Scribd Logo
Upload

Welcome to Scribd!

  • 23 views

    Sample Qstns

    Uploaded by

    Shabeer Ali PC
    This document contains questions related to various topics in computer science, information technology, and biology. It covers topics such as computer generations, network protocols, topologies, OSI model, communication modes, network security, client-server architecture, network topology, malware types, CIA triad, database components, cloud deployment types, embedded systems, IoT, big data, industrial revolutions, relationships between AI/ML/deep learning, neural networks, protein domains, sequence alignment, dynamic programming, and more. The questions range from definitions to explanations to biological concepts.

    Copyright:

    © All Rights Reserved
    Download as DOCX, PDF, TXT or read online from Scribd

    Sample Qstns

    Uploaded by

    Shabeer Ali PC
    23 views4 pages
    This document contains questions related to various topics in computer science, information technology, and biology. It covers topics such as computer generations, network protocols, topologies, OSI model, communication modes, network security, client-server architecture, network topology, malware types, CIA triad, database components, cloud deployment types, embedded systems, IoT, big data, industrial revolutions, relationships between AI/ML/deep learning, neural networks, protein domains, sequence alignment, dynamic programming, and more. The questions range from definitions to explanations to biological concepts.

    Original Title

    SampleQstns (1)

    Copyright

    © © All Rights Reserved

    Available Formats

    DOCX, PDF, TXT or read online from Scribd

    Did you find this document useful?

    Is this content inappropriate?

    This document contains questions related to various topics in computer science, information technology, and biology. It covers topics such as computer generations, network protocols, topologies, OSI model, communication modes, network security, client-server architecture, network topology, malware types, CIA triad, database components, cloud deployment types, embedded systems, IoT, big data, industrial revolutions, relationships between AI/ML/deep learning, neural networks, protein domains, sequence alignment, dynamic programming, and more. The questions range from definitions to explanations to biological concepts.

    Copyright:

    © All Rights Reserved
    Download as DOCX, PDF, TXT or read online from Scribd
    Download as docx, pdf, or txt
    23 views4 pages

    Sample Qstns

    Uploaded by

    Shabeer Ali PC
    This document contains questions related to various topics in computer science, information technology, and biology. It covers topics such as computer generations, network protocols, topologies, OSI model, communication modes, network security, client-server architecture, network topology, malware types, CIA triad, database components, cloud deployment types, embedded systems, IoT, big data, industrial revolutions, relationships between AI/ML/deep learning, neural networks, protein domains, sequence alignment, dynamic programming, and more. The questions range from definitions to explanations to biological concepts.

    Copyright:

    © All Rights Reserved
    Download as DOCX, PDF, TXT or read online from Scribd
    Download as docx, pdf, or txt
    of 4

    PART 1

    1. Explain various generations of computers with advantages and disadvantages of each


    generation.
    2. Compare TCP Vs UDP
    3. Explain various network topologies
    4. Explain various layers of the OSI Reference model
    5. Explain Simplex, Half duplex and Full duplex modes of communication network.
    6. What is network security? Explain the methods to achieve network security.
    7. Explain Client-Server architecture and its types.
    8. What is Network Topology? Explain various network topologies
    9. Compare Virus, Worm, Trojan
    10. Explain C-I-A Triad
    11. Explain various components of DBMS
    12. Explain various Cloud computing deployment types.
    13. Explain the various types of Client-Server architecture
    14. What is ELN? Write a note on how ELN helps in research activities.
    15. Explain various graphical representations of data.
    16. DNS, IP, NAT, Firewall, OS
    17. Explain various cloud service models

    PART 2
    1. Facts and figures about Internet
    2. What is the packet switching method in a communication network?
    3. How it differs from circuit switching.
    4. Compare Internet with WWW
    5. Explain the different versions of the Web (1.0, 2.0, 3.0)
    6. Draw the block diagram of information retrieval by search engines
    7. Explain web crawling and indexing
    8. Problem: Given a document, create an inverted index
    9. The page rank algorithm of Google and problem
    10. Google search commands
    11. What is Search Engine Optimization. What steps can you take to get your website to
    improve its web pagerank.
    12. Name popular search engines other than Google
    13. Name an AI-powered search engine and explain what it achieves.
    14. What are embedded systems. What are the types of embedded systems.
    15. Define IoT and its applications and implementation in Industrie 4.0
    16. When can a dataset be classified as Big data.
    17. 1 Petabyte = ? MB and similar conversions
    18. Explain the 5 Vs of Big data
    19. What are the defining characteristics of the industrial revolutions 1.0 to 4.0
    20. Draw the Venn Diagram depicting the relationship between AI, ML and Deep learning
    21. Biological concept underlying artificial neural networks ANN.
    22. Algorithm for a typical ANN
    23. What is the objective of the deep learning model ElemNet ?
    24. How is AI re-inventing Computing hardware and software
    PART 3

    1. Which one among the following is the start codon?


    CUG
    AUG
    AUU
    UAG
    2. BLOSUM62 is
    amino acid substitution matrix
    nucleic acid base matrix
    nucleic acid substitution matrix
    both a and c
    3. Which of the following is not true about multiple sequence alignment?
    can be used to derive phylogenic relationships
    can be used for amino acid pattern identification
    can be used structure determination
    can be used for genome scale comparisons
    4. Which of the following is not true about local alignment algorithm?
    In trace back step, the path terminates when a 0 is encountered
    First row and first column of matrix is set to 0 in initialization step
    Score in a cell can be positive negative or 0
    Gaps normally have a negative score
    5. Which among the following is a protein domain database?
    EMBL
    TrEMBL
    Interpro
    Swissprot
    6. Which of the following algorithms is/are based on dynamic programing?
    Needleman & Wunch
    Smith-Watermann
    Both a & b
    None of the above
    7. Which among the following is a domain observed in transcription factors?
    Tim Barrel
    Rossman-Fold
    Zinc Finger
    EF Hand
    8. Ramachandran Plot for proteins represents
    Allowed torsion angles of amino acids in a peptide chain
    Positions of secondary structures in a cartesian plane
    Both a and b
    None of the above
    9. What is a protein domain database? Give an example
    10. Differentiate between global and local alignments, what is their importance in context
    of biological information?
    11. What is PAM250 matrix?
    12. Introduction of a gap in a sequence alignment has more penalty than introduction of a
    mismatch. Explain the biological reason for this consideration.
    Above mentioned are only sample questions

    13. Use dynamic programing principles to find an optimal global alignment between the
    following sequences (Please show the matrix building and trace back methods)
    ACGATTCA
    ACGCACA
    14. Following is the Neutral zinc metallopeptidases, zinc-binding region signature
    (PATTERN).
    [GSTALIVN]-{PCHR}-{KND}-H-E-[LIVMFYW]-{DEHRKP}-H-{EKPC}-
    [LIVMFYWGSPQ]
    a) Identify the region in the following sequence and write down the sequence for the
    signature from the sequence
    MYYMPFFYDPYFWMIILGVAISGWASMNVNSTFNRYDQIQNHGNYTGKVAVRYILD
    QAGLYEVEIREVAG
    NLTDNYNPTNKVLSLSQSVYNSSSIAAVGVAAHEVGHALQDASDYAPMRLRSALVP
    IVSLGSNLSMPLIL
    LGLVLGMNQTLIKIGIWCFALVLVFQVVTLPVEFNASHRALRMLNNGAILDPQEMPI
    ARKVLFAAALTYV
    AAVLTSMLQLFRLILIFGRHNDDNN
    b) Which residues are invariable in this region for maintaining biological function?
    c) What does amino acids with the “{ }” signify

    You might also like