIMMKCSQCHTVEKGGKHKTGPNLHGLFGRRTGQAPGYSYTAAN
ee KNKGIIWG
Rhesus GDVEKGKKIFIMMKCSQCHTVEKGGKHKTGPNLHGLFGRRTGQAPGYSYTAAN
Monkey KNKGITWG
Horse GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANK
NKGITWK
Donkey GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANK
NKGITWK
Chicken GDIEKGKKIFVQKCQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNK
GITWG
Turkey GDIEKGKKIFVQKCQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNK
GITWG
Rattlesnak GDVEKGKKIFTMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGYSYTAANK
e NKGITWG
Fruit fly GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTNANK
AKGITWQ
2. Calculate the percentage difference between the species of each pair by dividing the
number of differing amino acids by the total number of amino acids in the sequences
of the pair.
Analysis Questions:
1. Which pair of organisms are most closely related? the least related? How do your
results compare with the taxonomic classification of the organisms?
8
2. How will you interpret those pairs of organisms having the exact amino acid sequence
of cytochrome-c?
Exploration:
Do you think that amino acid sequencing is a reliable basis for determining evolutionary
relationships among organism? Justify your answer.
What Is It
One of the recent evidences of evolution that reinforces the fossil records comes from
molecular biology. By using the technique called amino acid sequencing, researchers have
discovered that closely related organism have great similarity in their amino acid sequences,
indicating a common descendant, hence suggesting unity and diversity. In the activity, you
have determined the degree of relatedness among some species based on their amino acid
sequences of cytochrome-c.
A characteristic common to all forms of life is the need for energy. This is a
requirement for organisms to perform life processes. The various indicators of life and
processes like growing, reproducing, moving, and other intracellular processes require
that the organism spend energy.
9
The sun is the primary source of energy in the environment. All organisms rely
on the sun’s energy input to survive. It provides energy on earth in the form of light
and is received and utilized by the autotrophs or producers. These autotrophs or
producers are photosynthetic organisms. These organisms are able to harvest sunlight
to create their own food. The photosystems harvest light ang together with raw
materials like CO2, and water covert light energy into chemical energy. This process
is called photosynthesis. The chemical energy in the form of food molecules will then
be passed by plants and other photosynthetic organisms to other organisms that are
not able to produce their own food. Note that that there is already energy transfer
happening in this process. The organisms receiving the energy from producers are
called consumers, as shown in figure 4 below.
https://www.tutorialspoint.com/environmental_studies/environmental_studies_energy_flow_in_ecosystem.htm
10
https://www.tutorialspoint.com/environmental_studies/environmental_studies_energy_flow_in_ecosystem.htm
11
When we talk about the lower levels of hierarchy in biology, we are referring to
the interactions that make up the organism, this means, molecule level up to the organ
level. The interaction in the lower levels of hierarchy is important for operations of
certain regulations. Let us take for
example the regulation of waste
materials in the body, particularly
carbon dioxide. The body needs to
keep the levels of carbon dioxide in
the lungs low so that it can easily
diffuse from the blood to the lungs and
excreted via exhaling. This process
alone, allows for a lot of interaction in
between organs, cells, tissues, and
molecules. This ability to self-regulate
is made possible by a mechanism we
call, feedback.
https://byjus.com/biology/exchange-regulation-of-gases/
https://young7science16.weebly.com/interactions-and-ecosystems.html
12
What Have I Learned
The inside of your home is a dwelling place, not only for you and your family
but for a whole community of species. You can investigate their interactions if you…
Procedure:
1. Make a list of organisms that can be found living in your dwelling place.
Some may be invited, such as pets or houseplants. Other may be
uninvited, such as rodents, insects, or molds.
2. Make a table and record information about the food relationships among
members in this community. A sample table is provided for you below.
Invited Uninvited
Analysis of Results:
1. What do the animals eat? Do they rely on the human food supply, or do
they have their own sources of food?
2. Are there predators and prey in this community?
3. Describe how the community members compete for resources.
13
Reproduction of
Lesson Representative Animals
2
What This Lesson is About
We are products of billions of years’ worth of evolution, and we know this much
thanks to reproduction. Through reproduction, nature has selected organisms that
have a gene pool that is capable of surviving and thriving. Animals have both adapted
and evolved to better fit their environments thanks to variation.
