Gazetteer
Gazetteer
AnOverviewofOnnwal ............................................................................................................................2 . FaithsofOnnwal .......................................................................................................................................5 . FactionsofOnnwal....................................................................................................................................9 AGazetteerofOnnwal............................................................................................................................12 Gilderond............................................................................................................................................12 TheStormCoast..................................................................................................................................17 TheAzureCoast..................................................................................................................................23 TheEasternMarchlands.....................................................................................................................28 TheHeadlands....................................................................................................................................31 PersonagesofOnnwal.............................................................................................................................34 AdventuringWithinOnnwal....................................................................................................................43 Credits: Design:CreightonBroadhurst,StuartKerriganandPaulLooby OriginalDesign:DesBarrie,CreightonBroadhurst,JimBrown,SimonButler,GerardCummins, AndrewHewson,StuartKerrigan,JohnLeeper,MaxKraftandofcoursePaulLooby. Editing:StuartKerrigan Artwork:WizardsoftheCoastandUDONStudios BasedontheIrongateProjectbyDenisTetrault,ErikMonaandGaryHolian
An Overview of Onnwal
Proper Name: Free State of Onnwal (Free Onnwalons, member of the Iron League) or Obedient State of Onnwal (Scarlet Brotherhood) Government: Hereditary feudal monarchy (currentlycontested) Ruler: Contested: (Free State) His Noble Authority,JianDestron,SzekoftheFreeState of Onnwal, Duke of Gilderond, Warden of the GearnatandAzureSeas/(ScarletBrotherhood) ExaltedSisterKuranyie,ShepherdandKeshkal ofOnnwal Capital: (Free State) Killdeer/(Scarlet Brotherhood)Scant Major Towns: Scant (pop 4,500), Killdeer (pop 3,000), Longbridge (pop 2,500), Sornhill (pop2,000) Provinces:Onecitydistrict(Scant,heldbythe Scarlet Brotherhood), four feudal duchies comprisedoftwentyfourcantreds(lairdships and mayoral villages, nearly all held by the FreeState) Resources: Platinum, silver, gems (III, includes pearls), salt, fish, foodstuffs and agriculturalproduce Coinage:Seaeagle(pp),gull(gp),wader(ep), goose(sp),duck(cp) Population:85,500Human79%(Os),Dwarf 9% (hill), Gnome 5%, Halfling 3%, Elf 2% Other2% Languages:Common,AncientSuloise(Scarlet Brotherhood only), Dwarven, Gnome, Old Oeridian,Flan(Headlandersonly) Alignments:LN*,LG,N,CG,CN(Scantcitizens, FreeState);LE*,NE(ScarletBrotherhood) Religions: Major: Osprem, Zilchus, Procan, Norebo, Xerbo, Jascar, Fortubo (Free State); Bralm,Llerg,Pyremius,Syrul,WeeJas(Scarlet Brotherhood); Minor: Beory, Heironeous, Mayaheine, Pholtus, Trithereon, Fharlanghn (FreeState);Beltar,Nerull,Tharizdun(Scarlet Brotherhood) Allies: [of Free State] Free City of Irongate, Kingdom of Sunndi, Kingdom of Nyrond, Duchy of Urnst, Domain of Greyhawk; [of Scarlet Brotherhood rulers] Scarlet Brotherhood, Lordship of the Isles, Orcish EmpireofthePomarj. Enemies:[ofFreeState]ScarletBrotherhood, Lordship of the Isles, Orcish Empire of the Pomarj,UnitedKingdomofAhlissa;[ofScarlet Brotherhood rulers] dwarves and gnomes of theHeadlands,FreeCityofIrongate,Kingdom ofSunndi,KingdomofNyrond,DuchyofUrnst, County of Urnst, Domain of Greyhawk,United KingdomofAhlissa.
History
The Dragonshead has been home to dwur, nonizandFlanhumanssinceancienttimes.In antiquity,theFlandefeatedthekuotoaofthe Dragonshead and held the lowlands of the Headlands. In some places strange and convolutedruinscanbefoundonandnearthe coasts of Onnwal. The hills were the province of evil humanoids warring with dwur and noniz. MysticsofthefledglingFlankingdomwere led into the Headlands by dreams of knowledge and power. There they found the CirelIornadhtheDreamingGyrethatheld,at its centre, the Guronn Nur, otherwise known astheHideousIdol.Whilethegreatestofthem examined this strange idol that sent many of thenumbermad,theWyrmscameuponthem. The two groups forged a pact: the Wyrms would teach the Flannae the secrets of the Guronn Nur, and in exchange the Flannae would wage war upon the Dwur and Noniz. Returning to their kingdom they used the GuronnNurtoextendtheircontroloverallthe tribesofFlannae. The demihumans were victorious but quickly discovered that the humanoids had been pawns used by the Wyrms of the Headlands.TheDwurandNonizimmediately launched attack after attack upon the wyrms. Themysticshad,throughtheiruseoftheidol, forged the Obsidian Kingdom of Caerdiralor and fought for the wyrms. Eventually the WyrmswereslainandCaerdiralorwasthrown down.TheGuronnNurwasshatteredintofive fragments, each of which was lost in the subsequentchaosofwarasthesurvivingFlan fought forsupremacy. With thefinaldefeatof all their enemies the demihumans of the Headlandsretreatedtotheirclanholdstolive inpeace. BythetimeoftheGreatMigrationstheFlan weredividedintomanywarringtribesand,it was this disunity that was a major cause of theirdefeatbytheSuel.Howeversomeofthe lowlander tribes were united by Garantheuld, the Warrior King, in the face of the threats of the invading Suel forces and the hostile, barbarousFlanclansoftheHeadlands. About a thousand years ago, the Onnwi, Suel migrants fleeing the Rain of Colourless Fire and the turmoil of the Great Migrations thatfollowed,arrivedbyshipfromthePomarj. A cruel people they made war on the Flan, enslaving them or driving them into the
Headlands. They named their new kingdom OnnwalthelandoftheOnnwi. TheOnnwiwereconqueredintheirturnby the might of the Oeridian Kingdom of Aerdy. Azharadian, the legendary Aerdi general, crushedthelastremnantsofSuelresistancein 598 OR. Onnwal became a fief of the nascent Great Kingdom, administered by a szek appointed by the Hertzog of the South Province. Oeridian settlers poured into the Dragonshead, eager to exploit the lands agricultural and mineral resources. Scant was foundedin12CY. As the Great Kingdom began to stagnate and decline during the Age of Great Sorrow, Onnwals native nobility, the descendants of the war captains of Azharadian, resented the corruption and decadence of the Zelradton Szeks.WhenIvidNaelaxIemergedvictorious fromtheTurmoilBetweentheCrownsin446 CY,thisresentmentboiledoverintorebellion. The nobles deposed the then Szek, Prince TrevellynofHexpoolsandplacedthePlatinum Diadem of Onnwal on the head of Parmus Destron, one of their own. Szek Parmus first actwastodeclareOnnwalaFreeState. In447CY,theFreeStateofOnnwalbecame one of the founder members of the Iron League. For the next century and a half, its fleets and armies did battle against those of theSouthProvince,mostnotablyintheWarof theGoldenLeague(579581CY).Againduring the Greyhawk Wars, Onnwals armies fought ontheplainsofIdee,whileherfleetdidbattle inRelmorBay. ItwastheScarletBrotherhoodwhoproved tobetheFreeStatesundoing.Onthenightof Goodmonth 10, 584 CY (known now as the Night of Scarlet Knives), Szek Elwerd Destron and many other nobles and military officers were assassinated by agents of the Scarlet Sign. The following day, Scant was betrayed into the hands of a Scarlet Brotherhood invasion fleet. Undone by treachery and assassination, Onnwals resistance swiftly collapsed. Jian Destron, the murdered szeks son, only barely escaped to Nyrond with his life. For two years, the Brotherhood ruled Onnwal, attempting to remake the county in theimageoftheirtwistedideals.Thosenotof Suel descent were enslaved and nonSuel faithsandpracticeswerebrutallysuppressed. Only the Brewfest Rebellion of 586 CY put an end to this tyranny. The leader of the resistance in Onnwal, Rakehell Chert, took
An Overview of Onnwal
advantage of the chaos caused by the mysterious assassination of several of the Brotherhoods senior Herdsmen in Onnwal, hesparkedofftheuprisinginKilldeer.Within two months, the Brotherhoods forces where drivenbacktoScantandthewesternvergesof the Dragonshead. Szek Jian returned to his homelandsoonthereafter,butthewartofree Onnwal completely has ground on interminablyeversince.
RulersandLaw
TheruleroftheFreeStateisSzekJianDestron. In more peaceful times, the szek ruled as Onnwalsfeudaloverlord,withpowerstolevy taxesandresponsibilitiestomaintaintherule of law and defend the Free State. Now Jian strives to free his homeland while holding together the factions that comprise Free Onnwal. The four Provinces of Onnwal are each ruled by a duke. The ducal titles are held by theheadsoftheGreatHousesnoblefamilies whotracetheirdecentfromtheWarCaptains of Azharadian, the legendary Aerdi general who conquered Onnwal. Each Province is in turnsubdividedintoCantredstwentyfourin total ruled either by barons or, increasingly in recent times, by mayors appointed by the dukes.ManyofOnnwalsnobilitywereslainby Scarlet Brotherhood assassins on the Night of Scarlet Knives. Moreperished in theconfused fightingthatfollowed,withtwominorhouses wipedoutinthepurge. Since the Brewfest Rebellion of 586 CY, some nobles have returned to their fiefs. Others remain exiles and local military commanders or Wrecker Bosses hold sway. The Wreckers are members of the city of Scantsthievesguildturnedguerrillafighters; they directly administer many areas of the FreeState.Thethoughtofbrigandsrulingin their stead has disgusted and outraged many nobles. The Army of Rebellion is comprised of the remnantsofOnnwalsarmyRegulars,peasant levies, noble retinues and the Wreckers. The ArmyisunderthecommandofRakehellChert, leader of the Wreckers and Lord Marshall of Onnwal. The Regulars a standing force of professional soldiers form the core of the Army. The regulars are divided into four Braetads, each commanded by a Braetern oneofOnnwalsfieldgenerals.Thebulkofthe Armyismadeupofmilitiasdraftedfromthe peasantry.Poorlyarmedandtrained,theyare
mainly used in defensive roles. However, the escalation of the war and the depletionofthe regulars have seen the militias increasingly being called upon to fill the gaps left in the ranksoftheArmy. Szek Jian retains personal command of Onnwalsonce proudNavy andthe renowned Free State Marines. As most of the Onnwalon fleet remains in the hands of the Scarlet Brotherhood, the Free State Navy numbers only thirteen vessels. The fleet is organized into three Squadrons, one patrolling Dunhead Bay from Killdeer, one defending the port of Sornhill and the tenuous supply route to Nessermouth in Nyrond and one based at the southern port of Longbridge. Two admirals, knownasSeaEagles,commandtheFreeState Navy: Lord Degan Corlennd in Killdeer and LordCarthenRelasterinSornhill. The Free State Marines are based in Killdeer,wheretheyarebusyrebuildingtheir decimated ranks. Marine units serve on all Navy vessels as well as garrisoning Onnwals ports and are under the command of CommandantLynhernDeshend.Knownasthe Leathersides, the Marines are among the most feared troops in Onnwals service, deservedly so, given their training and nigh fanaticalcourage. TwoothereliteunitssupplementtheArmy of Rebellion the Hillstalkers, an elite unit of scouts and rangers, renowned for their skill
An Overview of Onnwal
withthelongbowandtheOrderoftheGolden Sun, commonly called the Glaives of Azharadian,Onnwalsonlyorderofchivalry.
CommerceandTrade
Onnwals merchants, though both daring and wealthy, wielded little power before the Occupation. Competition between the rival merchant houses was fierce. Such was the fractious nature of Onnwalon merchants that the popular phrase to squabble like a Scant trader was coined to describe a noisy and boisterous dispute. Many smaller firms were either wiped out or bankrupted by the Occupation. Only those firms with substantial resources abroad, such as the politically powerful Merchant House of Carbani, survived. Trade with Nyrond and Irongate has resumedmainlyfoodstuffsaswellasthreeof Onnwalsfourtraditionalstaples:pearls,silver and salt. Production of the fourth, platinum still awaits, having been disrupted by the sabotage of the mines. Irongate remains a staunch, if distant ally. Though happy to provide economic support, Cobb Darg has been most reluctant to commit Irongates forces to the war. Sunndi has been similarly reticent.
Faiths of Onnwal
MajorFaithsofFreeOnnwal
Osprem:Ospremisseenasaprotectivefigure andinsomeareasofOnnwalisbelievedtobe the wife of Procan, soothing his rage and calmingtheseas. Within Scant Many of the clergy there are still in league with the Brotherhood. The not inconsiderable number that resisted have been imprisonedinObelstoneKeep.Rumours ofterriblepunishmentsabound. Elsewhere, many priests escaped to Nyrond and declared a Church in Exile under the leadership of Marya Jernal. The Church in Exile has vociferously denounced the collaborators. Loyal priests serve with the navyofFreeOnnwalandelsewhere.However many are reluctant to trust the church again. The memory of the Brotherhoods cruelties is toofresh. Zilchus: As a trading nation Zilchus is a popular deity in Onnwal, overseeing affairs of money, business, and prestige and influence. Priests of Zilchus regularly oversaw that fair trading was observed in markets throughout Onnwal. Many were wealthy merchants in their own right and acted as diplomats. The High Tradepriest of Zilchus was an influential advisortotheSzeks. The Brotherhood saw their wealth systematically stripped before they were levelled. Some, especially in the east, fled to Irongate or the Headlands. A number act as diplomatsinIrongateandabroad,pleadingthe rebel case. Others seek to reestablish vitally needed trading links. New makeshift temples have been erected and the clergy have begun theoneroustaskofreconstruction. Procan:Asagodwhoseimmensewrathtakes the form of storms and tempests Procan is believedtobethehusbandofOspremwhilein the Eastern Marchlands however Procan is seenastheprimarygodofthesea. The Brotherhood hunted Procans clergy, levelling his temples. Many priests, especially in Sornhill and Killdeer, managed to escape, fleeing mostly to Nessermouth and Irongate, though a few priests including the StormseekersremainedintheStormIslesand the cliffs of the Storm Coast. The Cathedral at Killdeer is being rebuilt as are the temples at SornhillandLongbridge.TheChurchofProcan has enjoyed a surge in popularity since folk turnfromtheChurchofOsprem,seentohave colludedwiththeBrotherhood. Sornhill is the home to a small cult called the Stormseekers who believe Procan is manifestintheheartoftempests.Theyseekto be closer to him by holding ceremonies on shipsinthemiddleofstorms. Norebo: Norebo is said to smiles upon those who throw themselves headlong at life, with no mind of the odds or the consequences. In Scant,atempleofmiddlingsizewassetinthe poorer end of Gate Hill on the Street of Dice wherethegamblinghousestendedtocluster. ManyofNorebosfaithfulespeciallythose of Oeridian descent joined resistance cells where they are valued members and morale boostersasasourceofclericalmagic.Mostof the priesthood remained in Scant and welcomed the Brotherhood. Several collaborating priests of Norebo have been capturedandcarriedoffforexecution,though some few have been lynched publically by angrymobs. Jascar: The Suel god of Hills and Mountains wasadoptedbytheOeridiansettlers.Hisfaith was always a rural one especially about the feet of the Headlands. The priesthood mainly concerns itself with caring for the Headlands and the folk that dwell there so the main templeofthechurchisatNotilinthenorthern Headlands. Jascar is also revered and respected by many of the Noniz and Dwur of thehills. WhenthelowlandsfelltotheBrotherhood, most of the clergy retreated with into the Headlands. Refugees and Onnwalish soldiers wereledtosafetyinthehillsbythefollowers of Jascar and they are invaluable to the guerrillafightersinthehills,especiallyagainst the Brotherhoods Hochebi troops who they especially loath for wandering the Headlands, which had been free of hostile humanoids. JascarsremainspopularinFreeOnnwaland many rebels treat priests of the faith with respect. Fortubo:ThisfaithwasbroughttoOnnwalby the Dwur millennia ago and spread to the humansofthelowlands.Chieflyreveredinthe DwurcitadelsofSarakastandVergannininthe HeadlandsmanymaintainthatFortuboguided theirsirestothehills.AmonghumansFortubo isrootedinminingintheHeadlands.Offerings weremadeatshrineswhichoftenstoodatthe centreofminingvillages. Fortubo has a passionate hatred of the Scarlet Brotherhood, which is shared by this faithful.ThelastresistanceinScantwasatthe
templeofFortuboinGateHillwheretherewas a valiant stand for three days against the invaders.Theyhavenotbeenforgottenamong thepeopleofScantnortheFaithfulofFortubo. Elsewhere, the priesthood reluctantly withdrew to the safety of the Headlands, where they aided the guerrillas. They seek supportamongtheDwurcitadels.
Faiths of Onnwal
in their rulings and severe in their punishments. Trithereon: Before the Occupation, the Summoners faith in Onnwal comprised a small but vigorous sect. The Church first rose to popularity in the days of the rebellion againsttheGreatKingdom SincetheOccupation,thepopularityofthe ChurchoftheAvengerhassoaredeverywhere in Onnwal, though its base remains the Eastern Marchlands. The Trithereonites harried the occupiers relentlessly, organising bandsofguerrillasintheHeadlands.Thisand their willingness to unselfishly sacrifice themselves for the cause won the Church manynewconverts. Mayaheine: The Church of the Defender has been imported from Irongate by returning rebels.Herfollowingissmallbutgrowsbythe day, eroding the flocks of many established faiths, especially the Suel faiths, winning a strong following among the common folk, especially in the wartorn south and west of thecountry.TheChurchisofcoursehatedby theBrotherhoodandfollowersoftheDefender canexpectnomercyiftheyarecaptured. Heironeous: This faith was brought to OnnwalwiththeAerdiconquerorAzharadian. Hiscaptains,devoutfollowersoftheInvincible One, were the ancestors of the current noble houses.TheChurchofHeironeousistherefore closely linked with the nobility, though the commonfolkturnedinsteadtomorepractical faiths. The core of the Church is the quasi religiousOrderoftheGoldenSun(seebelow). PriestsofHeironeousoftenjoinedtheOrderas Glaives Cohort, ranking less than full Glaives whowereexclusivelyofnobleblood. Joramy:ThefaithoftheMaidenofDisputesis anewarrivalinOnnwal.Theyhavebeenwell received by some among the population, resentful after the years of oppression at the handsoftheBrotherhood.Undertheinfluence ofthepriestsofJoramyanumberofsuspected collaborators have been burned alive, despite theeffortsoftheauthorities. The Church of Joramy has a feud with the Church of Pyremius and priests on each side will attack each other on sight. The Joramites are also making enemies on the rebel side. Their use of valuable timber stocks has angeredrebelcommanders.
MinorFaithsofFreeOnnwal
Oeridian Agricultural Gods: Telchur, Atroa, Sotillon, Wenta and Velnius are collectively revered as agricultural gods in Onnwal especially in the agricultural heartlands of Gilderond, The Eastern Marchlands and the AzureCoast.Theirpriestsarepopularwiththe common folk, from whom they are often drawn. The Church suffered terribly during the Occupation, like the other Oeridian faiths. Shrineswerelevelledandpriestswerehunted. The clergy often took great risks to try and protect their flock and many paid with their lives for their devotion. However the church has no formal hierarchy, thus its structure survived theOccupation betterthan others. It has emerged from the dark times almost as strong as ever, with common folk stepping forwardtofillthegapsleftbythefallen. Pholtus: This faith was brought to Onnwal withtheforcesofAerdy.TheclergyofPholtus actedasJudgesoftheSessions,presidingover the law courts of the land. The Prime of Onnwal has traditionally been the high priest of Pholtus but the Church never had a widespreadfollowingamongthecommonfolk except in the Eastern Marchlands. Among the ruling classes however, the church was well respectedandpatronised. The Church of Pholtus was brutally suppressed Brotherhood, despite staunch resistance. The clergy was ruthlessly hunted down.Thefewpriestswhosurvivedhavebeen slowlytryingtorebuildtheirshatteredchurch inthelandsheldbyFreeOnnwal. A number of missionaries have arrived from the Theocracy of the Pale to aid their efforts.Thishassofarhadamoderatedegree of success, particularly in the Eastern Marchlands.ThoughanewPrimehasyettobe appointed,someofthemorezealousPholtans have taken on themselves to administer law and order to Free Onnwal. Unsurprisingly, these selfproclaimed judges tend to be harsh
Delleb: In Onnwal Dellebs was the only scholastic faith. The church never had much influenceoutsideofScantwherepriestskepta fine library and school in the High Quarter of Scant. Educating mainly the children of the nobilityandthewealthymerchantsofthecity, some of the more kindhearted clergy taught the children of some of the poorer families in Scant. Priests of Delleb also served as scribes forthegovernment. The temple, library and school were ransackedbytheBrotherhoodafterthefallof Scant.Thosebooksdeemedtocontainimpure knowledge were burned along with the priests. Dellebs faith is believed to be extinct inOnnwalnow. Beory: Beorys faith is restricted to certain Flan hill tribes dwelling in the Headlands. TheretheclergyofBeoryisexclusivelyfemale and the priestesses hold a great deal of power within the tribes being not only the religiousheadsofthetribe,butalsovariously the lorekeepers, midwives and arbiters of succession to the chieftainship. Chieftains are wedded to the Oerth and are considered to be husbands of the Oerth Mother. This, as much as their personal power, legitimises theirrule. Phaulkon: Though there was no formal church of Phaulkon before the occupation, many archers of the marines bear tattoos or talismanofPhaulkon. Daern: The Oeridian demigoddess of fortificationshadasmallbutdevoutfollowing in Scant where the security of the city and countryoftendependedonthestoutnessofits fortifications. Furthermore the symbol of Daern is set into many of the keystones and cornerstonesofthewallsandbastions.Itisnot known whether any of this faith or their precious plans and lore (which would be an enormousboontotherebels)survive.