While us, humans, have goals in life some animals were born to reproduce and die
immediately after. So now you ask, why is reproducing offspring so important to
animals? This is one of question that we will be answering into later, on this module.
In this lesson, we will understand key concepts about the complexities of reproduction
in animals and synthesize our learning at the end. Lastly, this lesson will also allow
you to appreciate the true importance of why a continuity of a species is important.
Source:https://pixabay.com/
14
What I Need to Know
According to the UN, there are about 360,000 babies born every day in the
world. Reproduction is one of the key survivals of a species – it is a way to continue
life. A male and a female organism will mate and produce an offspring. These parent
organisms will then pass on genetic information to their offspring, and in time, their
offspring will pass their own genetic information as well.
From our previous lesson of mitosis and meiosis, we know that cellular division
plays an important role in reproduction. The relationship between these two processes
are vital to animal reproduction. Some organisms like cows, sheep, dogs and will
require two parent organisms (sexual reproduction) in order to reproduce an offspring,
while others do not (asexual reproduction).
15
Sexual vs. Asexual
16
Figure 2.3 Binary Fission in Bacteria
17
https://courses.lumenlearning.com/boundless-biology/chapter/phylum-cnidaria/
https://www.britannica.com/animal/hymenopteran/Natural-history
18
Table 2.1 Advantages and Disadvantages in Sexual and Asexual Reproduction
Types Advantages Disadvantages
19
What I Have Learned
A B
reproduction.
reproduce.
itself to reproduce.
reproduce piglets.
into an offspring.
reproduce.
20
What I Need to Know
Organisms are diverse, unique and have equally unique features that help them
survive in their environment. These features tailor to the animal’s environment, size,
habitat, and so many more factors. One unique feature is the way these organisms
undergo fertilization.
Mechanisms of Fertilization
There are two types of fertilization – internal and external. Internal fertilization occurs
when the fusion of gametes is inside the female body, while an external fertilization is
the opposite where fusion of gametes is outside the female body.
21
2. Viviparity – most common in mammals, the
offspring develops within the female and is
nourished by the mother’s blood in the
placenta. Ex. Bears
Source: https://pixabay.com/
Figure 2.8 Brown Bear frolicking in the grass
Source: https://pixabay.com/
Figure 2.9 Great White Shark in the ocean
The table below will better summarize the key difference and similarities of the
two fertilization processes.
22
SUCCESS RATE - Since the offspring is - Has a less chance of
developed inside the survival because the
body of the female, it offspring develops
will have more without protection in
chances of surviving the open
even in harsh environment.
environments
because it is
protected.
KEY FEATURES - Has three types: - Survives best in
1. Oviparity moist/aquatic
2. Viviparity environments.
3. Ovoviviparity
- Has a greater
- few offspring are number of offspring
produced. produced.
EXAMPLES - Elephants, goats, - Fish and Frogs
and cats
23
What I Have Learned
In your own words, describe the type of fertilization given below and give and
example of an animal that has that type of fertilization.
Description Animal
Viviparity
Internal fertilization
External fertilization
Oviparity
Ovoviviparity
II. Essay
Why do you think there is a difference in the types of fertilization among animals?
___________________________________________________________________
___________________________________________________________________
___________________________________________________________________
___________________________________________________________________
24
What I Need to Know
What’s New
Pick a species and draw it in its natural habitat in the box below.
Now that you have drawn them here are some follow up questions:
25
What is It
The success of animal reproduction does not only end when an egg is fertilized.
It ends when the offspring can fully grow and eventually reproduce as well. As
mentioned before, reproduction is key to survival. We will all eventually die and we
need to make sure that our species continue through reproduction. Listed below are
the factors that affect reproductive success.
Factor # 2: Environment
To ensure a healthy offspring, the animal’s environment must also be nurturing
to the young. Temperature greatly affects the development and the urges of an animal
to mate. With the continuing rise of temperatures around the globe, some animals are
starting to dwindle in number and die before they even reproduce. When the water
becomes too warm, the fishes will have a hard time getting oxygen and can eventually
die when exposed to warm waters for longer periods of time. Glaciers and ice caps
are melting in the arctic, causing polar bears suffer health conditions due to
malnutrition.