Faiths of Onnwal
followers of Kurell were overthrown and many killed. If any survive they have kept a verylowprofile.
MajorFaithsoftheScarlet Brotherhood
Bralm: The Church of Bralm has aided in managing and mobilising the populace in building and other labour and in the indoctrination of those enslaved by the Brotherhood. They are called upon by the Brotherhood to bless and augment various sorts of labour including mining, construction and farming. Priests of Bralm are hated for their presence on the Brotherhoods slave mines and vast slave farms in the Onnwalish countrysidebeforetheBrewfestRebellion. Llerg: Many of the common Suel soldiery of thebrotherhoodsarmiesareknowntohavea reverenceforLlergasdomanyofthesouthern Suel savages brought to Onnwal to fight with the Brotherhood. The Church of Llerg has chiefly aided the Brotherhoods armies, lending guidance, morale and healing where needed. Pyremius: The Church of Pyremius is greatly feared and hated by the Rebels and the populacealikefortheirdepravityandcruelty. The Clergy of Pyremius is rumoured to instruct the Brotherhoods soldiery and is known to aid their navy in the use of fire against rebel ships. They are also believed to be the moral support behind the Brotherhoodsmanyassassins. Syrul: The Church of Syrul is believed to aid Brotherhoodintheircoverteffortsagainstthe Rebels. They are feared for their ability to infiltrate Rebel ranks and because of all the Brotherhood faiths it is the most mysterious andleastknown. WeeJas: The Church of WeeJas as well as aidingintheenforcementoflawandorder,is known to have considerable interest in the activities under taken by the Brotherhood in the now infamous and dreaded Obelstone Keep.
Olidamarra:Thisgodhasasmallfollowingin theWreckersfocusedmainlyaroundRakehell Chert. The Laughing Rogue is also known amongthe common people, though there was no marked devotion to him in Onnwal before theOccupation. Kurell: Kurell has afollowing among some of themoresinisterelementsoftheWreckersas well as among many pirates. Worshipers of Kurell were historically powerful in the Wreckers. Twenty years ago, Rakehell Chert staged a coup within the Guild, and the
MinorFaithsoftheScarlet Brotherhood
Lydia:Theprimaryaimofthispriesthoodwas the indoctrination of subcitizens with the ideals of the Brotherhood. However, while theyoperatedtheyalsoprovidedastandardof
education unheard of outside the noble and wealthyclassesinpreoccupationOnnwal.All of these schools in Free Onnwal have been closed, with the priestesses either being captured and imprisoned by the Rebels or managingtofleetoScant.InScanttheChurch stillrunstheformerDellebianacademy. Kord: Kord is widely worshipped by the savage troops brought by the Brotherhood from Hepmonaland and the Amedio Jungle as wellasbysomeofthecivilisedtroopsfromthe Tilva lands. His priests provide healing, and moralsupportforthesoldiers.
Faiths of Onnwal
Tharizdun: The rebellion believes that the Brotherhood keeps temples to the Dark One secret from the general populace. Many suspect the large numbers of slaves disappearing into the bowels of Obelstone means it is a site of a temple devoted to the worshipoftheGreatDestroyer. Truth be told however there are members oftheBlackBrotherhood,asecretsectwithin theorganizationdevotedtoTharizdun,within Onnwal. They pretend to be working for the ScarletSignbutaredowntotheDragonshead fortheirownsinisterends.
Factions of Onnwal
NotableFactionsofOnnwal
TheScarletBrotherhood
The Scarlet Brotherhood has thrown off its guise of an insular monastic order and emerged as the ruling body of an empire of unknownextentstretchingfromOnnwaltothe sweltering jungles of Hepmonaland, from the Lordship of the Isles to the Hold of the Sea Princes. According to the dwur sage Morrev Ironseeker (formerly of Scant, but now of Irongate), the Brotherhoods goal is nothing lessthatthedominationoftheFlanaessunder the rule of a Second Suel Imperium. They are prepared to use any means necessary to achievethisend. Once Onnwal had fallen into the Brotherhoods hands, governance of the so calledObedientStatewasplacedinthehands of Exalted Sister Kuranyie, Keshkal and Shepherd of Onnwal. She replaced the traditional system of government with a network of kesh administrators responsible for the running of a village or town. Now however, most settlements of any size apart fromScantareunderthecontroloftherebels. Thefateofthefewkeshwhosurvivedthefall oftheirterritoriesisunknown. The Brotherhoods administration appears to be divided into a number of bureaucratic divisions, known as Offices, each controlling some aspect of governance. The Office of Diplomacy deals with espionage, infiltration andassassination,whereastheOfficeofArms dealswiththemilitaryonlandandsea.Dayto daygovernanceisinthehandsoftheOfficeof Sovereigntyandreligionisinthehandsofthe Office of Faith. Education, indoctrination and breeding are the provinces of the Office of Purity. The Office of Thralls handles management of slaves, while magic and the creationofmagicalabominationsisunderthe controloftheOfficeofSorcery. The Brotherhood controls the ports of Scant, Obelton and Gullhaven, as well as the strategic towns of Halmarn, Myrhill and Tarlesan. Their navy and summoned seas monstersretainastrangleholdovertheStraits of Gearnat, extracting exorbitant tariffs from any ship wishing to make the passage of the narrows unmolested. Though a number of states have expressed their outrage at this practice, none have made any attempt to challengetheblockade.
SlaversandSlavelords
In the early years of the current century, the coasts of Onnwal were terrorised by slavers who would carry off entire villages. They showed few scruples and less mercy towards their victims, carrying off man, woman and child to suffer often short and brutal lives of bondage. TheFreeStatemadegreateffortstoputan end to this scourge but to no avail. The slavers seemed almost prescient in their ability to avoid the ships of the Free State Navy. This was no accident, for they had friends in very high places. Kosrel Relaster, Duke of the Storm Coast and grandfather of the current duchess, was in league with the slavers. In return for a cut of the profits, the dukeconspiredtodeliverhisownpeopleinto bondage. Kosrel would warn them of naval movements and of vulnerable targets. In return the Great House of Relaster grew rich onslavegold. InthepresentdaytheScarletBrotherhood arecourtingtheresurgentSlavelordstocome toOnnwalalongwiththeorcsofTurroshMak. Yellow Sailed ships have been spotted by rebels in the harbour of Scant and now MarkessatheWhite(LEfemaleelfSor10)plan harvestthefieldsofOnnwalforacropoflive cargo. The slavers have bases in the Storm, Hezarin and Saernadd Isles. They and other Pomarji factions may be take a more active interestinOnnwalinthefuture.
TheWreckers
Before the Occupation, the Wreckers were predominantly made up of smugglers, privateers, hijackers, wrecklooters and confidence men who preyed upon rich merchants and their cargo, rarely bothering thecommonfolkofOnnwal.Wellorganizedby their leader Rakehell Chert, they were a constant thorn in the side of the authorities. BasedinScant,theyoperatedmainlyalongthe coastsofthecountry.Theyhadoperationsand safe houses in all settlements of note in the country as well as contacts in Idee, the South ProvinceandNyrond. Rakehell Chert caught wind of the BrotherhoodsinfiltrationofScantdaysbefore the fall of the city and spirited the bulkof his thieves out into the countryside where he organized them into a series of independent cells.AfterthefallofOnnwal,theybecamethe only true organized resistance to the
Brotherhood and were instrumental in the Brewfest Rebellion. Even today they maintain a prominent place in the resistance. Many of its members are dubious about working so closely and sharing so many of their secrets with their old enemies namely the soldiers and sailors of Onnwal. Equally, the actions of members who have turned themselves into robberbaronsinallbutnamehastarnished thereputationoftheorganizationasawhole.
Factions of Onnwal
to the Jade Mask, the truth of the matter is obscure.
OrderoftheGoldenSun
TheOrderoftheGoldenSun,commonlycalled the Glaives of Azharadian, is Onnwals only order of chivalry. Devoted to the memory of the Aerdi general Azharadian and his patron Heironeous, it is comprised a core of knights, all of noble blood, supported by a body of commoners and priests of the Invincible One called the Glaives Cohort. Many members of the Order were slain during the Night of Scarlet Knives after being lured back to their chapter house in Scant, where they were ambushed by Brotherhood forces. The surviving Glaives are divided by mistrust, certain that one among their number is a traitor. They have been polarised into two camps: the more senior Glaives supporting Duke Gellen Cadwale, the most senior surviving Glaive, while the younger Glaives and the Cohort rallying about Baron Halrend Lorendrenn, who suspects Cadwale of being thetraitor.
TheJadeMask
The Jade Mask is the name for the Onnwalon Chapter of the Iron Leagues diplomatic (i.e. espionage) corps of the same name. Most Onnwalons are unaware of its existence and that is the way that the Mask likes it. Having been decimated by the Scarlet Brotherhood during the Night of Scarlet Knives, the survivorshadtoslowlyrebuildtheirshattered network over the next two years, with aid from allies in Irongate. In 586 CY, they are believed to have played key roles in the Brewfest Rebellion and have since worked quietly in the background, playing the Brotherhoodattheirowngameofsubterfuge, espionage and assassination. Brotherhood infiltratorsinflictedaheavyandbloodytollon the Mask in the past therefore potential recruits are very carefully vetted before admission and kept under constant observation during their probation. The mage Celendrenn is thought to lead this shadowy organizationthough,likemostthingsrelating
TheFellowshipoftheCoin
Thisisagroupofpriests,fighters,rangersand eventherarepaladindevotedtotheserviceof Zilchus. The Fellowship has sworn oaths to protect merchants and travellers upon Onnwal's roads from bandits and other parasites threatening the flow of commerce and trade. Before the wars, they were sought
10
afterashonestandefficientcaravanguards.In addition to guarding trade they also on occasion hunted down bandits in the Headlands, bringing them either to justice or toanearlygrave. Grand Acquirer Jerrul Bardens (LN male human Ftr3/Clr5) and many others in the band find working with the thieves and brigands they once pursued distasteful and there is no love lost between Jerrul and Rakehell Chert. The Fellowship plays its part in the struggle, refusing to recognise Chert's authority, but rigidly following the Code of LawsandJianDestron.
Factions of Onnwal
TheBlackHoods
The Black Hoods are a small organized crime group based in Longbridge led by the Galthrena merchant family. Involved in drug smuggling, slaver, murder and extortion outwardly this family projects an image of simple(althoughwealthy)merchants. The Black Hoods are dedicated to the worship of Kurell and its senior members wereonceleadersoftheWreckers.Thusthey have a personal score to settle against Chert andarecurrentlybidingtheirtime.Aswellas recruitingdisaffectedWreckerstheyarebeing quietlysupportedbytheScarletBrotherhoods OfficeofDiplomacy.
TheHillstalkers
The Hillstalkers are an elite cadre of the Free StateArmydevotedtoscouting,patrollingthe Headlands and wherever else the Free State hasneedtosendthem.Alwaysfewinnumber, theirrankshavebeenfurtherdepletedbythe Occupation and the Rebellion. Nonetheless therearenomoretrustedandvaliantservants oftheSzekandtheFreeStatealive.Theyexist independently of the normal chain of command reporting to the Lord Marshal and the Szek, Jian Destron. Skilled woodsmen all, the Hillstalkers are famed for their skill with the longbow and they disdain, as they see it, lessertypesofbow.Mostaredrawnfromthe Cantreds around the feet of the Headlands. Hillstalkersareequippedforspeedandstealth andneverworkinmorethanunitsofthree.
AssemblyoftheGreenandGold
This is a secret and semiofficial organisation of exclusively of wealthy and influential priests, nobles, merchants and artisans. The aim of the Assembly is members to attain powerandwealthandasameanstolookout for the personal, commercial and political interests of its members. The Assembly is a crossbetweenanoldboysclubandapolitical lobby for the wealthy. It has been very successful at guiding Onnwals policy in the pastandmaintainingthestatusquo. The Assembly is laden with ritual and ceremonies and entry is by invitation only, followed by a period where the prospective member must prove himself to the Assembly throughhisactionsbeforebeinginitiatedinto the group. Thereafter there is a strict hierarchyofrankwithtestsandceremoniesat eachlevel.Someoftheseritualshaverootsin the faith of Zilchus; others are (farcical) inventionsofpastAssemblymembers. The Assembly has put its support behind the Rebels. Many members find working with formerthievesandsmugglersdistasteful.Most realise that the current situation demands such compromises, but hope that things will swiftly return to normal if and when the Brotherhood are defeated. They have also expressedconcernattheriseinthepopularity of the Church of Trithereon among the peasantry. Their message of rebellion against authority fine directed against the Brotherhood,butafterthewar,theyfearitwill beredirectedagainstthenobility.
TheStormseekers
The Stormseekers are a bizarre sect of the church of Procan. Their central belief is that Procan manifests himself in the heart of the tempests that ravage the Gearnat and Azure Seas. Therefore in order to have communion withtheirgod,theysailshipsstraightintothe heart of these storms. Unsurprisingly, the Stormseekers are few in number and old membersarerare. Nonetheless, some have noted that some Stormseekers seem to have more than their share of luck in surviving such communions, even if often times, their vessels do not. The Stormseekers were based in Sornhill prior to theOccupationandnowsomehavestartedto return,whileotherwhofledtotheStormIsles still wage a campaign against Brotherhood shippingthere.
11
A Gazetteer of Onnwal
Overview
Onnwal occupies the entirety of the Dragonshead Peninsula, which separates the Sea of Gearnat and Dunhead Bay from the AzureSea.ThePeninsulaisdividedbetweena rugged and tortuous maze of limestone hills called the Headlands and rich, wellwatered lowlands.Wavesofsettlersandinvaders,from the dwur and noniz in the depths of the past, to the Aerdi have called Onnwal their home over time. Its long coastlines have meant Onnwal has traditionally been a maritime nation. The forests were felled to build ships and the fields yielded bounties of grain and otherfruitsofthesoil. Onnwal was once a vassal of the Great Kingdom and its independence was forged in the Iron Rebellion of 447 CY. Though Onnwal existed under threat of invasion from the South Province, for over a century war never touchedher.Beneaththeaegisofhernavyand her allies in the Iron League, both noble and peasant lived out the limit of their days in peace. In 584 CY the Scarlet Brotherhood shattered this idyll forever. Onnwal has since known only oppression, rebellion and strife. The land is divided into two camps: the resurgent Free State and the Scarlet Brotherhood.ThoughtheGreyhawkWarshas been consigned to history elsewhere in the Flanaess,inOnnwalitneverended. The Scarlet Brotherhood holdsthe eastern Cantreds of Halmarn, Low Bergard and Gullhaven. The invading forces have fortified the approaches to Scant. In response, the Onnwalon Army of Rebellion has occupied strong points on the eastern plains of the Gilderlea. Between the two forces lies burned outvillages,emptygrainfieldsgonewildwith neglect, all smothered in eerie, desolate stillness. Between the valleys of the Fallnos and Bergard,restachainoflowdells.Hereandon thesteepslopesoftheHeadlands,clingthelast remnants of Onnwals primordial forests. Sheep and goat herding predominate, supplying fleece for weavers looms in the coastaltowns.
Scarlet Lands
Brotherhood
Controlled
TheFourProvinces
The Free State was traditionally divided into four provinces: Gilderond in the west, the Azure Coast in the South, the Storm Coast in the north and the Eastern Marchlands on the shores of Dunhead Bay. The majority of this territory is once more under the rule of the SzekofOnnwal,JianDestron.
Gilderond
The largest province of Onnwal, Gilderond encompassestheplainsandrivervalleysofthe GilderleainthewestandtheSilvervaleinthe east. The Gilderlea is generally flat, rolling country dotted with farming villages. The broad valley of the Bergard river forms Onnwals agricultural heartland. Most of Onnwals grain, maize, wheat and barley is grownhere.Gilderondershaveareputationof being almost obsessively hard workers, but their love of good ale tends to give lie to the claimthattheyarehumorlessfolk.
Scant:Inhappiertimes,thecityportofScant wasOnnwalscapital.Oneofthebestdefended citiesintheFlanaess,itissituateduponapair of steep hills (Gate Hill and Palace Hill) surrounded on three sides by sea cliffs, connectedtothemainlandonlybyaflatstrip of land, known locally as the Langneck. The city and the Langneck enclose a large and shelteredbaycalledtheGreatHarbor.Alineof treacherous reefs breached by two channels bar the mouth of the Harbor and seaward approaches to Scant. It is navigable only with theaidofanexperiencedguide. The city feels cramped, the only open spacesbeingtheGrandandHighMarkets.The palelimestonebuildingsseemchaoticallyatop each other, with narrow streets twisting between them. The szeks palace, an opulent construction from the noontide of the Great Kingdom,dominatesthecityscape. ScantisspreadacrosstwosteephillsGate HillandPalaceHill,theseawardsidesofwhich arefringedwithprecipitouscliffsrangingfrom fifty to two hundred feet in height. These are almost unnecessarily topped by a thirtyfoot curtain wall. The tallest cliffs are those of the Palace Hill, which overlook the reef fanged channels and bristle with artillery engines poised to rain fiery ruin on any vessel foolish enoughtoattempttoforceapassagethoughto the Great Harbour. Alas treachery undid thesedefensestoowhentheBrotherhoodtook thecity. Between the two hills nestles a gap in the encircling cliffs and a small, sheltered inlet from the Great Harbour that forms Scant's
12
InnerHarbour.Twosturdyfortificationsflank the mouth of the Harbour Daern's Redoubt upon the eastern side and the Bastion of the Golden Sun opposite it. Thus the combination of natural features and cunning fortification makethecitynighunassailablebylandorsea byconventionalmeans. Scant is a comparatively small city of no more than five thousand people before the Wars.Itisdividedintothreemaindistricts: GateHill:OverlookingtheLangneck,GateHill houses most of the city's artisans. Before the Wars, Scant's Noniz and Dwur communities were centred here. The scruffy north end of the district is home to Scant's poorer inhabitants. TheHarbourQuarter:Thisdistrictdescribes the natural amphitheatre of land that nestles around the Inner Harbour at the feet of the two hills. It was the centre of commerce and trade, with the Grand Market, the temples of XerboandZilchusandtheCustom'sHouseall beinglocatedhere. Palace Hill or the High Quarter: Separated from the rest of Scant by an internal curtain
A Gazetteer of Onnwal
wallandloomingovertheInnerHarbouratop high cliffs, the High Quarter houses the city's more affluent inhabitants.The hill is crowned byamagnificentpalacedatingfromthegolden ageoftheGreatKingdom,whichservedasthe seatofOnnwal'sszeksandgivesthedistrictits name. In the middle years of the current century as the population of Scant grew, pressure for space increased, particularly in Gate Hill and theHarbourQuarter.Thusthecityasawhole hasaverycrampedfeelaboutit.Thereislittle in the way of open space, bar the Grand and High Markets. The pale limestone buildings seem to be piled chaotically atop each other, with narrow streets twisting between them, windingtheirwayupthehills. Construction was forbidden by decree on the Langneck for defensive reasons. Therefore the town of Halmarn, which faces ScantacrosstheGreatHarbour,profitedfrom the overflow from the city. Many rich merchantsornobilitymaintainedvillaseither in Halmarn or atop the steep cliffs that fringe the Great Harbour to the south, taking full advantage of the breathtaking views over the
13
harbour and the city. It was customary for those that could to flee to these villas, to escapetheheatandstenchoftheteemingcity in summer. So much so that during these months, more of the business of governance went on in Halmarn than in Scant, prompting onelocalwagtodubthesmalltown"Onnwal's othercapital". Sister Kuranyie rules what remains of her domaininOnnwalfromtheSzek'spalace.She is determined not to lose control of the city and maintains strong garrisons in both Scant and Halmarn, and a substantial military presenceinthesurroundinglandholdingthe landward approaches to the city. The city is resupplied by sea by Brotherhood vessels. Scant is the main base for the Brotherhood's navalpresenceoftheStraitsofGearnatandis thus well protected from seaward attack or blockade. The condition of Scant's populace is appalling. More than threequarters of the populationarebelievedtohavebeenclassified as slaves, with the remainder enjoying the dubious privilege of being subcitizens. Marnafel Toktot, Kesh of Scant, enforces the Brotherhood's rule in the city with brutal efficiency. Rumours of atrocities and the barbaric behaviour of the occupiers abound. With the current stalemate between Free Onnwal and the Brotherhood, there is little hopethatthesufferingofScant'spopulacewill endanytimesoon. Halmarn: This suburb of Scant stands across the Great Harbour from Scant and has a population of 1,000. Before the Occupation, Scant's welloff would keep villas in Halmarn to escape the heat and stench of the crowded streets of the capital in High Summer. Sitting astridethemouthoftheBergardandbordered totheeastbyanarrowcoastalplain,thetown was known for its leafy avenues and its mercantile arcades and fine waterfront townhouses, with their splendid views over thewatertothehillsofScant. Those pleasant days are long departed. Halmarn is now a busy garrison town for the forcesoftheScarletBrotherhood.Reservesfor theforcesopposingtheFreeStateleaguerare billeted here as well as a substantial garrison ofhochebiandeliteTilvaSuelsoldiery.Recent reports indicate that a stone curtain wall re enforcedbythehighspiredtowersbelovedof the Brotherhood now encircles the town built, of course, by slave labour. It is certain thatHalmarnwillhavetobetakenbeforeany
A Gazetteer of Onnwal
meaningfulassaultonScantcanbeattempted, controllingasitdoesthelandwardapproaches totheLangneckandGateHill,aprospectthat pleasesfewamongtheleadershipoftheArmy ofRebellion. Of particular note in Halmarn is 68 GreenleafAvenue.Thoughttobethehometoa merchant known as Franzier this modest home in fact once belonged to the archmage Bigby. Wardings prevent entry even to the Kesh of Scant, Maranefel Toktot, who is obsessedwithgainingentry. The Tal Marith: Under Scant lies a huge network or natural caverns, passages and chambers that intersect with the city sewers, seacavesandotherdeeperandoldercaverns. It dates back to the time of the Kingdom of Caerdiralor, the first human nation on the peninsula, and its war with the dwur of the Headlands. During the final throes of the conflict the Dwur pursued the last scions of Caerdiralor andcameuponagreatdefensivebastion,The Tal Marith. The Tal Marith was the site of a temple dedicated to He Who Must Forever Sleep. The Dwur tiring of the conflict called upontheirpowerfulhighpriestofMoradinto casttheentireedificeintooblivion.Thewaters of the Gearnat rushed in sealing the doom of the inhabitants of the temple and ending the FlannaeDwur conflict and the Dwur and remainingNonizretreatedtotheircitadels. CenturieslaterOnnwifromtheNoxtiaBay explored the Tal Marith and when the Oeridians established Scant in 12 CY they unwittinglychosealmosttheexactspotofthe oldsiteofTalMarith.Preliminaryexploration of the tortured maze of passages and chambers that they discovered, aided by the accounts of earlier Onnwi explorers. The uppergallerieswerequiteextensivelycleared but when the construction of the sewers was completed the passages were once again re sealed to prevent any remaining denizens of the caverns entering the sewers and endangeringtheinhabitantsofScant. When the Iron League was founded the sewers of Scant were neglected. Although a small amount of upkeep was undertaken a rock fall in one of the oldest portions of the sewernetworknearthemainharbouropened up one of the longsealed tunnels. The mounting list of those lost below Scant promptedSzekElwerdtoturntoBigbyforaid. He investigated the caverns and what lurked withinthemandsuggestedtoElwerdthatthe
14
tunnels should be sealed and their entrances warded to prevent anything entering the city frombelow.ElwerdagreedandBigbyandhis apprentices haunted the sewers sealing all knownmeansofegresstothetunnelsbelow. Many of those with knowledge of the Tal Marith fell during the invasion and all the Szeks official papers fell into the hands of Brotherhood agents. Kesh Maranefel Toktot resides in the very tower that Bigby once inhabited and something in the tower has made him interested in exploring the Tal Marith to further his personal power and prestige. The Brotherhood had also dispatched agents and adventurers to investigate Tal Marith for two decades although it is unknown what these advance scoutingpartiesdiscovered.Perhapsitismore than a coincidence that the Brotherhood invadedthearea. TheTalMarithwasacitadelthatcontained a temple dedicated to He Who Must Forever Sleep but this is not the only secret of Tal Marith. Amongst the massive labyrinthine corridors of the Tal Marith are numerous fire and shadowrelated creatures such as effigies and Creatures known as the Eirius Ionadh exist on the midlevels of the Tal Marith. They appear as octopi, seemingly composed of blood red fire and shadow. What is unnatural is the way they absorb the light around themselvesandyetburnwithanunholyfireat the same time. Their shape is akin to an octopus, but one that is a mass of fiery blood red doom. They attack by long thin tendrils thatconstantlywrithe,dissipateandreform. ThisisbecausetheTalMarithwasfounded toholdanartifactabletomanifestthepowers of fire and is the sites primary reason for its abilitytowithstandtheancientDwurassaults. Myrhill: With a population of 500 this town sits atop an isolated outcropping of the western Volanots, commanding the approaches to the Gates of the Gildenlea as wellastheintersectionoftheCliffwayrunning south and east to Longbridge and the BushelwayrunningeasttoBergardbridge.The Scarlet Brotherhood has made the village the forward bastion of its defensive lines around Scant. Despite frequent raids by the Army of Rebellion, the Brotherhood have thrown up ditches,palisadesandasmallstonekeepwith slave labour in the years since the Brewfest Rebellion.BandsofhochebiandHepmonaland Suelfanoutintothesurroundingcountryside, interceptingFreeStateraidsandpillagingthe
A Gazetteer of Onnwal
fertile farmlands beyond the Army of Rebellionleaguerlines.Thenativepopulation hasbeenpressedintoworkgangsorisusedas humanshieldsbytheBrotherhoodsoldiery. TheGatesoftheGildenlea:Thisisthename given to the narrow valley cut by the river Bergard through the limestone ridges of the western Volanots. The valley carries the main highway out of Scant, linking it to the rest of Onnwal. The Brotherhood is constructing a highspired keep halfway along the gorge to holditagainsttheFreeStateshouldMyrhillbe taken.
FreeLands
Arbend: With a population of 780 this is the Cantred seat of Middle Bergard, and nestles amid the golden grain fields of the Gildenlea. Themarketvillageisprotectedonthreesides by a broad loop of the river Bergard. Three AltadsoftheGilderondBraetadoftheArmyof Rebellion ("The Golden Heart"), bolstered by Wrecker cells and the local peasant Militia garrisonArbend.Fromhere,warriorsdisperse to man the watch on the Brotherhood positions around Scant. The village has been transformed into anarmed camp.A ditch and palisadenowencirclesthesettlementandthe banner of Farland Marshevel, Braetern of Gilderond flies proudly from the newly constructed watchtowers. Marshevel is a cautious commander, welltrusted by the lord marshal and the szek, not to squander his strengthonfutileraidsagainstScant. Bergardbridge: A small market town with a population of 950, Bergardbridge straddles the fast flowing upperreaches of the Bergard river.ThehighwaybetweenScantandKilldeer crosses the river here by an ancient Aerdi builtstonearch,whiletheHindRoadrunseast towardstheHeadlandsandtheSilvervale. As well as a strategic crossroads and market town for the eastern Gildenlea, Bergardbridge is remarkable for the fact that over half its population are hobniz. The eastern portion of the town is built on a low loamy ridge, which is riddled with traditional halfling dwellings. Most of Onnwal's hobniz dwellinHighBergard. Thehobnizweretreatedhorrificallyinthe daysoftheOccupationandtheordealhasleft its mark upon the hobniz of Bergardbridge. Theyaremoreserious,dourandpronetofits of rage than others of their kin. They contribute a force of archers to the town
15
militia, who drill upon the eastern slopes of thetowneveryday. Bergardbridge and the Cantred of High Bergard is administered by Celdrin Yarrowstone (CN male human Com3/Exp3), one of the few appointed mayors to survive the purges of the Occupation. In recent times, Yarrowstone has become a focus for calls for the nobility to be held accountable for their failings in the Fall of Onnwal and for more representation of the common man in the affairsofstateandthecourseofthewar.Heis infact a Scarlet Brotherhood operative who intendstofermentinsurrectionanddivisionin thefactuousrebellion. Garveld:Allbutabandoned,thecapitalofthe Cantred of Deyshond was one of the holdings ofHouseDestron.Basedinthebountifulplains andvalesthiswasJianDestronslandassonof Szek Elwerd and thus Duke of Deyshond. The population and local provost were all but murdered by the Brotherhood and the Ducal Lodgewasburnedtotheground. ThePlatinumDiademandtheSzeksblade Adoreawerebothlostthoughrumoursduring the occupation placed them within the lodge. Jian Destron wears a replica of the diadem upon his troubled brow. He would pay well if either item were to be returned to him, as wouldotherstogainleverageoverhim. Grovehill:SoldiersfromGrovehill,population 400,helpmaintainpatrolsonthestretchofthe Hind Road between Bergardbridge and the Silvervale. The House of Farness has special duties to preserve the Szeks woodlands many of which are located within Low Headland. The father of the current baron apparent, Sir Tiren Farness (LE male human Ftr6+), a Glaive Virtuous of the Knights of Azharadian was assassinated in the first Brotherhood attacksonthecountry.BaronTirenFarnessis oneofthesurvivingGlaivesofAzharadianand a supporter of Duke Gellan Cadwalle's faction withintheOrder. Tiren has an enormous intellect and is a noted scholar and military historian. He has writen extensively on the Strictures of Azharadian. He is a cunning strategist and is the traitor who betrayed the Order of the GoldenSuntotheBrotherhood. The Pillar of Azharadian: Fashioned of hard grey basalt and bearing the hallmark of dwur craftmanship, this 100 feet high monument stands atop the bare summit of a wooded hill
A Gazetteer of Onnwal
intheLowHeadland,commandingastunning view over the plains of the Gildenlea. It commemorates the Aerdi conqueror Azharadian, whom legend says died there six hundred years ago. The pedestal is carved withscenesofthegeneral'slifeandthenames ofhismostfamousvictories. The pillar is sacred to the Order of the Golden Sun and in times of peace knightly pavilions were held around the pillar. Within the hill beneath the pillar is a network of natural caves. Squires and knights seeking advancement within the Order explore the caves as part of their trials yet no two can agreeonthelayoutofthecaves.Itisbelieved itshouldbepossibletotraversethecavesand enter the pillar to retrieve Azharadian's war axe Bardinar that is interred within the heart ofthepillar. Silvervale: Farther east, the Cantred of Silvervale lies cradled in a broad valley between the hills of the southern Headlands. TheSilvervaleisblessedwithbothfertilesoils andsilverandgemminesonthefringesofthe hills. In the north of the vale stands the small Wardwood,hometotheWardborn,agroupof pure blood Flan who have lived here for as long as memory stands. They are the soul inhabitants of its haunted glades and swear fealty to the baron, whom they admire and respect. Eastwards lies the Eaganrast and Aeganlirr mines where captured prisoners of warareputtowork. The town of Silvervale stands resolutely, while some of its buildings have been burnt and cast down or have fallen into ruin many stand resolute against the march of time and men. The temples of Zilchus, Pholtus and the Oeridian agricultural gods are long since cleansed and restored to piety and while the baronscastlewaslevelledhenowholdscourt in the converted tavern Hergadas Rest which is said to rest stop the barrow of an Oeridian shieldmaiden. The baron of the Silvervale is Halshas Geldrenn. A first cousin of Jian Destron, he is nextinlinetothePlatinumDiademofOnnwal. Geldrenn is a firm ruler and a strong believer in the restoration of the old order in Onnwal. WhilehelovesJianheisgravelyconcernedat the prominence his cousin has given to the Wreckers, and has doubts whether the young szek has the willpower or the ability to stand up to Chert and assert his authority. He fears Onnwalwillbecomealawlessbanditstateand
16
feelsthatitneedsstrongleadershipifthisisto beprevented.IfJiancannotprovidethis,then he can advise his cousin. His idea of strong leadership would be considered by many despotic tyranny and given he is Jians successorthisdaycouldcome. The Baron is charismatic and skilled of arms so is well loved by the populace of Silvervale. He is courted by the Shining Paragon of Killdeer who may find him a staunch ally. His young nephew Aerivalye Geldrenn (LN male human Ftr3) administers the town and cantred while Halshas travels withJianDestronorattendscourtinKilldeer. While Aerivalye appears young and inexperiencedhedoesacompetentjob.
A Gazetteer of Onnwal
Noone knows why he left it all to become a hermit, however since then he has lived an asceticlifeinacomplexofcliffcaves,whountil recently were his only companions. He has constructedashrinetoPhaulkonwithhisown hands in a cleft overlooking the tempestuous waters of the Gearnat Sea. Here he worships his master and is said to commune with the Parliament of Birds, which gathers there reputedly delivering the wisdom of Phaulkon intheirchaoticchorusofcriesandsong. WhentheBrotherhoodheardofTarnedas's existence, they resolved immediately to remove him and his perversion of one of the pure faiths. Before the Brewfest Rebellion three Brotherhood agents were dispatched in succession but none returned. All three have become disciples of the hermit and sit at his feetlearningthewisdomofPhaulkon.Eachof hiswouldbeassassinshastakenoneaspectof hismessagetoheart. The Path of the Talon founded by Jekasto (LN male human Mnk8), formerly a monk of the Scarlet Sign, emphasises perfection and purificationofthebodyandmind.Followersof this path specialise in both unarmed and armed combat and spend their time attaining physical perfection inthe cause of the Hermit oftheGulls. ThePathoftheWingaimsatexcellencein theartsofarcheryandisledbyKavrhos(male human Rog4/Rng3/Order of the Bow Initiate 3), previously a rogue in the service of the Brotherhood. Among its number are marksmencapableofextraordinaryfeats. The Path of the Song are devoted to listening to the teachings of Phaulkon and Tarnedas though meditation, contemplation andlisteningtothevoiceofthemasterinthe callsofthebirdsoftheStormCoast.Theyare closest in creed and outlook to Tarnedas and are led by Kantara (NG female Rog5/Ex Asn2/FavouredSoul4Phaulkon)whoinher previous life was an assassin of the Brotherhood. As his master is a deity dedicated to destroying powerful evil magical artifacts Tarnedas receives visions from his master impending danger to the Dragonshead involving the Hideous Idol. He therefore knows much about the legacy of Caerdiralor the Obsidian Kingdom and the Guonn Nuar. However the way the knowledge is sporadicallytransmittedbytheFarReacherto Tarnedas means attempts to convey this information is unintelligible his message is
TheStormCoast
Onnwals northernmost province, the Storm Coast, takes its name from the tempests that roll in from the Sea of Gearnat to batter its rockyshoresandcliffs.Aloosechainofcraggy ridges and low stony plateau called the Volanots stretch along the coast westwards fromthetownofSornhillasfarastheportof Gullhaven on the Azure Coast. In the east, the Norland Peninsula forms a flat and marshy bowloflandfringedbylowhills. Many of the Storm Coasts populace is concentratedinvillagessetinshelteredcoves. Fishing is the main occupation, with fleets of smallboatsventuringoutmainlyinwinterand summer, when the tempests that bedevil the Gearnat are less frequent. Inland, goats and sheepherdingonthecragsoftheVolanotsand viticulture on the southern slopes of the hills arethemainactivities. Suel blood predominates more among the inhabitants of the Storm Coast than in other partsofOnnwal.SomeoldSueltraditionsand customs, forgotten elsewhere, linger on here. The people of the Storm Coast are known as hardyandcapablesailors,wiseinsealoreand well used to riding out a squall or gale. The provincealsoproducesmorethanitsshareof sorcerers.Itisnosurprisethatmanyofthese are adept at manipulating the weather and elements.
ScarletBrotherhoodControlled Lands
TheCavesoftheProphet:Somewherealong the cliffs of the Storm Coast dwells a remarkable man Tarnedas (NG male human exact classes unknown) Hermit of the Gulls. Twentyyearsago,hewasamerchantinScant.
17
obfuscated and couched in riddle and hyperbolae.Heknowsonethingforafactit is not his destiny to live to confront the evil, only to gather strong arms with his message. He also recognises that Jekasto, Kavhros and Kantara despite their genuine repentance are still deeply flawed individuals and their assertions that each is on the correct path may lead to bloody conflict once his time on theOerthisover.Theyarenottheonestoface thegreatevil,butmayyethavepartstoplay.
A Gazetteer of Onnwal
ObelstoneKeepandexperimentedonbythe OfficeofSorcery. Obelton was once a thriving town but is now nothing more than a deportment centre forthosebeingshippedtoObelstone.Muchof the town is in ruins and the majority of the populationhaveeitherbeenenslavedorkilled. Tarlesan: The holdings of Tarlesan once belonged to the Baryaerns, an old Suloise familyraisedtothenobilitythroughmarriage withtheRelasters.Theywereknownfortheir magery and for their longstanding feud with HouseMaldrenn. Withthedeathofthepreviousbaroninthe Occupation, his daughter Lady Velyae (NG femaleWiz5),aspellworkerofsomeprowess, attemptstoretakethefortifiedcoastaltownof Tarlesan, near to which can be found some strange convoluted ruins that are only uncovered at particularly low tides. Kesh Param Lokan (LE male human Mnk6) holds Tarlesaninhisgripwiththeaidofhochebiand savageforces. TheStormIsles:ThesubtropicalStormIsles, many of which are still uncharted lie off the coastofStormwal.Farmers,usingtheverdant soil to grow citrus fruits, sugar cane and to rear pigs and sheep on have settled some. Pirates who, if rumours are to be believed, operatefromahiddencitysomewherewithin thechaincontrolotherislands. The Brotherhood still maintains an iron grip on the islands closest to the mainland thanks primarily to the fanatical efforts of KeshJohranTeven(LEmalehumanMnk7). Tessaks Cove: Brotherhood forces are arrayed in a great arc around Tessak's Cove, protecting their most easterlyfortified position in the duchy. Patrols from Tessaks Cove range throughout southern Gearnwal preying on those attempting to join the siege of Scant. Kesh Palis Sharn (LE male human Mnk9) directs the defence of Tessak's Cove andisknowntobeacannystrategist. The Oerid House of Maldrenn once ruled here.TheregionwasoncehometomanySuel bandits until the firm rule of the Maldrenn quashed such lawless behaviour. The Maldrennswherenonethelessfairandjustbut their marital traditions and disparaging attitude towards Suel traditions has been the cause of a longstanding feud between them andtheHouseofBaryaern. Thisattitudealsoledtotheperviousbaron being singled out for a particularly gruesome
Obelstone:Thisforbiddingcastlestandslikea blackshadowloomingoverthehorizoninthe cantredofObelton.ItwasbuiltbyearlyAerdi Overlords as a symbol of their control over Onnwal,asaplacetohousetheirarmyandto keep many prisoners who suffered horrendous punishments in the name of the Overkings. It was then a symbol of terror to the pirates, many of whom spent their final daysrottinginitsmanydungeons. Now it houses the villainous Office of Sorcery and many enslaved and imprisoned people of Onnwal. No one has ever proven that escape from Obelstone is possible. Rumoursofmagicksthatdistortdistance,cells without doors, walls that shift and shape, magical guardians and labyrinthine corridors are common. Inside many of those who have been "guests" or worked here have gone mad from the seemingly endless screams and the oppressivearchitecture.Peoplereportfeeling watchedbyinvisibleeyeswherevertheyturn. It is a fell place and full of horrors imagined and real from ghosts of prisoners, guardians, rejects from the Breeding Pens and the insidious success stories that are the purpose oftheBrotherhoodsexperimentshere. Obelton: This port was once ruled by the House of Jherlo, a Suel house that allied itself withAzharadianattheoutsetofhisinvasionof the country, welcoming him ashore when he landed at Obelton. The house maintained the purityofitsbloodlineandthismayhavebeen itsundoing.TheBrotherhoodpoisonedBaron Jherlo but his wife and three daughters were led away by the invaders and have not been seen since. The late baron has no other living heirs,thusthefateofthehouseisverymuchin question. Twoofthedaughtershavebeenshippedto the Tilvanot homelands of the Scarlet Brotherhood.Theremainingdaughterandher mother, both sorceresses are being held in
18
deathatthehandsoftheBrotherhoodhewas laid under a wooden platform and crushed beneath the weight of local people who were made to stand atop it. His brother, Lord Keirnal Maldrenn (LN male human Ftr6) survivedtheOccupation,andisnowfightingto restoretheoccupiedfief. Kiernals son, Dorlan Maldrenn (LG male humanPal6/GlaiveofAzharadian1)isaGlaive of Azharadian and acquits himself well in the fighting to recover Tessaks Cove. He has caught the eye of the Suel sorceress Lady Valyae Baryaern. Their liaison may heal the rift between the two houses but currently remainssecret.