26
What’s More
Check your knowledge against the understanding that you have gained in the
lesson regarding reproductive success. Answer the following questions briefly and
concisely.
Essay
1. Why do you think natural selection favors animals with the greatest
reproductive success?
________________________________________________________________
________________________________________________________________
________________________________________________________________
________________________________________________________________
2. What do you believe is the greatest threat to animals and why?
________________________________________________________________
________________________________________________________________
________________________________________________________________
________________________________________________________________
3. Why is it important for animals to never go extinct?
________________________________________________________________
________________________________________________________________
________________________________________________________________
________________________________________________________________
4. How can we better preserve and protect animals so that they may continue to
live on?
________________________________________________________________
________________________________________________________________
________________________________________________________________
________________________________________________________________
27
What I Need to Know
The stages of development of a human baby are complex and truly fascinating.
In this lesson our objective will be able to understand how a human embryo develops.
Before an egg cell can be fertilized by a sperm cell, both gametes need to be
mature and become spermatozoa and oocyte. For it to be mature, it first has to
undergo stages of development.
Stages of Development
Spermatogenesis Oogenesis
1. Spermatogonia Oogonia
2. Spermatocyte Oocyte
3. Spermatid
4. Spermatozoa
What’s In
28
What I Need to Know
29
What I Can Do
Knowledge is power! Let us put your synthesizing skills to the test through this
animal profiling activity.
Now that we’re done with general profiling, let’s compare and contrast this
animal’s reproduction with humans using the venn diagram below.
30
Essay
Let us see how well our knowledge truly understand these ideas through essay
writing.
______________________________________________________________
______________________________________________________________
______________________________________________________________
______________________________________________________________
5. What is the difference between oviparity and ovoviviparity?
______________________________________________________________
______________________________________________________________
______________________________________________________________
______________________________________________________________
31
Summary:
• Study of life anywhere on earth will always reveal unifying themes. These
themes allow for better understanding the so-called mystery called life.
Organization theme shows that emergent properties result from the
interplay of the lower levels of hierarchy. Reductionism allows for the
compartmentalization of larger and more complex systems to be easily
studied. In information theme, it is all about life’s processes revolving
around the expression and transmission of genetic information. And that this
genetic information is encoded in the nucleotide sequences of the DNA.
Energy and Matter as a theme is important as life processes requires
energy. The sun being the fundamental source of energy enters into the
ecosystem as light and exits it as heat. Producers are responsible for
converting light energy into chemical energy which is then passed into
consumers. Interaction theme is important to life for regulation, thus
enabling organisms to survive. Internal interactions are done through
feedback regulation. This is a process where either an accumulation or
decrease of an end product allows for the speed up or decrease for its
production. Evolution theme is the change among organisms that has
allowed for unity and diversity of life here on earth. Charles Darwin who
authored natural selection, saw it as a means of evolutionary mechanism
for adaption of organisms to their environment.
• To ensure species continuity, nature allows for both sexual and asexual
reproduction in the animal kingdom. Sexual reproduction requires the
union of female and male gametes to form a diploid zygote. Asexual
reproduction on the other hand can produce an offspring without the union
of gametes. Several mechanisms for asexual reproduction include
budding, fission, and fragmentation. There are also some variations
through reproduction can still occur. These are through hermaphroditism
and parthenogenesis, in which environmental and hormonal factors have
control in the reproductive cycles. Fertilization can either occur externally
when both materials are released outside the body, or internally when a
male fertilizes an egg in the female reproductive system. Unlike asexual
reproduction, sexual reproduction is a form of partnership between
organisms and at the same time, it promotes competition between
individuals and even between gametes.
32
Post Assessment:
Multiple Choice. Read the sentences or questions carefully. Choose the letter of
the correct answer.
4. What do you call animals that are at the top of the food chain?
a. Apex predators
b. Prey
c. Ants
d. Lion
33
True or False. Write the word true if the statement is correct and the word false
if it is not.
1. Both internal and external fertilization has the male gamete discharged unto
the female reproductive system. ________
2. Internal fertilization has more offspring produces compared to external
fertilization. ________
3. The 3rd stage of sperm development is called spermatozoa. ________
4. Humans are ovoviviparous. ________
5. Parthenogenesis is when an organism has both the male and female
gametes. ________
34