A Gazetteer of Onnwal
The Suel first settled the area after they subjugatedthelocalFlantribesaftertheGreat Migrations. Much of the town was, however devastated when the Oeridians swept out of the east and conquered the region in the late 590s OR. The Oeridians reconstructed the shatteredtown,improvingthefortifications. The seat of the Dukes of the Storm Coast was captured through the treachery of its mayor,RohalSoldasin584CY.Itwasliberated from the Scarlet Brotherhood in late 590 CY, forcing its Brotherhood ruler, Kesh Kekarav Maditoflee.Soldas'bodywasnotfoundinthe retaken town and it is assumed that he escaped with Madi. However the liberation allowed Saielma Relaster, the new duchess of theStormCoasttoreclaimherancestralhome. Though young Duchess Saielma Relaster ruleshereinname,andhasthefavourofmost of the surviving 2,000 townsfolk, she is unskilledintheartsofwar.Fearingthatsheis not equal to the task she has allowed the Captain of her father's personal guard, a grizzled old marine veteran Hazaraz Skullsplitter almost complete freedom to deal with the Hochebi that infest the western
FreeLands
Sornhill
Sornhill: Sornhill possesses one of the best sheltered anchorages in Onnwal. Situated on the southern rim of Notxia Bay and protected from the seasonal storms by the rugged up lands of the western arm of the bay that juts outintotheGearnatliketheoutflungarmofa giant.
19
reachesofNotxiaBay.Acunningtacticianand not unskilled warrior, Hazaraz has been successful in containingthe Hochebi threat to thewesternarmofthebay.
A Gazetteer of Onnwal
dedicated to Mayaheine), as well as the Stormspire (Procan), the Halls of the Shining Coin (Zilchus), The Hall of the Pursuer (Trithereon) and the Chapel of Fortune (Norebo). Harbour Town was also home to a some Stormseekers led by Iseln Guiral. As a result of their desire to worship as close to their deity as possible membership of this groupissmall. Shipyards:PriortotheinvasionSornhillwasa centreofshipbuildingontheDragonsheadbut Brotherhoodforcesdestroyedthe3shipyards herebeforefleeingthetown.Twooftheyards, Patriis Monirs and Gershimon Iilinskis are nowoperationalalthoughHarnshirJaromesis beyondrepairbeinglittlemorethanmounds oftumbledstoneandcharredwood. Haven Town: The most cramped and squalid portion of Sornhill, Haven Town was home to manywhocouldaffordtodwellnowhereelse. Here the streets are narrow and windy with many buildings packed close together. Open spacesherearerare,althoughthereisaseries ofwellsfortheuseoftheinhabitants.
Stormhaven (The Red Tower): This edifice was built by Suel settlers shortly after their arrival on the Storm Coast solely out of red huedgraniteminedfromthehillstothesouth. Theoriginalstructurehadextensivedungeons beneath it used for storage and other less savoury purposes. The Oeridian citadel Stormhaven was built around the Red Tower whichhassurvivedthecenturieswell. TheBrotherhoodconvertedtheRedTower back to its former use, keeping influential Onnwalon captives here. They reopened the ancient tunnels and chambers beneath the tower, using them for the incarceration and torture of captives. Duke Relaster was kept imprisoned here for two years before he was killed. SincetheliberationStormhavenhasserved as Hazarazs command centre. The marines stationed in Sornhill also use Storm Haven as their base of operations. A Brotherhood shrine to Syrul was found in one of the dungeon rooms beneath the Red Tower. Interestingly, a number of religious murals were found on the walls of this chamber whose age long predated the Brotherhood occupation.Itisspeculatedthattheyarerelics of the Onnwi. Whatever the truth, they have defieddefacingwiththecoloursandpictures reemerging through either damage or covering.Theroomhasbeensealedoff. HighTown:Builtonalong,lowhillthatrises outoftheNotxiaHighTownisnotascramped asHarbourTownanditsinhabitantsenjoyeda better standard of living. The Chapel of the Blinding Light stands in High Town. In days past it doubled as the lawcourts and it is knownthatCatherayearnsforthedaywhenit will serve as such again. Onrulf the Smith Prince (LN dwarf Exp10) also has his shop here,cateringtothosewithsufficientcoin. HarbourTown:InmanywaysHarbourTown is the centre of Sornhill as most of the trade carried out in the town passes through this wardatonepointoranother.TheBrinyHalls standherealargeindoormarketdevotedto the buying and selling of fish and other consumables as do many of the temples popularwiththepopulace. The devout can find the Vault of the Sea here (previously devoted to Xerbo, but now
SornhillsHinterlands
TheHanging Gardens: Justoutside thewalls of Sornhill can be a found a small copse of treesknownastheHangingGardens.Itishere thatcriminalsandbrigandsweresentencedto deathfortheircrimes.Manylawbreakershave been buried here, giving rise to several gruesomelegendsaboutthisstandoftrees. Hekas (LE male human Wiz6 Nec) is the caretaker here. He maintains the facade of an absentminded old man but he is in fact a necromancer sent from Scant. He intends to recover the bodies of any Brotherhood operatives interred here for resurrection and to harness the power of the vengeful spirits heretodistracttheSornhillguard. Osprems Light: This large and wellfortified templeallbutcutofffromSornhill,locatedas itisacrossthebayonthewesternarmofthe bay.ThisedificeisalsoknownasTheTemple oftheLightoftheHavens. Alargeandprominenttempleinthetown, it has its own dock for the use of the faithful. The clergy of the church were almost all captured by the Brotherhood when the town fell with only a handful escaped by ship to Nessermouth. The captured priests were subjectedto"reeducation"atthehandsofthe Brotherhood'sOfficeofFaith.Whilesomedied duringtheordealorwentmadtheremainder
20
have become fanatically loyal supporters of theScarletSign. Whentherebelsretookthetownalthough andeffortsweremadetocapturethemalive,a numberofpriestsdiedratherthansurrender. Thesurvivorsarenowheldinthedungeonsof the Red Tower. It is unknown whether their minds can be freed from the hold, which the Brotherhoodhasoverthem. Upon the battlements a coalition has formed between the clergy of Mayaheine and Osprem. The measure of these stalwarts is to protecttheweakuponlandandsea,andthisis donefromthewallsofthefortresstemple.
A Gazetteer of Onnwal
barrows would shed much light on the early inhabitantsoftheDragonshead.Unfortunately for the savants more pressing matters currentlythreatenOnnwal. Celestians Court: This is a stone circle located midway along the route between SornhillandKilldeer.Atthecentreofthestone circle, which is located on a small hillock, is a stone monolith with a circular hole some 2 inchesinradiuscarvedthroughit.Thewhole islevelwiththehorizon.Twotimesayearthe sunis"in"thiscircleatsunsetandsunriseand marks the beginning of the winter and summer solstice. It was rumoured to have been built by the early Flan as a sort of calendarbytheirpriests.Latelyithasgained popularitywithpriestsofSotillionandTelchur who travel here on the summer and winter solsticerespectivelytoprayandcelebrate. Flannanot:Anoldabandonedhillfortlocated severalmilesinlandtheareagaineditscurrent name when the Onnwi fought a great battle against a conglomeration of local Flan tribes intent on resisting their advances. After several days of skirmishing the Flan were driven back to the hillfort where they made their final stand. Amongst the Suel were several powerful spellcasters who at the climaxofthebattledestroyedmuchofthehill with powerful magicks. The shattered and dazedsurvivorswereleadoffintoslaveryand the place swiftly fell into disrepair only sometimesbeingusedasawaystopbyweary travellers intent on sheltering from the elements. SeveralhundredyearslateranAerdipatrol discovered several beaten gold and silver trinketsonthehillafterdiggingafirepit.This find sparked off a wave of treasure hunters andadventurerswhocameanddugonthehill but nothing else was ever found. The inner wallsofFlannanotstillstandtothisday.Until recently the villagers of Harltonhill used the remainsofthefortasapenfortheirlivestock at night. Today the hilltop is the sight of frenzied activity as rebel forces attempt to refortify it in expectation of a Brotherhood counterattack. It is not unknown for rebel soldiers to be seen here late at night digging up on Flannanot seeking to supplement their meagre pay with a find of ancient Flan artefacts. Greenfalls: The town of Greenfalls, with its populationof100,istheseatoftheBaronsof SaltirnandliesonthebanksoftheSaltirn.This
SornsHill:ThefeaturethatSornhillisnamed after,SornsHill,istheburialsiteofanancient dwarven hero who perished here. A combined army of Noniz and Dwur troops exterminated the lingering remnants of the humanoid tribes of the peninsula in a weeklongbattle.Sorn,thegreatestDwurhero presentwasmortallywoundedatthemoment of victory and in accordance with his last wisheswaslaidtorestwherehefell. Centuries later the burial mound bears little resemblance to its original appearance. Several oak trees have taken root on the eastern face of the mound and the southern has partially collapsed after some wouldbe grave robbers attempted to tunnel into the mound in search of dwarven treasures. The only survivors garbled account of the very earthcomingalivetoswallowhiscompanions has served to keep other treasure hunters at bay.ThesouthernfaceisknownasChekars Folly after the leader of that illfated expedition. Sorns Hill is a wellknown local landmark used occasionally by travellers who cannot reach the safety of Sornhill as shelter. Those standingonthepeakofthehillcanseeseveral miles in all directions and in times of trouble the hill has been used as a lookout post. Several small skirmishes have been fought here, the debris of which can still be found lyinghereandthere.
OtherLocalesofNote
The Barrow Fields: Amongst the hills that surround Sornhill can be found the Barrow Fields.Thesetombswerebuiltlongbeforethe coming of the Suel. Some tombs have been disturbed and undead abominations awakened within, others now serve as bandit lairs. Scholars argue that the treasures undoubtedly concealed within undisturbed
21
shortstreamrunsdirectlyoutofthenorthern Headlands,cuttingadeepgorgeformostofits length,emptyingintotheGearnatnotfarfrom Sornhill.Itisknownforitsmanycataractsof which Greenfalls so named for the supposedly medicinal moss which grows thickly on the rocks around it is the most famous. ThecurrentBaronSaltirnisMilosRelaster (N male human Wiz10), a mage of some renown. He was an apprentice of Bigby and wasabsentfromGreenfallswhenitfelltothe Brotherhood. His absence continues and he is known in town as the absentee. Sometimes heisonbusinessforhisoldmaster,butlately hehassurprisedpeoplebyattemptingtoclaim the Barony of Norland, an uncharacteristic involvementinpolitics.HeappointsJorak,the localpriestofVelnius,toadministrateNorland onhisbehalf. DeathfallQuarry:Thisiswherethestrangely coloured rock used in the construction of the RedTowerwasmined.KnowninFlanlegends as the Battlefield of Giants it was originally a huge extrusion of rock jutted out from a hillside. Discovered by Suel explorers theydeemed the rock tough enough to be used in their fortificationsandbegantominetheareausing captured Flan slaves, the majority of whom diedhere.Workstoppedwhentheremainder of the hillside, destabilised by the removal of so much rock collapsed killing almost all the workersandguardspresent.Todaythesiteis alonely,desolateone.Stillunstablesinkholes andsmalllocalcollapsesarecommon.Several Scarlet Brotherhood patrols were lost in the areaandnownoneventurehere. The mine is haunted by those killed in the final collapse that even now attempt to dig themselves free, causing the sinkholes and other collapses. Any disappearances in the areaareblamedontheserestlessspirits.
A Gazetteer of Onnwal
village but was slain by the Brotherhood. HarltonHillisstillwithoutaMayorfor5years. A local man, Tarek Blackhands (LG male human Com5), has taken it upon himself to lead the villagers. The only surviving blacksmithinthevillageheischarismaticand popularalthoughaprivatemanmuchgivento broodingandblackmoods. The village is a focal point for the rebels, possessingstrongdefences.KeshArinthellwas slain in the fighting to regain the village, as were most of her troops, and her body was severely mutilated by the outraged villagers before being cast into a shallow grave to the west of the village. So far it has remained there... Plansexistfordiggingahugeditcharound the rest of the village but currently the manpowerforsuchexcavationsdoesnotexist. Swallowfeld:Swallowfeldisavillagethathas grown up on three sides of Hillwater Lake. The lake itself is formed out of a natural depression bounded to the north, west and eastbyasmallrangeofhills.Onlytothesouth do hills not mark the extent of the lake. Two small rivers thatflow out of the Headlands to the south feed the lake, which is drained (supposedly) via several underground watercourses that run northward emptying into the Gearnat although the truth of this is not known. Swallowfeld is named for the flocks of swallows that early Suel settlers discovered dwelling around the hills. They discovered that the broad flood plains of the two rivers were particularly fertile and ideal for grazing their cattle. Beyond this the land rises slowly and is well drained making excellentlandforthecultivationofsugarcane, limesandothercrops. Before the occupation almost 500 people madetheirhomesinthehillsaroundthelake either farming the land or fishing the lake to survive. After the first few months of occupation many Onnwalons were carried off to Scant and captivity. Many have not returned. The local mayor has not been seen since the beginning of the occupation and his fateremainsunknown.Inhisplacehiseldest daughterrules,PirraenVae(LGfemalehuman Sor5). During the occupation she managed to keep her magical talents a secret from the Kesh, BeratRegor, while giving the resistance extensiveassistanceininfiltratingthearea. Thecentrepieceofthelakeisalargeisland upon which grow nine huge oak trees known locallyastheNineGiants.Locallegendhas
Harlton Hill: Named after the original owner of the first inn built on the slopes of the hill HarltonHillishometoaround220individuals. Builtintheleeoftheoldhillfortandlinkedto the coastal road by two spur tracks Harlton Hill sprung up to service treasure hunters searchingFlannanot.Thetreasurehuntersare gonebutthevillagestillsurvives,tendingtheir cropsandlivestockandservicingtheneedsof thoseusingthecoastroadtothenorth. Due to its proximity to Sornhill a mayor appointed by Duke Relaster oversaw the
22
itthattheninetreesareancientnaturespirits trappedinphysicalform.Whateverthetruth, the trees are listed in the records of the first Sueltocolonisethearea.
A Gazetteer of Onnwal
formthemazeofsteepsidedlimestoneislands knownastheKurstIsles. The valleys of the Fallnos and the Silverstreamarebothfertileandsupportfields of maize and sugarcane. Yornal, a variety of rum, is distilled near Longbridge. Away from the valleys, orchards producing citrus and other soft fruits are abound, as well as olive groves and stands of cork oak. Salt is harvested along the lagoons of the central coast, complementing the large fishing industry. Before the Greyhawk Wars; Onnwalon salt was exported far and wide across the Flanaess. Pearls are found in abundance in the waters around Longbridge, knownalsoasthePearloftheAzure.
Verwald and Norland Point: The northern most cantred of the Storm Coast was often regarded as worthless and backwards swampland. It was ruled over by Sailemas cousin, Garamon Relaster, who disappeared duringthepreviousyear.Thoughhisbodywas not found assassins of the Scarlet Sign were thoughttoberesponsible. The line of succession was unclear as Garamondhadnoheirs.Threeclaimantshave emerged a young rake named Wallac Relaster (CN male human Rog5), thought to have links to the Wreckers, Baron Milos Relaster of Greenfalls and lately Harnashir Relaster (LN male human Ftr6/Templar2 Pholtus), a distant cousin of Sailema who had been wandering in Northern Nyrond and has converted to the worship of Pholtus. He has the backing of the priesthood of Pholtus in Killdeer. In the ensuing panic Jian Destron appointed Paradd Carbani (LN male human Ari6)asprovostofNorland.Paraddisascion of a powerful Onnwalon merchant house that has bankrolled the war effort. Ever since Paradd became Provost dark and terrible things have been happening in Norland. Supplycaravanshavebeendestroyed,villages attacked and the tracks have led into the swamps. For what little resources it has, Norland holds several crucially strategic position, not leastofwhichisthewesterntuskofDunhead Bay, and that should Norland fall into the hands of a traitor it would be a total disaster forOnnwal,andforthepeopleofNorlandand alltheStormCoast.
ScarletBrotherhoodControlled Lands
Gullhaven: This Brotherhood controlled port with a population of 630 provides a stranglehold on the Azure Sea. Referred to as GovalbytheBrotherhooditisnonetheless the last major hold of the Brotherhood and hometonumerousgalleysbearingtheScarlet Sign. Rumours abound that yellow sailed ships belongingtotheslaversoftheWildCoasthave beendockedinGullhaven.Therebellionwould paywelltoknowtheveracityofthesetales.
FreeLands
LongbridgeanditsHinterlands
Longbridge: Standing at the mouth of the Fallnos river, Longbridge is not one, but two towns,linkedbyastonebridgebuiltbydwur calledtheSpan.Alsoknownas"ZilchussWay" goodfortuneisthoughttosmileonthosewho castacoinintothewatersoftheFallnoswhile standingonthebridge.Uponthewesternbank stands Naerway, the scruffier of the two settlements,whileontheeasternbankstands theelegantSolliton. The town was liberated inlate 586 CY but the House of Cadwale was decimated during the Occupation. Duke Ansend his wife and three sons were slain by Brotherhood assassins as they slept. The Duke's cousin, Duvend, Baron Azurond, fell in the Brotherhood landings at Longbridge, leaving no direct heir. Gellen Cadwale, Ansends brother,nowbearstheducalcoronet.Acloud of suspicion overhangs Cadwale as it was he who bore the orders recalling the Glaives of Azharadian to Scant, ultimately leading to
TheAzureCoast
The Azure Coast is considered the most pleasant of Onnwals four provinces, not least by its inhabitants, who are known for their pride and talltales. The majority of the coastline is lowlying, with many sandy beaches, salt marshes and lagoons. The Azure Coastislushandgreen,enjoyinghotsummers and plentiful rainfall. The land slopes gently downfromtheHeadlandstothesea.However, inthewest,theVolanotsspillintotheCantred of Gullhaven, while in the east the Headlands
23
their betrayal on the Night of Scarlet Knives. MayorAccilonDara(LNmalehumanAri4)and his wife Kaywen (NG female human Clr6 Sotillon)aidhiminrulingthetown. Prior to the Wars, Longbridge was an integralpartoftheCliffwayatraderoutethat linkedIrongatewithScant.However,withthe outbreak of hostilities, trade along this route hasbeenreducedtoatrickle. Docks and jetties can be found up and down both banks of the Fallnos. Built with
A Gazetteer of Onnwal
Dwur aid to resist both the Azure Seas autumnal high tides and the seasonal floodwatersthatflowoutoftheHeadlands,the bridge bars the passage of larger vessels further up river. The Fallnos is a particularly fast river and annual dredging is needed to keep the approaches to the town open. For three days during Patchwall, the Fallnos is packed with salmon trying to swim upstream to their spawning grounds. The mouth of the riverisover50yardswide,butunpredictable
24
A Gazetteer of Onnwal
Solliton but spends much of his time in his palatial estate to the eastof thetownashe is dying of consumption that defies clerical magic. Of the other family members only Helanaisoftenseenabouttown. Solliton is also home to several faiths. The Vault of the Coin adjacent to the Merchants WheelisdedicatedtoZilchus.Sealedsincethe fall of the town in 584 CY, it has resisted all attempts to reopen it. A makeshift chapel to theLordofCoinhasbeensetup.ThePalaceof theLadyofthePearlsissanctifiedinthename of Osprem (a local belief having pearls being considered to be the tears of Osprem). The Court of the Winds, sacred to the Oeridian agriculturalgods,alsoresideshere. Sotillon is an important local deity, worshipped primarily in her aspect as a provider of comforts. A summer festival has been traditionally held in her honour every year. On the first day of Richfest a young maiden is proclaimed as the Pearl of Longbridge. Weeklong celebrations ensue, giving thanks to the Lady of Summer for the bountyandcomfortsthatshehasbestowedon thetown. ThelawcourtsandchapeltoPholtuswere desecrated and used as a stable by the small forceofBrotherhoodcavalry.Raisea,theblind Pholtine highpriestess, survived thesackand has, with grim determination, set about reconsecratingtheguttedshrine. AtthecentreofSollitonliestheMerchants Wheel a great oval space in the midst of which is an ornate fountain dedicated to Sotillon, unfortunately vandalised during the sack. Much of the trade that is conducted in Longbridgeiscarriedouthere.Richmerchants maintain business around the Wheel, while lesser individuals rent stall to display their wares. Longbridge bears the hidden legacy of the decadent Zelradton Szeks and their vile cronies.ThelayoutoftheMerchantsWheelis actually a large arcane symbol that the architect intended to use to summon fiends. There is, beneath the centre of the wheel, an abandonedtempletoHextorthatwasusedby the Aerdi noblemen that once vacationed in Longbridge. The Estates of House Cadwale: House Cadwale'sestatesarelocatedseveralmilesup the Fallnos from Longbridge. They are linked to that town by a welllaid road that is now showingsigns of neglect. The estate takes the form of a single large and rambling manor
Naerway: Naerway is constructed on the lowerofthetworiverbanksandpartsofitare pronetofloodduringthehighautumnaltides. As a consequence in Naerway the poorer you are, the closer you live tothe Fallnos.Asmall part of Naerway has come to be known as Little Naerie because of a number of Ideean exiles who dwell there. They hate both the Brotherhood and Ahlissa and take any opportunitytostrikeagainsteitherenemy. The Azure Citadel, dedicated to Procan, is located where the danger of this is greatest. Every autumn special services were held as thecrestsofthehighestwavesgentlylapinto the temple's main chamber. It was leveled by theBrotherhoodduringtheOccupationgutted byfire.GavosKalsenn(CGmalehumanClr10) officiateshereandiswidelyregardedasoneof themostpowerfuloflocalspellcasters. Naerway's has newly built temples to TrithereonandMayaheine,asmalltownhouse called The Bastion Solar. The votive altar and statue to Fharlanghn at the Crane Gate vanishedduringthefallofthetownin584CY andreappearedequallyasmysteriouslyonthe morning the town was retaken. Although the Farwanderer has no permanent clergy in the town, these mysterious goings on have increased the mystique of the faith in Naerway. The Almshouse of the Gilded Leaf stands on a small bluff a stone's throw from the Fallnos. Maintained by Malasca Demerii a native of Sunndi, the Almshouse helps many thatwouldotherwisestarve.Asaconsequence Malascaismuchbelovedbymanycommoners. Sotillon:Sollitonishometomanymerchants, welltodo commoners, spellthrowers and othersofgoodstanding.Prominentmerchants maintaining businesses here include the Carbani, Feralnen, Muamman and the Galthrena. The Feralen are preeminent in the fine weaponry trade, some of their blades rivaling thoseofthedwurforstrengthandkeennessof blade. The Galthrena are perhaps the most powerfulmerchantsintheprovince.Theyare the leaders of the Black Hoods, a local crime syndicateandwhileaccusationsofcorruption dog the family no concrete proof exists. Derl Galthrena, the aging patriarch of the family and selfproclamied godfather of the town, maintains a wellappointed townhouse in
25
house with its attendant outbuildings and perimeter wall. The wall now has several breaches, which were created, during the recent fighting between rebel and Brotherhoodforces. The Cadwales were universally renowned for their skill at arms until the socalled "Tunnelling Duke" (373 CY402 CY) who hid himself away from the populace and busied himself constructing galleries, tunnels and chambers beneath his estate. One of the tunnelshewasrumouredtohavecreatedwas wide enough for his carriage to traverse and wasthoughttorunfromhisstablesalltheway tothemaingate. The estate is now deserted after rebel forcesdiscoveredtheBrotherhoodtroopshad been slaughtered to a man by something that (presumably) escaped from the depths. Several rebels who spent the night in the housewerefoundtornlimbfromlimbandso thehouseisavoidedbyallnow.
A Gazetteer of Onnwal
Vale. The very air around the bones is corrosive due the presence of the nearby whitesegmentoftheHideousIdol. Its guardian, Vaereldenlham is a young adult male bronze dragon. He is bound by an ancient oath made by his progenitors and is unabletosetfoot,orflyovertheDragonshead. Hisonlycompanionsonhislonelyvigilarethe ghostsofhisancestors. He is aware of the stirrings of the piece of the Pentarch and desperately seeks to understanditspurpose.Aidedbythespiritsof many of his kin he understands that the reawakening of the Pentarchs does not bode well for the inhabitants of the Dragonshead. He fears that if the Pentarchs were to be reunited then dragons would flock to the DragonsheadfromalloverOerthandthatthe destructionwroughtsomanyyearsagowould berepeated. Bauldrenn: This small hamlet with 150 souls appears a dour and humourless place. The mayor,DubiasDaldrenn(NmalehumanAri3) hidesasecretheisbeingblackmailedbythe local Wrecker boss, Gavran (CN(E) male Rog6),wholiberatedthehamlet. Dubias aided Kesh Nojos of Longbridge in executing certain dissidents. In return for his silence Dubias has made Gavran effectively a robberbaron.Gavranandhisbandoverseethe few skiffs and barges that pass through here. Occassional goods go missing and Gavran has his way with the local women. His appetites andgreedarelikelytoreachdangerouslevels before long and he may make a boon companion to Helana Galathrena of Longbridge. Elmscoombe: Located in the eastern portion oftheIronMarch,amongstthefoothillsofthe Headlands is a secluded boxvalley known as Elmscoombe. A huge and ancient elm tree standsamongstacopseoftreesthatsurround a small lake. Struck by lighting and scorched byfireseveraltimesinitslonghistory,theold elm has stood for centuries. Isolated and uninhabited, two bands of Brotherhood soldieryvanishedhereduringtheOccupation, leaving no hint as to their fate. Prior to the Greyhawk Wars, a minor War Company, the Blades of Irongate, vanished here after spreading it around Kurstand that they had discoveredsomepreviouslyunknowncaverns. Their horses were found several weeks later, grazing by the pool, hobbled and in need of exercise,butotherwiseunharmed.
OtherLocalesofNote
Aekalityrva, the Isle of Bone: Only the ancient Dwur Eddas of the Wyrm Slayers makes mention of Aekalityrva. All but fools and dreamers among the people of Onnwal andtheHeadlandsconsideritalegend. Far out in the Azure, this rugged isle thrusts up out of the waves. Marked on no chart, its black volcanic cliffs rise sheer and jagged on almost all sides, empty of bird life, withtheendlessbeatingofthewavesuponthe shoretheonlysound.Theisleitselfisverdant for the most part, though strangely bereft of animal life. The wind whistles eerily though the long grasses and trees, which clothe the slopes. Attheheartoftheisle,liestheValeofBone so called because it is littered with the huge bleached skeletons of a multitude of Wyrms, like great ruined cathedrals of bone. Aekalityrva was the graveyard for the Great WyrmsoftheDragonsheadinagespast.Even the most powerful dragon must oneday die, andforunnumberedaeons,theycamehereto breathe their last and to join their ancestors. The spiritsof the ancientwyrms still dwell in the vale, whispering to each other of long forgotten days. Here too are the bones of Rithuxalaerthhoon the last of the Great Wyrms of Onnwal, slain by the dwur hero DarrorFarstili,thoughhehimselfwasslainin the act. Their bones and Darrors arms and armour lie intermingled in the heart of the
26
Haylind: The seat of the Cantred of Azurond, Haylind stands at the mouth of the Silverstream, at the eastern end of the many arched stone bridge that carries the Cliffway overtheriver.Thesquarestonetowerkeepof theBaronsofAzurond,vacantsincethedeath in Longbridge in 584 CY of Duvend, the last baron, dominates the little port. A small force of Army of Rebellion Regulars now garrisons the tower and protects the village and its populationof 650. Below the tower is asmall harbour. In happier times flatbottomed skiffs and smallbargeswouldtraveluptheSilverstream to bear south the bounty of the mines of the Silvervale. An unpaved road follows the river north into the vale, to meet up with the Hind RoadatthetownofSilvervale.
A Gazetteer of Onnwal
in the vicinity of the Hezarin Isles, and sightings of ships of the Yellow Sails have addedmuchcredencetothistheory. KennarsCrossing:Thisvillageof400soulsis the seat of House Keldas who rule over the fertile valley of the Fallnos some of the richest land in the country. In the past, the barons of Fallnos Vale have been content to ruletheirlandsandtaketheireaseandhave been perceived by other nobles as country bumpkins. Perhaps it was this perception of their irrelevance, which spared the current baron, Joren Keldas from the attentions of the assassins of the Scarlet Brotherhood. Joren was nonetheless hunted by the Brotherhood after the invasion, but made good his escape with his family into the Headlands and found refuge with the survivors of the House of Faskel. A strong bond has grown up between the two houses and a marriage between Joren's eldest daughter, Natalia and Sir Milos Faskelisrumoured. Kurstand: Kurstand, a trading post of 200 people, stands in a small bay where the flat lands of the central Azure Coast meet the western edge of the Headlands. Like Haylind, Kurstand stands on the Cliffway. Some traffic betweenIrongateandthe600peopleherehas resumed in recent years, as well as some surreptitious trade with the Headland Dwur citadelofSarakastespeciallyinmetals. TheHouseofDernasterhasruledoverthe rugged Iron March for centuries from here. The family had extensive contacts with Irongate and was mainly responsible for keepingthelandlinktothefortresscityclear of bandits and the collection of excises on traffic entering Onnwal from the east. The Dernasters were therefore one of the wealthierhouses. The fate of Baron Leinand Dernaster and his entire family is a mystery. They were last seen fleeing the Brotherhood advance aboard the navy galley Pegasus, bound for Irongate. However the Pegasus never reached the Fortress City. They are feared lost to either BrotherhoodorKurstIslandpirates.
The Hezarin (Hell) Isles: The Hezarin Isles consistoffiveislands,thethreelargerislands being volcanically active. Situated on a fault line the three main islands constantly spew forth ash, smoke and fire, the seas around themchurn,boilandquakeandtheairisblack andpoisonous.Historicallythesevolcanicisles have mostly been ignored due to both the natural dangers that hinder any exploration and the many superstitions attached to them. Howeverinrecentyearsthishaschangedwith the growing conflict over these isles between followers of Joramy and Pyremius who both see them as a holy site of their respective Gods. ThetwosmallsettlementsofPelorbayand Ospret are located on the relatively dormant and fertile islands of Gedan and Berel respectively. Since the Brotherhood withdrew its occupying garrisons in early 587 CY, these smallislandtownshavebeenfreeports.They have served as safe havens for foreign merchants who wish to avoid the strife that plaguesthecoastalwatersofthemainland.As aresulttheyhavealsoattractedmanypirates of the Storm Isles, who traverse the trade routesandhaveplunderedthebountifulcargo of many a Keoish Galleon or Uleki Caravel, muchtotheangerofthecitizensoftheIsles. These piratical and slaving activities are said to be responsible forthe many ships lost
27
The Kurst Isles: This maze of drowned limestone tors is named for Lendril Kurst, a nighlegendary local freebooter who plagued this region in the middle of the 3rd century. The isles are almost all uniformly steep and clothed in dense vegetation, at least where it cangainpurchaseontheoftenprecipitousand rocky flanks. Caves rid dle the isles, some of which are revealed only at low tide. In times past the isles have served as a refuge for all manner of fugitives pirates and other undesirables which combined with the region's treacherous shoals and reefs mean that the isles are avoided by wise travellers andremainlargelyunchartedtothisday. TheSaernedd(Serpent)Isles:TheSaernedd Islesarethemostsoutherlyandmysteriousof the island chains. The Iron League made the firststepsinexploringandsettlingtheseisles in the decades before the Wars by the founding of two separate colonies, one by Onnwal, the other by Idee and named Fort Azharadian and Port Saerwen respectively. The inhabitants of these small colonies have shedlittlelightonthemanytalesoflostcities, cannibalistic tribes, savage gods, colossal snakes, trees of gold and silver, of nations of talking animals in which humankind are the petsthatcomefromtheseisles. The islands are verdant, filled with lush jungles, home to many unknown plants. A large variety of reptiles and snakes, many of which are not found elsewhere make the
A Gazetteer of Onnwal
islandstheirhome. When the settlers of Fort Azharadian arrived they discovered that these isles were under the rule of many tribes of lizardmen. The Dwur had established a small stronghold named Narazthat. They find a life at sea far more rewarding than toiling under miles of dirtandareconsideredpariahamongmanyof themainlandDwurclan.ThefolksofSaerwen and Fort Azharadian regard them as great shipbuilders. They guard their secrets closely and sail the open seas upon their sturdy catamarans. Fort Azharadian has long since fallen into anarchy with the loss of contact with the mainlandandisrumouredtoberunbyagents oftheScarletSign.PortSaerwen,withthefall ofIdeetotheKingdomofAlhissa,haschanged rulersandistheonlybastionofcivilisationin these isles (according to the new Ahlissan governerGarthubaldNeranden).Humanshave never visited many of the islands and subsequently what secrets and dangers they mayholdareyetuncovered.
TheEasternMarchlands
The Eastern Marchlands encompass most of the Headlands and a narrow coastal plain runningalongthewesternshoresofDunhead Bay. The majority of the population dwells in wellfortified towns and villages along the coast.Thelowlandsarewateredbynumerous fast flowing streams that tumble out of the hills. Though some fruit and maize are cultivated, most families keep pigs or cows. Fish are plentiful in Dunhead Bay, though the threats posed by Ahlissan corsairs made it hazardousfortheMarchlandsfishingfleetsto venturetoofarfromshore. Unlike the rest of Onnwal, the Marchlanders are almost pureblood Oerids, here Oeridian faiths and traditions predominate. Having lived in the shadow of the South Province for nigh two centuries, military service is ingrained into the lives of the people and the Marchlands supply more than their share of soldiers to Onnwals military. Marchers are known to be rather dour,seriousfolkwhoaregoodinafight. TheMarchlandswerewherethefirstblows oftheBrewfestRebellionwerestruck.Killdeer serves as the new capital of the Free State. A significant proportion of Onnwals military is based here, while the free churches have set uptheirmainshrinesandtemplesinthetown. TradewithIrongatehasresumedviatheport of Northanchor. Baeren Coriell, duke of the
28
Eastern Marchlands serves as Onnwals ambassadortoIrongate. BaerenistheheadofHouseofCoriellwho haveruledheresincetherebellionagainstthe GreatKingdom.Therehavebeenstrongbonds betweentheHouseofCoriellandtheDwurof the Citadel of Vergannin. In repayment for an old debt of honour the Thegns of Vergannin sendHouseCorielladozenofthefinestDwur warriorsofVergannin.Thankstotheseguards Baeren Coriel survived the Scarlet Brotherhood assassins. Rallying his troops to fightofftheadvanceBrotherhoodforcesentto capture Killdeer, he quickly assessed the enormity of the disaster that had befallen Onnwal.Thedukeinstructedhispeopletoflee into the hills and with his household forces retreated into the Headlands, making his way finallytoIrongate.Hisbrother,Elwerd,Baron of Dwur March too survived the occupation, finding refuge with his household guard in Vergannin. He has since returned to his fief, though he continues to urge his Dwur friends
A Gazetteer of Onnwal
tojointhestruggleagainsttheBrotherhood.
Killdeer
Killdeer is the heart of Free Onnwal. Most of thesmallrebelfleetisbasedhere,alongwitha large contingent of the Army of Rebellion, backedbyDukeCoriell'spersonalguards.The majority of the free churches of Onnwal have setuptempleshere. Something approaching normal life has returned to the main town and considering that before the Wars, Killdeer was effectively an army camp, little has changed except the identity of the enemy. The people have put aside the dark memories of the past and thrown themselves into the struggle for freedom.Killdeer'sfishingfleetoncemoresets forth proud and free, to return with nets bulging with fish to provision the Army of Rebellion.TradehasbegunwithIrongatewith foodstuffs being shipped down the coast to Northanchor in return for badly needed arms andarmour.
29
Nonetheless, the occupation has left its mark, not only in the hostages taken from everyfamilybyKuranyie,ofwhichnothinghas been heard of since, but also in the distrust and suspicion of strangers which is pervasive here.RumoursoftheresurgenceofAhlissaare afurthercauseofconcern.Whateverguisethe rulers of Aerdy adopt, it will not erase the enmity the people of Killdeer have held for theirneighbourstotheeastforoveracentury. Boatstrand: The Boatsrand, a small, densely packed part of Killdeer, is the portion of the town into which waterborne trade good used to flow. Many warehouses are located here. Walled off from the rest of the town to guard against invasion this part of the town was comprehensively looted by retreating Brotherhoodforcesin586CY.Tocompensate forthelackofspacebuildingsheretendtobe higher than the norm some warehouses beingoverthreestoriesinheight. TheDuke'sCauseway:TheDukesCauseway runs from the Boatstrand to Templeside. The causeway also provides the only overland access to the central islands, and as such is heavilyguarded.TheThanesPassage,adwur constructed bridge, links the causeway to Boatstrand and therefore controls access to thecentralislands.Thecentralpartofitcanbe retractedintimesofneedsealingoffthecastle fromtherestofthetown. Main Town: Main Town is by far the largest part of Killdeer. Home to the majority of the populationmostofthebusinessestobefound inKilldeerarealsohere.Thecourthousescan be found overlooking Killdeers marketplace, which is little more now than a muddy field. Therehasnotbeensufficienttimetorepairall the buildings damaged in the fighting and some still stand empty. Unlike most places in Onnwal, Killdeers population has actually increased by several hundred with refugees and members of Destrons court flowing into thenewcapital. Most of these immigrant Onnwalons are tobefoundhere.Manytavernsandhostelries can be found within Main Town. The most infamous of these is The Slumbering Wyrm. Run by Megaera Varn (NG human female Rog8/JadeMask5)andCairEirnalroe(NGhalf elf male Clr7 Johydee) it is a wild place suitable only for those with a liking for rowdiness and adventure. Varn and Erinalroe maintainasecretJadeMasksafehouseandare on the lookout for adventurers who show promise.
A Gazetteer of Onnwal
In recent months wild rumours have circulated of Brotherhood agents again operatinginKilldeer.Fearofthisreachedsuch alevelthatinReadyinganAhlissanmerchant waslynchedsimplyforwearingaredcloak. Templeside: In Killdeer all the temples are clustered in Templeside. Most of the major faiths of Onnwal have places of worship here, many of which were damaged or destroyed duringtheoccupation.MaryaJernaltheleader ofOspremsfaithhasreclaimedhertemplebut to her chagrin she has lost much of her congregation to the faith of Procan. Procans faith led by Holshend Wildren has rebuilt its temple.Workprogressedquicklythrough591 CYandthenewedificeiscompleted. The Zilchians have been reduced to worshippinginasmallmakeshiftshrinewhile their shattered temple continues to be rebuilt under the direction of Barund Laramore, who is the Szeks. Followers of Pholtus led by Shining Paragon Purcend Kerondas have also returned here, and have all but rebuilt their charred place of worship. The worship of Trithereon is enjoying rapid expansion in Killdeer as it is throughout Onnwal. The temple has been rebuilt and its sacred bell onceagainringsoutoverthetown,despitean attempttodestroyitbytheScarletSignin591 CY.NialletheWandererleadsthefollowersof the Summoner in Onnwal but defers in many thingstoSarlemFreeman. Religious tension here is high as the many lawfulandchaoticfaithsofOnnwalareforced to coexist relatively close together. Although bloodshedhassofarnotbeenavoidedseveral worshippers of rival faiths have attempted to disruptothersservices.
OtherLocales
Dunheern:The900inhabitantsofthisfishing port, located where the Dunn/Issak's Torrent reaches Dunhead Bay, are of almost pure Oeridian descent. As a result the entire populaceweremadethrallsoftheScarletSign during the Occupation. This ordeal has reinforced the traditional siege mentality of the port, an echo of the days when it was the sails of the South Province that were feared, notthoseoftheScarletBrotherhood. Dunheern, therefore, does not readily welcome strangers, a fact exemplified by the rows of rotting hochebi heads that line the walls. There is only one tavern, a temple to Procan and an ornate, but small Temple of Heironeous in keeping with the staunchly
30
martialtraditionoftheHouseLorendrennand theireliteretainers,theDunheernVanguard. ThemostprominentfeatureofDunheernis the ancient Baronial Keep where Baron Halrend Lorendrenn (LG male human Pal6/Glaive of Azharadian 5), Glaive Valorous oftheGoldenSun,hashisseat.Lorendrennis said to plot against his foil, Duke Gellen Cadwalle,whoheblamesforthecurrentstate oftheOrderoftheGoldenSun. Notil: Notil is the seat of the Cantred of the High Headland and the site of Onnwal's platinum mines. Seven delves surround the main settlement of 880 individuals, their shafts plunging deep into the flanks of high limestonetors. Asturdycastlestandswatchoverthepass that forms the northwestern entrance of the ValeofNotil.ThecastleistheseatoftheHouse of Faskel, who maintain it and a garrison of theirhouseholdguardbolsteredbyanAltadof ArmyofRebellionRegularsofthe1stBraetad. Thesettlementitselfissitsinavalecarved out from the limestone hills by the Yoreill, a fastflowing tributary of the river Fallnos. An encircling curtain wall, built from stone quarried in the surrounding hills protects the village. Cultivated fields cover the floor of the vale,whilesheepandgoatsareherdedonthe less precipitous slopes of the surrounding hills. There is a prominent chapel to Jascar in Notil, while Fortubo and Zilchus are also favouredhere,forobviousreasons. Prior to the Occupation however, most of the village earned its living from the mines. Many of the skilled human, dwur and noniz miners and engineers were worked to death by the Brotherhood during the Occupation. The Baron of Notil was slain but his brother, LordKalderonFaskel,survivedhowever. However,theworstatrocitywasvisitedon thecommunityby,theKeshofNotil,beforehe was slain by Baron Faskel's forces, when he orderedthattheminesbecollapsedmanyof them with the miners still working inside them. Since that time, no ore has been mined inNotil. Varl's Keep: The seat of the Cantred of the Dwur March and of Baron Elwerd Coriell, Baernansbrother,sitsonthenorthernedgeof the Headlands. The centre of the settlement, where520soulssubsist,istheBaron'sKeep,a modest tower keep and bailey built in the square Oeridian style, which sits atop a small tor. The rest of the village clings to the flanks of the hill, its narrow streets winding up the
A Gazetteer of Onnwal
steepslope.Someofthehousesherearebuilt directlyintothelimestonerockthoughthese arechieflyoccupiedbydwur. An unpaved road connects Varl's Keep to the shores of Dunhead Bay and the paved highway that runs between Killdeer and Northanchor. The track winds on into the Headlands, following tortuous river valleys as far as the Dwur Citadel of Verganinn. Varl's Keep is one of the main points of contact between the Citadels of the Headland Dwur and the Free State and there is much traffic alongtheVerganninTrail. The Baron's duties as acting Duke mean that he is frequently detained with affairs of the Province and the State in Killdeer. When he does manage to escape the capital, he is accompanied by six of the famed Vergannin Guard. Elwerd has tried, so far without success, to persuade the Headlander Dwur to commit their forces to the cause of the Free State. So far, however, his entreaties, though greeted sympathetically in Vergannin, have metwithlittlesuccess.
TheHeadlands
The Headlands form the spine of the Dragonshead Peninsula. Mainly composed of limestone, the hills are a maze of steepsided tors riddled with natural cavern systems. Blessed with abundant rainfall, the highlands are clothed in lush vegetation. Scored by thousands of streams, which form tortuous systems of valleys and gorges. The Headlands are generally considered impassable except forahandfuloftracksandpasses.
TheHeadlanders
Known as Headlanders to the people of the Lowlands the Flan tribes of Onnwal are the last vestiges of the first human inhabitants of the Dragonshead. These people have herded theiranimalsanddweltintheirstonehillforts since before the coming of Azharadian. Collectively the Headlanders call themselves thePeopleoftheDreaming. There is a long standing enmity between the Headlanders and the Dwur and Noniz of the Headlands, the cause of which goes back through the centuries. The Headlanders (except the Galai Iorn) and Dwur hate anything draconic due to an intolerance ingrained during their ancient war with the Wyrms. Ventonii:TheVentoniiareapeacefultribeof farmers and hunters led by Chief Mortigasus (LN male human Rng6). What distinguishes
31
them is the blue tattoos they cover their bodies with and their obsession over an ancient relic taken from the Onnwi a large standard made of lion skin known as Rashta. The artefact is interred within the sacred moundofCregyBedwandusedinthetesting ofnewspearsforthetribe. Dumanonii: The Dumanonii are similarly peaceful. The tribesmen, bearing the mark of the green cloud on their bared shoulders, trade their livestock and produce with lowlanders during the Brewfest Fairs in GrovehillandSilvervale.Thechief,Gwallam(N humanmaleFtr4)isarivalofMortigasusand the two tribes have come to blows over accusationsofcattletheft. Talamendes:Residinginthesouthernsection oftheHeadlandsthebloodthirstyTalamendes wearredtattoosontheirbodies.Childrenare exposed to the elements at birth and to enter the tribe they must walk a deadly gauntlet of pain. ThelandsoftheTalamendesareclosestto thedwurcitadelsandthetwofrequentlyclash. The head of the tribe Awran Bloodreaver (CN human male Brb12) is a mighty warrior who tookleadershipofthetribeshortlyafterbeing given his spear. Before the Greyhawk Wars a sizeablebountywasplacedonhishead. Galai Iorn: The degenerate Galai Iorn are thoughttobesomekindofinbredthrowback. The Galai Iorn dwell in the heart of the Headlandsinthedesolatetorsandbenighted valeswhichsurroundtheCirelIornadh.Onlya fewglimpsesofthesemysteriousHeadlanders have been forthcoming. Descriptions state they are hunched black tattooed inbred humans with grey skin and eyes that glow in the darkness. The leaders of the Galai Iorn claim to be priests but are actually are sorcerersandexclusivelymale. The Galai Iorn are shunned by the other tribes. They are cannibals feeding off dwur and human flesh alike. They practice wicked waysincludinghumansacrificebutknowlittle oftheirhistorywhichbutfortalesamongthe other Flan and fragmentary histories of the Dwur is now remembered only by the spirits ofthedeadWyrmsofAekalityrvatheIsleof BonesintheAzureSea. The Dreaming Gyre: The ancient Flan of Onnwal came originally from the lands of the UrFlannaetotheeastandnorth,fromwhence they were driven. Over four thousand years ago,certainmysticswereledtotheHeadlands
A Gazetteer of Onnwal
by a voice that spoke to them in dreams. Somewhere deep within the heart of the Ial Iorneh, they found the Cirel Iornadh the DreamingGyre. Here, they discovered a place where faint echoes of the terrible dreams of the SlumberingGod,Tharizdun,resonated.Within thewindingcavernsoftheCirelIornadhandat certain conjunctions of the heavens his dreamings even physically manifested themselves. Wyrms dwelt here and the Olve shunned the Dragonshead as a place of dragons, nightmares and madness. At the heart of the Gyre, they uncovered the Guronn Nur the Hideous Idol believed to be made from the Slumbering Gods dreamings made material. So terrible was the Idol that is was saidthattheverysightofitalonecoulddrivea manintoaninsanehomicidalrage. However the Ial Iorneh was, in that time, the realm of Great Wyrms, the Childern of Tiamat, and Weaver of the Slumbering Ones nightmares and guardians of the Gyre. They came upon the Mystics and made a bargain with them. The Wyrms would teach the Ur to use the powers of the Idol (for though the WyrmsknewfromtheirMistresstheworkings of the Gurron Nur they could not touch it withoutbeingdriveninsaneorbeingkilledin the process). The Ur in return would use the powersoftheIdoltounitetheFlannaeagainst the Dwur and Noniz who waged war on the Wyrmsforcontrolofthehillsandtheirwealth. UsingthepoweroftheIdol,theUrFlannae brought the other Flan tribes beneath their dominion and founded Caerdiralor (called by sages in the modern era the Obsidian Kingdom) to rule the Dragons Head, worshipping the Wyrms and Tiamat as gods. They made war on the Dwur Kingdom and theirNonizalliestotheeast. YetwhiletheGuronnNurhadbeenusedin the worship of Tiamat, it was of He Who Slumbers Yet and it slowly corrupted the PriestsofCaerdiralorsendingthemvisionsof greatness in their sleep and whispering thoughtsofrebellionintheirwakinghours.So itwasthattherulersoftheObsidianKingdom sought to construct a weapon to harness the powers of the Cirel Iornadh and enslave the WyrmsusingtheIdol. However, the Wyrms discovering almost too late what was occurring and struck to prevent the completion of the ritual. In the battle that followed, the magi of Caerdiralor lost control of the dreamings and Myrsyrna
32
the Obsidian City (called Miirezuur by the Dwur) was destroyed along with the seven eldestandmostpowerfuloftheGreatWyrms of the Dragons Head. The Guronn Nur was shattered into five fragments. Each fragment seemed to manifest the powers of one of the headsof Tiamat fire, cold, corrosion, poison andlightningandtheywerethereforecalled thePentarchofTiamat. InthefollowingchaosthesubservientFlan tribes rebelled and the Dwur pressed home their war against the remaining Wyrms who wereweakenedbythelossoftheirelders.The Five Fragments of the Guronn Nur were scattered and lost and the Great Wyrms were one by one slain by the great heroes of the Dwur. The red fragment of the idol is in the depths of the Tal Marith, the green fragment lies within the Headlands, the blue fragment within the ruins of Unaagh within the Bright Desert, while the icy white fragment may be foundintheAerdifortressofIcespireandthe corrosiveblackfragmentishiddenontheIsle ofBones. ThesurvivingUrofCaerdiralorwereeither slain by the vengeful Dwur, their rebellious subjectsorfledacrosstheseatothelandmen now call the Bright Desert. There their descendants would in later years come to foundtheKingdomofSulmwhichinturnfell when it delved too deeply into the secrets of itsforefathers. TheHighPriestoftheGalaiIornisselected from among the tribe by being summoned in dream into the Gyre and then surviving the ordeal of passing though into its heart. There hereceivesenlightenment. Ironically while the Galai Iorn claim to worship Tiamat, the visions that their priests receive are undoubtedly from the Dreamings of the Slumbering One. Through these visions hascomeaprophecyforetellingthecomingof a golden haired Prophet who shall uncover and reunite the five fragments of the Guronn NurandrestorethegreatnessofCaerdiralor.
A Gazetteer of Onnwal
admitted into any of the Citadels, even Sarakast. The three citadels boast a fiercely honourable warrior caste dedicated to Clangeddin Silverbeard. Typically comprised of warriors proficient in the axe or hammer, the Warriors of the Citadels or Khadaarzhel boast members of the fierce priesthood of Clangeddinmanyofwhomserveasadvisorsto theircommanders. Nerakern: This citadel of 3,000 dwarves is ruled by a Council of Elders, but used to be a theocracy ruled by priests of Moradin. It standsonasmallplateauintheHeadlands;its four great towers dominate the skyline. As withmostotherDwursettlementsmostofitis actually underground. Many of the walls are decorated with great stone carvings of the Dwur pantheon, although Fortubo is a prominent absentee. It is built across two great bridges spanning the River Nera (Silverstream). Religion is a very important part of life in Neraken with the priestsof Moradin ruling in allbutname.ThecurrentThegn,Vorakaar(LN male dwarf Ari6) is a virtual puppet to the charismatic and powerful dwur cleric Morathuann(LNmaledwarfClr18Moradin). Morathuanns advanced age has brought with it xenophobia and he councils Vorakaar that the war against the Scarlet Brotherhood is strictlyahumanaffairandthatnodwurblood shouldbeshed. Sarakast: This is the newest of the citadels with only 2,500 doughty dwur beneath its spiresandparapets.ThegnDorinuur(LGmale dwarf Ftr8) is relatively liberal and delegates external relations to a council of merchants, some of whom are in negotiations with the priesthood of Zilchus. Sarakast is thought to controlmanyofthepassagesandcavernsthat traversetheHeadlandsfulllength. Vergannin: This is the most isolated of the three citadels and is famed for its mighty warriors and skilful smiths. Now, however, thecitadelhasfallenonhardtimeswithmany of its mines being played out. Many of its population are exploring portions of UnderOerthtolocatenewsourcesofprecious metals and gems leaving only 2,200 dwur in thecitadel.ThegnVorengund(NGmalehuman dwarf Ftr7/Exp5) is a doughty warrior and among his expert craftsmen there are links withtheArtificersUnioninIrongate.
TheDwarvenCitadels
Dwarvish civilisation in the Headlands is centredaroundthreemaincitadels:Nerakern, SarakastandVerganin.Eachofthecitadelsis undergroundaccessiblethroughasystemof tunnels, bridges and even in the case of Nerakern ornate ledges moved along via a winch and pully system whose operation is knownonlytothepriesthoodofMoradin.Itis therefore very rare for lowlanders to be
33
Thischapterdetailssomeofthepersonagesof notewithinOnnwal,focusingmainlyonthose who are part of the Free Onnwal movement and the main leaders of the Scarlet Brotherhood.
Personages of Onnwal
Milosisrumouredtobebetrothedto).Thereis a certain degree of tension between Baernen andMilosinparticular,asunlikeMilosheisa supporter of Duke Gellen for the position of GlaiveSuperior. BarundLaramore,LordChamberlainofthe Free State of Onnwal, High Trade Priest of Zlichus (LG male human Clr15 Zilchus): Zilchuss most senior representative in Onnwal is a Marchlander born and bred. As such, he is an Oerid, with olive skin, short brown hair beginning to turn white at the temples and hooded greygreen eyes. His square jaw is bearded and he is long of limb. Were it not for his slight build, Laramore mightpassforoneofthegrimfacedwarriors that garrison the capital of the Free State. As befits his status, the High Tradepriest wears gleaming white robes of the finest cloth, trimmedwithgoldembroidery. Unlike many of his faith however, Laramore avoids ostentatious displays of wealth, wearing only a platinum signet ring upon his right hand and the holy purse of his mastercastingoldintermsofjewelry.This,he says, is to show solidarity with the many Onnwalons who have been left destitute by war and occupation. Though this appears at facevaluetobeashrewdpoliticalgesture,the sentimentisheartfelt. When Duke Coriell was forced to abandon Killdeerin584CY,Laramore,thenmerelythe headofthetempleinthetown,fledtoIrongate and from thence, at great risk to himself, to Nyrond. There he was one of the first to rally toJianDestronscourtinexileinNessermouth. Laramoreisabornadministratorandheputs his skills to good use in his role as Lord ChamberlaininrebuildingOnnwalsshattered fortunes. Shrewd and skillful in the arts of stateandcommerce,itiswellknownthatthe szek values the High Tradepriests counsel. Contrary to the popular stereotype of the grasping Zilchan, he believes firmly in the doctrine of propriety and has no truck with anywhoplaceavaricebeforevirtue. Carthen Relaster, SeaEagle of Sornhill (LN male humanFtr5):InhislatethirtiesCarthen isahandsomemanwithshortblondehairand alithestep.Tallandbroadshoulderedhehas surprising quickness. Lord Carthan dresses in a wellmade tunic, trews and a short cape. Across his chest is an azure sash, upon which is pinned a golden pendant in the form of a bird of prey diving to strike the insignia of
Ared Yor (Uncle Yor), Assassin of the Scarlet Brotherhood (LE male human Rog3/Mnk3/Asn10): Ared Yor has no fixed appearance,takinganydesiredappearanceby wizardry.Hispreferredformisthatofayoung Suel man with short blond hair cropped in a militaristicfashion. Yor is the Brotherhood assassin who infiltrated Szek Elwerds court and slew him duringthefallofOnnwal.Heisregardedasthe most powerful of the Scarlet Brotherhoods assassinsandisasabogeymantochildrenin FreeOnnwal.HeisafollowerofPyremiushis rarelyemployedsignaturekillistoreducehis victimstoashortoleaveashatthesceneofa murder and a member of the Brass Daggers faction. He considers Kuryanie weak and is awaiting the nod to eliminate her. His own deathwouldboostmoraleinFreeOnnwaland earnthegratitudeofJianDestronhimself! Baernan Coriell, Duke of the Eastern Marchlands (LG male human Ftr4/Wiz9): Dark tanned skin and tall at 6 ft. Baernan Coriell is entering his 50s and has short greyinghairthathetiesneatlyintoaponytail. His gaze is inscrutable and intelligent. He is trainedasawarriorwizardandthuscarriesa spearthatdoublesashiswizardsstaff. Baernan is the only surviving duke and is therefore its most senior statesman. He therefore daily presses the cause of the Free State in Irongate to Cobb Darg and Elayne Mystica. He is often accompanied by his elite dwur bodyguards that were responsible for him surviving the knives of the Scarlet Brotherhood. Baernan Keldas, Glaive Valorous of Azharadian (LG male human Ftr7/Glaive of Azharadian4):Builtlikeanoxandat6ft.6in., Baernen appears to be the mightiest of the surviving Glaives. Coming from the Fallnos Vale, Baernen speaks with what others jokingly call a country accent, something that was a source of amusement to the other Glaives, many of whom considered him a fool for his rural upbringing. This is not the case, Baernen possesses a keen wit, which often disarmsunsuspectingconversationalists. He is brother to Baron Joren Kelldas (who is in turn father of Natalia Kelldas, whom Sir
34
officeofaSeaEagleoneofOnnwal'sadmirals ofthefleet. Carthen is an expert strategist but recognises he ascended to SeaEagle far too quickly due to the loss of his superiors. Cautious,hepreferstodelegatethedaytoday affairstoHazarazSkullsplitterleavinghimfree toplanSornhillsnavaldefence.
Personages of Onnwal
unknown what Celendrenn thinks of such stories,buttrheiscertainlynotonetoemerge from the shadows in which he has cloaked himselftoconfirmorrefutethem. Danvirius Soron, Leader of the Breakers Warcompany (LG male human Ftr12): Danvirius Soron is an exceptionally heavily builtmanstanding6andahalffeettall.Heis an extremely strong, charismatic, and skilled warrior, Danvirius is the leader of The Breakers, a WarCompanyofsomereknown.Afollowerof Heironeous,hispreferredweaponisthebroad sword. Danvirius is a focussed, but chivilrous opponent, being generous in victory and gracious in defeat. With the success of his company he is the toast of the nobility in Onnwal. DerlGalathrena,HeadofHouseGalathrena, theBlackHoodsandtheSpurnedCircle(LE malehumanRog9):At5ft.3in.Derlappearsa shrunken and withered old merchant within Longbridge. He is in fact the only survivor of the original leadership of the Wreckers, an ardent worshipper of Kurell. He is dying of a sickness of the lungs and lives tenuously through his daughter Helana, who he has trained to bethe instrument of his vengeance on Rakehell Chert. Derl is a godfather figure within Longbridge. Few these days get audiences with him, instead dealing through Helana. He has little realisation that his daughter has little time for his lawful and calculatedrunningoftheircriminalassets. Ellinka Vanir, Member of the Breakers Warcompany (LGfemalehumanFtr12): This womanisdressedinwellmaintainedstudded leather and wears her long brown hair in a tarred ponytail. A strong willed woman, Ellinkahasthephysicalstrengthtomatchher devotiontoHeironeousandthatofherpartner in the Breakers Danvirius Soron. A former marineinOnnwal,sheisfiercelypatrioticand favoursfightingwithswordanddagger. Gellen Cadwale, Duke of Longbridge and Glaive Virtuous of Azharadian (LG male human Pal6/Glaive of Azharadian7): Of medium build and 5 ft. 9 in. Gellen Cadwale appearstohaveagedbeyondhis42years.His steely grey hair is subtly whitening, and his browisnowfurrowed.Gellenscountenanceis alwaysseriousnowandhisgreyeyesseemto stare into the distance to the outward observer he seems to bear the mark of one
Cathera of Ogburg, Palish Missionary (LN femalehumanClr6Pholtus):Catheraisinher early 20s and has olive skin and long meticulously combed hair. She travelled from Ogburg to fight against the Brotherhood and even converted Shining Paragon Purcennd Kerondastotheharshandintolerantdoctrines of the Pale. He is not her only convert with her charismatic firebrand preaching, Cathera haswonmanyheartsespeciallyamongthose whowereenslavedbytheBrotherhood. Celendrenn (NG male human Wiz6/Mindbender10): The name Celendrenn isonethatoccasionallyturnsupinatalltalein the keghouses of Onnwal. Thought to be a nativeofScant,Celendrennwasknownbefore the Greyhawk Wars to be a talented mage in the service of Fraznier of Halmarn, the alias used by the archmage Bigby. During his time in Bigbys service, he is believed to have shownaparticularaptitudeformindeffecting magic, one seemingly encouraged by his master. Celendrenn frequently acted as a messenger for Bigby throughout the lands of theIronLeague.Itissuspectedthatduringthis time, he made contact with an organization know as the Jade Mask. Celendrenn also attended meetings of the Greenleaf Society, a small informal group of Onnwalon magi who occasionally gathered in Bigbys villa in HalmarnontheoutskirtsofScant. When Bigby was forced to flee Onnwal during the Scarlet Brotherhood invasion, Celendrenn remained behind and went into hiding. Firm knowledge of his movements sincethattimeispatchyatbest.Heisthought to have spent some time in Irongate, before returning to Onnwal. Given his secretive nature, no clear account of his physical appearance exists. Popular rumor has it that he is Jian Destrons master of spies. More sagaciousobserversasserthemustbeasenior memberoftheJadeMask.Someclaimheisno morethanoneofthemyriadguisesofRakehell Chert, guild master of the Wreckers, while others claim the exact opposite: that Chert is no more than a mask for Celendrenn. It is
35
Personages of Onnwal
havingnotutteredthelanguageinyears.Heis very concerned for the future of his people withincreasedincursionsbythebloodthirsty Talamendestribe. Halrend Lorendrenn, Baron of Dunheern and Glaive Valorous (LG male human Pal6/GlaiveofAzharadian5):Astriking6ft.3, of strong build and with prominent Oeridian features,Halrendhasthebearingandposture of a professional soldier, for which House Lorendrennhasastrongtradition.Indeedthe family crest bears a golden bolt, symbolising its dedication to the ideals of Heironeous and Azharadian. Halrend is no exception he fought with distinctioninIdeeduringtheGreyhawkWars. He is convinced that Gellen is a traitor to the Orderandrefusestoacknowledgehisclaimof authority. Though he agrees that the Order needs new blood, he opposes Gellens proposals, on grounds that it is a ploy to recruit more supporters and thus gain the leadership of the Order. The Glaives Martial Dorlan Maldrenn and Milos Faskel as well as the majority of the surviving Glaives Cohort supporthim. Halshas Geldrenn, Baron of Silvervale (LN malehumanFtr9):Physically,Halshasisshort, 5ft6in.butpowerfullybuilt.Ashockofshort redhairtopshislean,gauntfaceoutofwhich hisinquisitivegreyblueeyesseemtostudyall that are near him. He is a rather gruff sort of character,preferringactionstowords,though isabletoholdhisowninrhetoric. TheBaronofSilvervaleisaninfluentialand vocal member of the resistance. His holdings are rich in mineral wealth and as a result he was one of the wealthiest individuals in Onnwal before the fall. A skilled warrior and tactician, Geldrenn was badly injured during anattemptuponhislifeintheearlydaysofthe conquest. Surviving the attack (but baring a limp from this encounter), he retreated into the Headlands with his troops. He waged a savage guerrilla war against the scarlet invaders until he regained his ancestral lands duringtheBrewfestRebellion. Halshas is the epitome of the conservative nobility.Halshasleadsthenobleparty,backing the traditions of Onnwal against the corrosive forces of the Wreckers and other chaotic groups, such as the Church of Trithereon. He views the more liberal nobles such as Duchess Saielma as naive and politically unwise. He firmly believes in the
who carries the fate of the world on its shoulders.Certainlyheclaimstocarrythefate of the Glaives of Azharadian, though his wearinessstemsfrommattersbeyondthat. Gellen was not born to wear the ducal coronet he was the second son of his generation and was groomed for the Order of the Golden Sun. While his career within the Order has in the past shown him to be a man of honour, his reputation may never recover fromthefactthatheboretherecallorderfrom IdeetotheOrdersBastionwithinScantwhere all but a handful of the Glaives were slaughtered. His loyalty is very much in question, in fact many wags still say that the occupation was the best thing that happened tohim.Thisviewdoeshavesomemerit.Gellen hasemergedfromtheOccupationasthemost seniorsurvivingknightoftheorder,andwith thedeathofhisbrotherDukeAnsendandhis heirs, as duke of the Azure Coast. Gellen is deeply concerned that the Order is on the verge of extinction and proposes that the conditions for membership be extended to commonerstobolsternumbers. Gwallam, Riadh of the Dumanonii (N male human Ftr4): Gwallam is a thin, weathered man whose body is covered in green tattoos. He wears numerous teeth and bones of his foes, offsetting his blue eyes and red hair. He appears particularly anxious, his eyes darting wildly. Gwallamviewslowlandersassomethingof an oddity and he speaks common slowly,
36
traditions of the old regime in Onnwal and is opposedtochangecertainthatitwilldestroy Onnwal.HehatestheAhlissansasmuchashe hates the Scarlet Brotherhood. Halshas also hasnotimeforthosethataredisrespectful.
Personages of Onnwal
Harnashir Relaster, BaronClaimant to Norland (LN male human Ftr6/Clr1 Pholtus):Harnashirisanimposinglytall6ft4 in. gaunt figure with his blonde hair sheared offtotonedownhisSuloiseheritage.Hehasa dark look about his eyes, and everything he says is with an intense and measured solemnity. Some feel uncomfortable when talkingtohimforawhile,asifthereisadark edgeofmenaceabouteverythinghedoesand says. He claims to be the son of the old Dukes sister, and has spent the last four years wandering the Flanaess under various guises. As cousin to Garamon and the Duchess if his claim can be proved, his claim is almost certainlythestrongestofthethree. Harnashir never drinks alcohol, and demands utter loyalty from his followers and subordinates. Devoted completely to Pholtus (somewouldsaywiththezealofaconvert)he considersMilosasorcererandjumpedupuser offoulmagics,aswellasadespicablecoward. Wallachethinksofhimasathief.Hishostility toward Carbani who he sees as an insolent shopkeeper, is thinly veiled, though he is in fact far cleverer than some see him to be and icily sane. Harnashir comes across as unbending, forthright and utterly unforgiving andhehasthebackingofPurcenndKerondas andCatheraofOgburg. Hazaraz Skullsplitter (LN male human Ftr7/Rng2): In his mid fifties he is still physically imposing. Graying short hair frame aweatherbeatenface.Hiseyeshavetheairof intelligence and are light gray in color. He limps slightly and is never seen without a broadsword the preferred weapon of the marinesbeltedtohiship.Hewillbecladin battered but serviceable studded leather armor. A grizzled old veteran of the marines and the Captain of the former dukes personal guard, Hazaraz is probably one of the most experienced members of the rebel armed forces.HehasservedOnnwalforover30years andasaconsequenceisamastertacticianand strategist. Named the "Skullsplitter" due to his skill withtheswordinhisyouthhewasafearsome
combatant but a wound sustained during the defence of Stormhaven has affected his mobility somewhat. Named by Saielma as the First Protector of Sornhill Hazaraz is ultimately in charge of all aspects of Sornhills defence. Rumors are currently circulating throughout the Storm Coast of a romantic relationshipbetweenthegrizzledwarriorand the duchess. He is fanatically loyal to the Relasters which is just as well as he knows their darkest secrets. His father had been a trusted servant of Duke Kosrel and had, like hismaster,colludedwiththeslavers.Hazeraz onlydiscoveredthiswhenhisfatherconfessed it to him on his deathbed, after Duke Kosrel's death. Knowing Kosrel's son to be a man of honour, Hazeraz kept the sins of his father to himself, lest one man's wrongs destroy the entireGreatHouseofRelaster.Heiswillingto gotoanylengthtokeepthissecret. Helana Galathrena, Heir to the Merchant HouseofGalathrenaandChiefBladeofthe Black Hoods (CE female human Rog6/Asn2): Statuesque at 5 ft. 7 inches and slim with her strawberry blond hair Helana maintains the perfect facade of the dutiful merchants daughter.Sheisoneofthemosteligibleladies in Longbridge and won the Pearl of Longbridgefestivalbeforetheoccupation. Helana was raised by a hateful father who has little idea how insane and psychotic she has become. By day she attends events and sponsors public works in Longbridge but by nightshestalksthestreetslookingfortargets toeliminate.Forinstanceitisnosurprisethat opposing merchants holdings have suffered arson attacks blamed on the Scarlet Brotherhood. She also dabbles in fiend summoningwithsomeofhercircleoffriends.
37
Personages of Onnwal
KekaravMadi,FormerKeshofSornhill(NE male human ExMnk2/Clr12 Tharizdun): Madi stands a shade under six feet in height andisofaveragebuild.Hewearshislongred hair tied back in a ponytail. His eyes are pale blue and seem disproportionately large and intense. It has been reliably reported that Kekerav is also particularly skilled with throwingdaggers.Indeedatleastonewitness reported him torturing a prisoner by hurling redhot daggers into nonvital parts of the unfortunate fellows body. Madi has also an unnaturalaffinityforpoison. TheformerKeshofSornhillwasrenowned as a Brotherhood hardliner during the Occupation. With the fall of his town to the Free State, he appears somehow to have escaped the wrath of Kuranyie. His exact whereabouts are unknown, however he is rumoured to have returned to the Volanots, intent on retaking what he sees as rightfully his. The last confirmed sighting of him in the flesh was aboard the Scarlet Death, as that warship fled Sornhill after the brief siege by FreeStateforces.LittleisknownofKekeravs personal abilities, although he is thought to wieldsomeformofclericalmagic,althoughhis patron deity is not known to the Rebellion. Kekerav was much feared by the resistance duetohisabilitytouncoverrebeloperatives. Madi is in fact a member of the Black Brotherhood, a subsect of the Scarlet Brotherhood that reveres Tharizdun. He is therefore drawn to both the Headlands and theTalMarith.HehasarivalrywithMaranefel Toktot as he wished to be Kesh of Scant but wasgivenSornhillinstead. Kuryanie,ExaltedSisterandShepherdand Keshkal of Onnwal (LE female human Mnk14): Typically Suloise in appearance, Kuryanie is said to stand 5 ft. 8 in. tall and is extremelyslender.Herskinisfair,hereyesare violet in hue and her short hair is golden blonde in colour. Known to be a fanatical follower of the doctrines of the Scarlet Sign, she is the person ultimately responsible for manyoftheatrocitiesheapeduponOnnwal.It wasshethatorderedtheburningofthirtyfour farmers in the Grand Market of Scant in Richfest 585 CY. One of the most reviled individualsinOnnwal,Kuranyieistherulerof what remains of the socalled Obedient State ofOnnwal. Brutal in her suppression of dissent, she has survived several attempts upon her own life. Little is known of her personal powers
Jian Destron, Szek of the Free State of Onnwal, Duke of Gilderond, Warden of the Gearnat and Azure Seas (LN male human Ftr8): Broadshouldered Jian stands just less than6ft.tall.AtypicalOnnwalon,hiseyesare greyandhishairauburnincolour.Hisslightly bearded face is heavily freckled due to his exposure to the sun. Jian is thought to move about the Free State in disguise bothtoavoid the daggers of Brotherhood assassins and to oversee the war. He has survived several attempts on his life by close associates and is nowdistrustfulofthosenewtohim. Duetothismistrust,someconsiderJianto be a harsh man, but they forget he carries a heavy burden upon his young shoulders. Behind closed doors Destron is a different man. His severe public mask is replaced by genuine affection for his kin and country. A man of almost 30 summers, Jian is already a seasoned warrior and tactician. He was groomedforthelifeofanavalofficerfroman early age and indications show that he has inherited his fathers military acumen and tactical planning. He dearly wishes to see his fathers murder avenged and his country free again. Jian has never proven to be suited for the path of the diplomat or scholar, he prefers to leave matters other than military studies to a small circle of trusted advisors. He routinely has to deal with the protests of his surviving dukes and barons, who are incensed by the level of power he has invested in his ally RakehellChert.However,thenobilityremains loyaltotheonemantheyknowwhocanhold togetherOnnwalsdisparatefactions.
38
Personages of Onnwal
and extremely slender, the kesh possesses pencilthin eyebrows and tight bloodless lips. Thosewhohavestaredintohisdeepblueeyes report a complete lack of emotion there. His hair is straight and yellow of hue, while his skin is the colour of dried parchment. Maranefel is rumoured to be a spell caster of no small skill. Some who have witnessed his anger(andsurvived)whisperthathecouldbe theequalofBigbyhimself. Maranefel Toktot is perhaps one of the most hated members of the Brotherhood in Scant, but paradoxically could become one of their greatest allies. A member of the HomelandNobilityfactionhebelievesthatthe Brotherhood should be ruled by nobles and notmonks.Tothisendhe hasdevelopedthe following scheme: if Scant and Onnwal could be lost to the rebels he believes that Korenth Zans position, as leader of the Brotherhood would become untenable. In the following chaos he plans to depose the Father of Obedienceandgainpowerforhimself. Milos Faskel, Glaive Martial of Azharadian (LGmalehumanPal6/GlaiveofAzharadian1): Thisyoungmanof25isquiteadashingfigure of chivalry with his curly blond hair and 5 ft. 11 build. The youngest of the surviving knights, what Milos lacks in battletactics and experience he makes up for with enthusiasm andenergy. SirMilosisthesonofLordKalderonandis rumoured to be romantically involved with Natalia Keldas. Indeed House Keldas and House Faskel have grown close since the occupation, having combined forces to elude theScarletBrotherhood. Milos Relaster, Baron of Saltirn, Mage of Renown(NmalehumanWiz10):Anassociate of Bigbyanda mage above all else Milos is of mediumheight,slightandgrayinginthebeard and at the temples looking lined and careworn. Milos for the most part is haughty and aloof, maintaining a small tower in Greenfalls he occasionally frequents. As a fellow mage, Milos was close to the old Baron of Norland, Garamon,andthethoughtofanothertrawling through his collection of lore in his tower on NorlandPointisabhorrenttohim.Hehasbeen aggravating Carbani for months to make a decision and considers the Provost to be delayingaslongashecanjusttoclingontothe power. Milos is a powerful man and would make an excellent patron of aspiring magic users.
although she is thought to control powerful protective magic. It was these dweomers that allowedhertosurviveanattemptonherlifein 586 CY that slew over a dozen of her Herdsmen. Her current fate and whereabouts are unknown, as she has not been seen in publicnowforseveralyears. Lyndern, PriestCommander of Osprems Light(LGfemalehumanFtr4/Clr6Osprem): Lyndern proudly wears the tabard of the breaking wave of the Storm Coast. She is muddyblonde,blueeyed,andquitetallat5ft. 11. and a powerful warriorpriestess of Osprem. As the priestcommander of the Light she believes that ultimately the responsibility for failure or success is upon her shoulders. This makeshercold,detachedfromtherestofher men,asshehasletherguarddowninthepast andbetrayalandtragedyhaveensued. Maranefel Toktot, Kesh of Scant (NE male human Wiz16+): Known as the Butcher of Scant, Maranefel is said to carry out Sister Kuryanies instructions with barely contained glee. A highly intelligent individual, many believehimtobeslightlyunhinged,suchisthe depth of this mans ability to inflict pain and suffering upon his victims. Maranefel has surroundedhimselfwithagroupoffanatically loyal hochebi warriors of above average skill. He never leaves Scant, dwelling in a clifftop tower thought to once belong to Bigby. Tall
39
Mortigasus, Riadh of the Ventonii (LN male humanRng6):Mortigasusisastrikingandtall man with bronze skin and dark brown hair covered in ornamental blue tattoos and wearing gold and silver torcs, bracelets and circlets.Hewearstheheaddressofamountain lion,andthestandardkiltofaHeadlander. Heisanaloofandproudman,notgivento lowering himself to speak to lowlanders in common. Paradd Carbani, Provost of Norland (LG male human Ari2/Exp2): A prominent merchant family based in Scant before the Wars,theCarbanisareoriginallyfromBluein the Pomarj. Driven from their home by the invading orcs they found safe haven in Scant, the refugees banded together with what resources they had, sealing their pact with intermarriage, forging the group into one united family. Through much hard work and effort, the Carbani's regained much of their lostwealthandestablishedthemselvesasone of the richest merchant families in Scant. However, they never forgot their lost homeland and have been unwavering foes of the orcs and pirates of Blue and the Pomarj ever since. They have repeatedly urged the SzeksofOnnwaltosendtheirforcestoreclaim Blue for decent humanity and to cleanse the Pomarj of the orcish filth, which pollutes it. Led by Tygeld Carbani, they escaped to Nessermouth in Nyrond. Tygeld has used this money to purchase two other vessels, which hehasloanedtoJianDestrontoferrysupplies from Nyrond to Killdeer. Though it is not known for certain what conditions apply to these loans, it is speculated that Destron has had to make promises to strike against Blue and the Pomarj, after Onnwal has been liberated. Paraddisfairlyshort,andhisfigureslight, with a prematurely receding dark blonde hairline. In his late twenties Paradd is well educated, clever and fiercely dutiful, however hequestionshisabilitytohandlethesituation inNorland. He looks harried and almost broken at timesanalmostcompletelydifferentmanto the jovial, youthful scholar appointed a year ago.Thethoughtofgivingup,however,would be abhorrent to him and he does the best he can. He has become completely convinced that oneoftheclaimantsissuchatraitor,andheif he makes a mistake in his arbitration he will bearitslegacyfortherestofhislife,whichhe
Personages of Onnwal
suspects may not be long. He still remains forceful,emphaticandsomewhatimperiousin hisoutwardappearancehowever.Hedespises disloyalty,lawlessnessanddisrespectheartily, along with a passionate hatred of all of euroz kindsincetheydrovehisfamilyfromBlue. PurcenndKerondas,HighPriestofPholtus (LN male human Clr10): Clad in white robes with his dark brown hair shaved off entirely thetallpriestseemstofillanyroomheispart of,evenbeforeheresortstousinghisdeepand eloquentvoicetodenounceanyinequity. The Shining Paragon of Pholtus witnessed the deaths of many of his colleagues and his mentorduringthefallofOnnwal.Inresponse he has turned wholeheartedly towards the intolerant teachings of the Theocracy of the Pale,andbeguntostructurethepriesthoodin asuitablymartialmanner. JianhasnotyetappointedaPrimeforFree Onnwal yet, but Purcennd is encouraging him to do so. Purcennd is appalled by the power which criminals such as Chert and the Wreckershaveandthedeferenceshownthem byJian.Purcenndhasspokenofthedangerof OnnwalbecomingabanditstateandChertand many of the Wreckers are known to hate the Shining Paragon almost as much as the Brotherhood. Rakehell Chert, Lord Marshal of Onnwal, TheWrecker(NmalehumanRog18+):Chert istheguildmasteroftheWreckers(thename giventoOnnwalsthievesguild)andaformer adventurer.Chertisnowoneofthetwomost influential men in the Free State of Onnwal. Hispersonalskillsaresaidtoborderuponthe superlative.Heissopuissantthatitissaidthat even the Circle of Eight has made use of his talents in the past. Chert has been given authority over the Army of the Rebellion by
40
the szek and has turned them into a flexible fightingforce.AprimetargetforBrotherhood assassins, only his old adventuring comrades know his true appearance and his current whereaboutsareunknown. TheexactappearanceofChertisdifficultto ascertain,forheisamasterofdisguises.Heis believedtobeadappermanof5ft.7in.,with shortcurlybrownhair.Chertisaneasygoing fellow, devoted to Olidmarra the Laughing Rogue.Heisonewhoprefersnonviolentand cunning solutions over brute force. He is said tohaveavastcollectionoftreasuresscattered throughout Onnwal, though again he prefers curiositemsoverthoseofrawpower. Ifawarcompanyweretorecoversomeof hislosttreasures(suchashisoldshortsword, the Silver Left) and mention it to him Chert wouldsimplyshrugandsmile.Hetendsnotto worry about such matters his finances shall last a considerable lifetime, and he is more concerned with liberating his adopted homeland. Rohal Soldas, Traitor of Sornhill (NE male human Rog3/Sor5): A native Onnwalon who sold himself to the Brotherhood, Soldas has become the most infamous traitor since the Wars began. Once the mayor of Sornhill he betrayed that town and its rulers into the handsoftheBrotherhood.Hisultimatefateis unknownalthoughrumoursflyingaroundthe town of Sornhill say he is either dead, or has returned to the area in the company of his masterKekeravMadi.Aslender,slightmanhe is nonetheless reknowned for his skill with a rapier. Although physically strong his true strengths are his speed, intelligence and good looks. His eyes are pale blue and his hair is that of a typical Onnwalon muddy blond. Slightly tanned he has a charming smile but keenobserverswillnotethatthissmilenever reaches his eyes. His capture or the confirmation of his ultimate fate would do much to improve the morale of the defenders ofSornhill.
Personages of Onnwal
Saielma Relaster, Duchess of the Storm Coast(NG (N) female human Ari3/Sor4): The famed White Rose of Sornhill is so named for her pallid complexion, long platinumblonde hair and pale, violet eyes. Barely 25 years of age, Saielma is reputed to resemble her ancientancestor,Lindera,theWhiteWitchand Suel wife of the first dukeofthe StormCoast. The duchess is short of stature and slight of build. However, though she appears frail, Saielmaisknowntobestrongofwillalso.
The second youngest child of the duke of theStormCoastthemurderofSailemasfather and elder brothers just prior to the liberation of Sornhill in 590 CY thrust her forward onto the stage of history. The duchess is still only coming to terms with the responsibilities of her unexpected role. She relies heavily on the adviceofHazarazSkullsplitter,FirstProtector of Sornhill. The two share a very close relationship, some say akin to that between father and daughter though a wealth of salacious gossip suggests it is far less blamelessincharacter. Saielma is regarded as one of the more liberal nobles in Onnwal. This has led to barbedcommentsaboutheryouthfulnaivety amongthenobility.Ifreportsofthistalkreach her ears, the duchess appears to pay them no mind. Tarnedas, Prophet of the Gulls (NG male human exact classes unknown): Tarnedas is clad in a simple white robe. His hair is white andfallsunkemptabouthisshoulders.Linesof age and care mark his sunkissed face, yet there is a look of absolute peace and serenity in his intense blue eyes that touches any that lookuponhimtotheheartoftheirbeing. Tarnedas believes himself to be the messenger of Phaulkon on the Oerth and divines his Master's will from the calls of the birds around him whom he calls the ParliamentofBirds.Heisotherworldly,utterly serene, calm, unhurried, wise and detached. He seeks the destruction of the fragments of the Hideous Idol and its connection to Tharizdun.Howeverhespeakscrypticallyand rarely gives a direct answer, preferring often
41
to answer it by posing another question in return. Tarnedassexactcapabilitiesarelefttothe Dungeon Master. He could be an epic level clericormonkofPhaulkonorhecouldsimply beacharismaticcommoner.
Personages of Onnwal
was in order. He started with his own father, theagingBaronofGrovehill. A faked order was sent to those Tiren felt could not be swayed under his cause. The remainingGlaivesweretobetheyoungorthe malleable. Unfortunately he did not count on the valiant Sir Halrend being caught behind enemylineswithinNaerie,orforhisdupe,the Glaive Virtuous Gellen Cadwale, to have collapsed from exhaustion after having delivered the nowinfamous message that luredsomanyGlaivestotheirdeathinScant. Uthather Kais, Noted Magi of the Breakers (CGmalehalfelfWiz11Invoker):Uthatheris ahalfolveofabout50yearsofage.Slenderof frame, he wears his fiery red hair in a long mane falling to the middle of his back. He dresses in a haphazard fashion, with his clothes consisting more of inexpertly sewn patchesthantheoriginalcloth. A worshipper of Boccob and Trithereon, Uthather is tempestuous and unpredicatable characterandisnotlikelytotakedefeatwell. A halfelf Invoker, Uthather is almost as wild as his human colleagues in the Breakers are lawful.AworshiperofBoccobheisstartingto turntoTrithereoninhisaspectasaliberator. Wallac Relaster, Claimant to the Barony of Norland(CNmalehumanRog5): n his early I forties, but looking much younger, Wallac usually cuts an extremely dashing looking figure,withhisflowingblondehairandcatlike elegance. Tall and broad shouldered despite his startling quickness he possesses the languid manner of a noble born man who greatlyenjoyslifeanditspleasures,buthasa keen and sharp wit, as well as a shrewd understandingofreality. He seems to have nothing whatsoever of the sense of snobbery or aloofness of many nobles. Wallac considers himself a manofthe common people, and of the future. He has ambitionsbeyondbecomingBaronofNorland ortheDukeoftheStormCoastoneday.Wallac has heard whisperings of his potential glory from Ahlissan agents (these same agents arrangedforGaramonRelasterdisappear)and hehopestocoaxthemintothewarontheFree StatessideevenifitmeansheisaPrinceof Onnwalinsteadofadukeorbaron.Heiswell likedintheStormCoastandhasconsiderable influence with the Wreckers in the Storm Coast, being one of their number.
Telek Senh, Head of the Office of Faith in Onnwal (LE male human Clr16 Wee Jas): TelekSenhisanelderly6ft.1in.tallballman clad in scarlet robes. He often emblazons his head with the sigil of Wee Jas and favours a replicaoftheSuelstaffoflaw. SenhhatesallnonSuelfaithsandseesitas his duty to convert all to the true faiths. He personally oversaw the reeducation of captured Onnwal priests of Suel faiths and is skilled at enchantment and mind control. He blames Kuryanie for the loss of most of Onnwal and has petitioned the Father of Obedience for more troops and for the removaloftheExaltedSister. Tiren Farness, Glaive Virtuous of Azharadian, ScholarKnight and Traitor of theOrderoftheGoldenSun(LEmalehuman Ftr6+): A dapper man of 5 ft 7 Tiren is the most unassuming of the knights. Aged 41, Tirens greying hair, lean figure and pale complexiondonotpresentthetypicalfigureof awarrior.Whilehecaneasilyholdhisownin battle, Tiren views himself as more of a scholarknight, a student of Azhadarians originalcampaigns.Hisknowledgeoftacticsis unsurpassed amongst the surviving knights, andearnedhimtherankofGlaiveVirtuous.He is a staunch supporter of Gellen Cadwale. There is also the small matter of Tiren being responsibleforthebetrayaloftheOrderofthe GoldenSun... Tiren Farness was forced into the knighthood by his father. He ascended the rankstoGlaiveVirtuous;thiswasnotbywitof hismartialprowess,butratherhiscunningon andoffthefield.Hewasapoliticalnonentity and rallied around such heroes as Sir Gellen CadwaleorSirHalrendLorenndren. Before the Greyhawk Wars an advisor to Tirens father approached him. Cunning, subterfugeandtacticswerevirtuestheScarlet ones admired over sheer martial prowess. Seeing how much emphasis on culture, learning and education the Scarlet Brotherhood possessed within their culture, Tiren was convinced that serving their cause was best for the Order, and that a cleansing
42
This chapter gives some hints and advice on developing adventures in the Onnwal region for home play. Onnwal is currently struggling throughsomemajorchangesandassuchithas the capability to support all kinds styles of play.
HackandSlash
As a country embroiled in a bloody rebellion Onnwal offers unparalleled opportunities for the player who enjoys hack and slash. Although largescale battles are at this time unknown the whole land is embroiled in a seriesofskirmishesandraidsdesignedtogive side the upper hand. Player characters can battle against the Brotherhood, their savage jungle warrior allies, Hochebi soldiery, the pirates of the Pomarj or possibly even the infamousslavers.Playerscouldbeinvolvedin any number of small defensive and offensive actions.
Roleplaying
As much a physical battle the Onnwalish rebellionisastruggleofwordsandideals.The rebel camp is made up of allies thrown together out of necessity. Warriors and soldiersofOnnwalrubshoulderswiththieves and smugglers while nobles fight alongside peasants and common folk. Many different priesthoods, all with their own agendas and belief systems, have lent their strength to the rebellion and although all these different factions have a common goal the defeat of the Scarlet Brotherhood and the liberation of Onnwal many of them cannot agree on a strategytoaccomplishthis. Manyinthemovementresentthefactthat Rakehell Chert, in their opinion is a common thiefnothingmore,enjoyssuchahighlevelof powerandrespectfromJianDestron.Intheir eyes there should be only one leader of the rebellionandthatshouldbetherightfulheirto the throne. Many agitate for this while the original members of the Wreckers point out that if it were not for them there would probably be no organised rebellion. Many of the thieves are extremely uncomfortable working so closely with soldiers, city guards and law enforcement types and have grave misgivings about allowing them accessed to the thieves many hidden bases and safe houses.Indeedmanyintheresistancesuspect theexistenceofanothernetworkofbasesand facilities even now being kept a secret from them.
AdventureThemes
Listed below can be found some general guidelinesonthethemesofadventuresuitable forOnnwal.Thisshouldnotbeconsideredan exhaustivelist.
StruggleagainsttheBrotherhood
This is the central theme of the campaign in Onnwal and as such offers almost limitless opportunitiesforadventure. Rescue: The Brotherhood has taken many hostagesduringtheiroccupation.Muchofthe hostagetakingoccurredwhenSisterKuranyie ordered the populace to give up one member of each family to ensure that noone else fled to Nyrond. What happened to these people? Where are they? Are they still alive? The Brotherhoodmaystillholdhostagesonalocal level and PCs could be hired, or ordered to retrievethem.
43
Hold at all costs: The Brotherhood has launchedasurpriseattackagainstsomeofthe rebels holdings and the players have been orderedtoholdthefortuntilreinforcements can arrive. An interesting variant on the traditional approach to adventuring this scenarios main events revolving around the PCs defending a position, fortification of dungeonandnotattackingit.
Attack! The players have been chosen to participateinanattackagainstaBrotherhood fortificationorstrongpoint.Challengeswould involve getting into the objective unseen and sabotaging vital defences or equipment. Alternatively they could participate in a full scaleattackdesignedtodrivetheBrotherhood fromoneoftheirenclavesbeyondthewallsof Scant. Spy Hunting: The PCs have been asked to observe and apprehend a suspected Brotherhood agent in a forward base on the storm Coast. PCs would have to observe the individual; and gain evidence of his true loyaltiesbeforeapprehendinghim. LegacyoftheBrotherhood:TheBrotherhood has not only tried to occupy the land of Onnwal, but also the minds of its people. The ScarletOneshavedrivenhomethedoctrineof the superiority of the Suel race using brainwashingaswellasmoresubtlemeansof social control. Even after the liberation, this ordealhasleftscarsonthepeopleofOnnwal. Those that collaborated are hunted down; those that suffered must try to rebuild their lives. Spies and traitors undoubtedly still lurk within Free Onnwal. The old social order and its certainties have been systematically destroyedandnooneissurewhatwillreplace it.Willitbemoblawwheremightmakesright, or will justice and civilisation prevail? The actions of the PCs will be central to the creationoftheneworderforgoodorforill. Suel Backlash: Many folk of Onnwal have begun to associate anything Suel with the Brotherhood. Thus certain Suel deities are beginning to see their worshipper numbers fall as well as a corresponding dip in their influence within the community. Those who also exhibit particularly Suel characteristics (such as a pallid complexion, blond hair and blue eyes) are also beginning to experience a risinglevelofabuseandhostility.
Onnwal contains additional sites designed to facilitate dungeon exploring. The Storm Coast hasmanygoodsitesforlowleveladventuring, including several Flan ruins. Consider the Cadwale Estates the Tunnelling Duke undoubtedly created an extensive dungeon complex. With its close proximity to Longbridgeitcouldmakeagoodsiteforlow level adventures to cut their teeth under the patronage of either Duke Cadwale, the mayor of Longbridge or even the legitimate front of theBlackHoods,theGalathrenas! Adventurers in Onnwal have traditionally been involving in check the ambitions of the South Province or battling against pirates on the Gearnat. These pursuits have left little time for the exploration of the network of tunnelsandpassagesthatarethoughttoexist under the peninsula. Several deep cavern complexes are thought to link with UnderOerth deep below the Headlands. The Dwur could have knowledge or records of these. Finally for highlevel campaigns the Tal Marith and the horrors of the Dreaming Gyre willdefinitelytestthesteel(andsanity)ofany adventuringgroup.
ExplorationtheSurface
Island Hopping: Although Onnwal has been settled for centuries comparatively little is known about the three island chains dotted aroundthecoastsofthepeninsula.PCscould beinstructedtosearchtheseislandseitherfor signs of Brotherhood activity or good anchoragessuitableforuseasrebelbases. Travel: Free Onnwal is desperately short of friends, or more precisely it is desperately short of friends who will support it with monies, equipment and troops. PCs would form part of a unit of specialists tasked to protectanimportantambassadorordiplomat ashetravelstoaforeignland.Suchamission would inevitably involve ocean travel and al theperilsassociatedwiththatpractise.
Dominion
After about 10 years and a day after the last verifiedsightingofscionofahouse,theclaim onthelandslapsesanditrevertstothecontrol oftheprovincialduketodisposeof. Putting lairds back in charge of all the cantreds is apriority to the nobles of Onnwal who are anxious to stem the authority of roguesandvagabonds.Thosewhosupportthe
DungeonDelving
44
szek through the wars want to be rewardedfortheirefforts.PCscouldbeonthe list and have to deal with protecting their holdings,andpossiblyunseatinganyWreckers orotherfreebootersthatmayholdswayover theirpopulace.Theymayalsorunintoconflict withotherheroesoftherebellion,suchasthe wealthyCarbani.
Wildcards
The Disappeared: Kuryanie took hostages to prevent people fleeing to Nyrond. If Scant is threatened she is prepared to sacrifice these hostages to create a force of 7,000 undead (zombies, ghouls and ghasts with higherlevel undead at the DMs discretion). The psychological trauma that this could cause FreeStateforcesisconsiderable. Obelstone:ItispossiblethattheBrotherhood could deploy some sort of freakish monster thatturnsthetideofthewar(forinstancethe Brotherhood has started deploying red skinnedtrollswhoareimmunetotheeffectof fire). It is also possible that the Brotherhood mighthaveanexperiment
DissensionwithintheRebel Camp
Religious Tensions: The rebel alliance includes within its ranks many individuals of differing religious denominations who frequentlyclashonavarietyofsubjects. The Class Divide: Peasant folk have been heardmutteringthatwhenthestruggleiswon the system of government of Onnwal should bemodifiedtogivethenormalfolkofOnnwal more rightsand privileges. The nobles ofthe realm are horrified by this implied erosion of theirhereditaryrights. Thieves vs. Merchants: The Wreckers are a core part of the rebellion. The merchants of the alliance are unhappy with having to work withthelowlifewhohavebeenresponsible for so much of their financial looses in the past. Petty thievery is also not unknown and several prominent merchants who have suppliedtherebellionhavecomplainedtoJian Destronabouttheirlosses.TheFellowshipof the Coin are thought to be particularly unhappyabouthavingtoworksocloselywith theirformerprey.
TheFreeState
Jian Destron is in overall command of Free Onnwal while Rakehell Chert has been given commandoftheremainsoftheRegularArmy and of the peasant Militias now collectively calledtheOnnwalonArmyofRebellion. Army Regulars: Chert has reformed the Regulars into Sertads (Companies) of ten warriorscommandedbyaSertern(Sergeant). Four Sertads, commanded by an Altern (Captain),combinetomakeaAltad(Column). Five Altads in turn make a Braetad (Brigade) ledbyaBraetern(Brigadier).TheBraeternof the Easter Marchlands are called The Watchmen" Eastern Marchlands and are commanded by Elwyrd Grinsharn (LN male human Ftr8). The Golden Heart represent Gilderond and is commanded by Farland Marshevel (LN male human Ftr9) while The Pearl Spears from the Azure Coast are led by TalgaraLarelann(LNfemalehumanFtr7)and The Cliffrunners of the Storm Coast are commanded by Braetern Verelan Halwyr (LG malehumanFtr7/Warmaster3). Generally made up of light to medium infantry, with a good proportion of crossbowmen or other missile troops these arelevels18fighters,warriorsandrangers. The Free State Navy and Marines: This consists of six warships and two converted merchantmenonloanfromtheCarbanis.Free Onnwal is desperately short of ships Longbridge is currently without a naval screen. In Killdeer the marines man all the ships of Free Onnwal's navy, with usual
ArmiesandLogistics
TheScarletBrotherhood
The standard Scarlet Brotherhood troops consistof(50%)hochebi(hobgoblins),(15%) Olman and (15%) Touv savages. Tilva Suel round out the forces acting as the officer classes, either as (10%) fighters or as (10%) monks.Savagesandhochebiareaccompanied by a Tilva Suel officer (a fighter of levels 15) in the field. This does not factor in of course unconventional monsters (constructs, trolls, giants and anything else) and experiments of theOfficeofSorcery.Thedeploymentofthese troopsiscurrentlyasfollows: Scant:5,000troops Halmarn:1,000troops Obelton:1,000troops Gullhaven:1,000troops
45
contingents numbering about 20. The remainder are used for garrison duty in the ports or training of new recruits (for which there has been no shortage of volunteers). These are warriors, fighters and rangers typically of levels 16 who favour the sword andlightarmoursuchasstuddedleather. Noble Contingents: The noble retinues that have not disbanded entirely have refused to recogniseRakehellChertastheircommander. They are mainly used for garrison duties in their native Cantreds. Their equipment is longsword, polearms or spears (sometimes masterwork)andtheyarecladinchainmailor better.Theyareoftenfightersoflevels15. Glaive Cohort: The Glaives are now only a shadow of their former strength and must be rallied by a charismatic leader. They are unsuited to the hit and run nature of the war beingwaged.TheGlaivesarefighters,paladin and clerics of levels 18, with the occasional cavalier. Wreckers:Gangsarestillinplaceacrossmost of Onnwal specialising in intelligence gathering, subterfuge, sabotage, and assassination. These are rogues, rangers and occasionallybardsandassassinsoflevels18. Militia:MostofOnnwal'sfightingstrengththe militia act in a defensive role protecting the local people from attack, at least until help arrives in the formofRegulars. Typically clad in leathers or rarely chain the militia wield sword, mace or spear and are warriors of levels13. ArmyRegulars:800mediuminfantry FreeStateNavy:1,500lightinfantry FreeStateMarines:300lightinfantry NobleContingents:400mediumcavalry GlaiveCohort:100heavycavalry Wreckers:900skirmishers Militia:6,000lightinfantry
WideningoftheConflict
Turrosh Mak and the Orcish Empire of the Pomarj: The Brotherhood is in negotiations withtheforcesofthePomarjforassistancein Onnwal. Turrosh Mak has had extensive contact with the Brotherhood in the past. He was one of the original Slavelords and even now heads the new Slavelord operation. He also controls Blue, the porttown from which thepiratestraditionalsail. TheHoldoftheSeaPrincesortheLordship of the Isles: The Brotherhood could also reassign troops from the Hold of the Sea Princes or Lordship of the Isles to Onnwal if Scantisthreatened.
PotentialAlliesoftheFreeState
TheUnitedKingdomofAhlissa:Ahlissa(the oldSouthProvinceoftheGreatKingdom)was the dominant force in Onnwalon politics. Almost without exception the Szeks ordained by the Herzogs were selfcentered opportunists who no interest in governing Onnwal fairly. When Onnwal won its freedom SouthProvinceembarkedonoveracenturyof warfare designed to bring its wayward provinceintotheimperialfold. Consequently much bad blood and suspicion exist on the Onnwalons part. However Overking Xavener, the current ruler of Ahlissa, views the Brotherhood as his realms most dangerous threat and could thereforeindirectlyassistOnnwal,makingita proxy in his efforts against the Brotherhood, spending gold to allow Onnwalons to shed theirbloodtokeepAhlissasafe.Hissecondary objective would be to also increase Ahlissas influence over Onnwal though economic and commercialmeans,undercuttingorabsorbing nativetradersandmakingthestatedependent on Ahlissan trade and gold. Ahlissa is an economic powerhouse and as such could dispatchenvoysoftheRoyalMerchantsGuild of Aerdy to open trade negotiations with the
PotentialIndigenousAllies
The following forces could join the war in responsetotheactionsofthePCs: The Headlanders: Negotiations are also continuing with the Ventonii and Dumanonii Flan of the Headlands to get them to join the conflict on the Rebel side. However promises of recognition of the Flan clain to the HeadlandsbyCherthaveinflamedtheNobles. The tribes could bring 600 troops, equipped withspearsandhidearmour.Thesewouldbe fighters,rangersanddruidsbetweenlevels1 5.
46
rebels. Elements within the Church of Zilchus areparticularlyvulnerabletomanipulationby Ahlissa as their church has suffered a decline in prestige and wealth thanks to the Brotherhood. Xavener knows his realm cannot afford to engage in the costly wars that ultimately destroyedtheGreatKingdom.Insteadheplans toconquerthoughcommercewhereacentury ofwarfarefailed.
Irongate: The Lord Mayor of Irongate now recognises Jian Destrons government but currently sends no troops to Onnwals aid. Irongate has its own problems but Darg will notstandidleifAhlissanambassadorsstartto winheartsandmindsinOnnwal. Nyrond: As a member of the Golden League and signatory of the Eastern Pact, Nyrond is still very much allied with the free portion of Onnwal. Jian Destron wintered in the port of NessermouthinsouthernNyrondafterthefall of his country and still has many friends who agitate for stronger support from Nyrond to assist him in his campaigns. Unfortunately, Nyrondhasmorepressingconcernsofitsown and cannot commit itself to any major programs of support. Elements of the Nyrondalfleetdohoweverassistrebelvessels whenever they can, although they are forbiddentoattackBrotherhoodships. Sunndi: Sunndis main attention is focused in two different directions: keeping an eye on Ahlissian imperialistic ambitions to the north andinguardingagainstBrotherhoodattempts to subvert their land from within (attempts that until now have been impressively unsuccessful). Hazendel (among other things) is a priest of Trithereon and he feels for his allies in the Iron League who are prisoners of the Brotherhood. Hazendel would most likely be receptive to overtures but with no port such troopswouldbeforcedtotravelthroughIdee, which is now part of the United Kingdom of Ahlissa.OverkingXavenerisunlikelytolethis former enemies traipse through his domains unlessthereissomethinginitforhim.
WarBegetsWar
Although recently wracked by war and strife the Oerth is the site of another larger and altogether more magical conflict. It is certain that the Flanaess will be plunged into bloody war again and this time the outcome will be decisive.Thisfinalstrugglewillnottakeplace for at least a decade as most nations were weakened by the Greyhawk Wars, and need timetorebuildtheirstrength. The Circle of Eight know a little of the existence of the Pentarch or the Dreaming Gyre on the shores of the Dragonshead throughBigbysexplorationsoftheTalMarith andhissurveysoftheHeadlands. The violence and bloodshed on the peninsula in the Greyhawk Wars and subsequentoccupationhasbeenjustsufficient toawakenthelatentenergiesoftheGyreand start it gently calling to the Pentarchs and to any nearby evil dragons. The power it would gainfromthesheerenormityofthenextGreat War would massively augment the Dreaming within the Headlands, perhaps validating Mordenkainens worry that the Brotherhood willinadvertentlyawakenTharizdunandeven
TheBiggerPicture
OfBigbyandtheCircleofEight
Many may wonder why such a powerful archmagewasforcedtoflee,andwhyhedidnt take a more active part in defending Scant
47
makinghimaccidentallyculpableintheendof the Oerth itself! In short DMs may take the view that the evil in the centre of the HeadlandsmustbedealtwithbeforeFlanaess plungedintothenextGreatWar. The PCs can have allies in this struggle agentsoftheCircleofEight,thenonevilFlan tribes and the loremasters of the noniz in the Headlands,andespeciallyTarnedasareviable options. Of all the allies Tarnedas knows the most about the Gyre although he is a poor mediumfordirectcommunicationwithPCs.
Liberation
What if in an extended military campaign Onnwal is freed? Wars of liberation are often succeeded by civil wars. In Onnwal the Office of Diplomacy, long anticipating the military defeat of the Office of Arms have been infiltrating new agents in Onnwal. If Jian is deadthenHalshasisthelegitimateheir.IfJian surviveshehasalwaysbeenabettersoldier thanaruler.Hehasledthearmiesandhasleft the governance to his ministers. His political savvyisnotthebest. TheStormCoasthasalargeSuelpopulace which by merit of their blood were not persecuted as badly as those of Oeridian descentbytheBrotherhood.Thiscouldleadto alotofresentment,andovertime,oppression
48