Autodock Tutorial Withoutpics Homology Model
Autodock Tutorial Withoutpics Homology Model
See discussions, stats, and author profiles for this publication at:
https://www.researchgate.net/publication/341830560
AutoDock Tutorial
Method · June 2020
DOI: 10.13140/RG.2.2.27339.21289
CITATIONS
0
READS
6,460
1 author:
Some of the authors of this publication are also working on these related projects:
The discovery of novel class IIa HDACs inhibitors View project
Molecular Genetics View project
Ammar Elmezayen
University of Texas Southwestern Medical Centre
At the start of this tutorial, all you need is a directory (e.g., “Docking”) which consists of two
files;
protein.pdb and ligand.mol2.
Steps:-
7. Load the pdbqt files of both the Protein and the Ligand.
• File –-> Read Molecule ---> model_fin.pdbqt
• For Gridding:-
◦ Select your molecule by:-
▪ Grid ---> Macromolecule ---> Choose ---> select the molecule:- ‘model_fin’
◦ Then choose your Ligand by:-
▪ Grid ---> Set map Types ---> Choose Ligand ---> select Ligand:- ‘lig1’
◦ Then make a box by:-
▪ Grid --- > Grid Box :- Will show a 3D differently coloured box around the
molecule. The adjustments to the box dimensions will be available in a menu
• Save the grid as a ‘Grid Parameter File’.
◦ Grid --- > Output --- > Save GPF --- > set the directory you want to save it in
and set the name:- model_fin_Grid
◦ Will create a file named model_fin_Grid.gpf
8. Now, we do Autodock:-
• Close the Grid adjustment menu after saving the gpf file.
• Run AutoGrid:-
◦ Run --- > Run Autogrid --- > Choose parameter filename:- ‘Browse’ next to
‘parameter filename’ --- > Select model_fin_Grid.gpf file as your parameter
file --- > A log file- .glg file, i.e. Grid Log file will automatically be saved --- >
‘Launch’
• Prepare files for docking:-
◦ For Protein:- Docking --- > Macromolecule --- > Set Rigid Filename --- >
select model_fin.pdbqt
◦ For Ligand:- Docking --- > Ligand --- > Choose --- > lig1
▪ Select ‘Ok’ on all the dialog boxes that pop up
◦ Docking --- > Search parameters --- > Genetic Algorithms --- > Accept
◦ Docking --- > Docking Parameters --- > Accept
◦ Docking --- > Output --- > Lamarckian (GA 4,2) --- > Enter the output filename
as:- model_lig1_parameter_output.dpf
◦ Run --- > Autodock --- > set Log Filename as :- model_lig1_docking.dlg --- >
set Cmd from :- autodock4 -p model_lig1_parameter_output.dpf -l & to
autodock4 -p model_lig1_parameter_output.dpf -l model_lig1_docking.dlg &
• Visualising all the models generated of the Ligand, by loading the protein --- >
Analyse --- > Dockings --- > Open --- > open the .dlg file . Then, we do:- Analyse
--- > conformations --- > ‘Play’ or ‘Play, ranked by energy’
• Open the model_lig1_docking.dlg file ---> look for the lowest energy. In the image
below, lowest energy is –6.6.8 of the Run 5, i.e docking model 5. So, we searched
‘Run=5’ copied the coordinates of MODEL 5 to text editor and saved it as a .pdb
file. (file named: model_fin_run5.pdb)
9. Now, we grid the Ligand around the lowest energy binding site, i.e. ‘run=5’.
• Load the Protein molecule. File --- > Read Molecule --- > choose model_fin.pdbqt
• Open the model_lig1_docking.dlg file.
◦ Analyse --- > Dockings --- > Open --- > choose model_lig1_docking.dlg
◦ Anaylse --- > Conformations --- > ‘Play, ranked by energy’
◦ Place the Ligand at Run=5, and then draw a grid around it:-
▪ Choose the Protein first:- Grid --- >Macromolecule --- > ‘model_fin’
▪ Choose the Ligand:- Grid --- > Set Map Types –- > Choose Ligand --- >
‘lig1’
10. To get the pdb output of the best Ligand conformation run Vina:
• Make a config.txt file to put all the grid box parameters in it and run command:
◦ vina –config config.txt –log vina_lig1.log –ligand lig1.pdbqt
▪ A log file and a lig1_out.pdbqt is generated
◦ Now get the pdb coordinates of the conformations using openbabel:
▪ obabel -ipdbqt lig1_out.pdbqt -opdb -O lig1_vina.pdb
◦ Only 1 model was made in which the first one is the best as it has the least
energy.
Each Ligand has 9 conformations. For each Ligand, the first conformation is the
best one
Homology Modelling
Predict the secondary structure of the given sequence using Chou & Fasman, GOR
& Neural Network methods.
Sequence
>query
MAGHIVLNTGAKMPMLGLGTWKSSPGQVTEAVKTAIDVGYRHIDCAHVYQNEQEVGLAIQ
QKLKEQVVTRKELFIVSKLWCTYHEKSMVKEACKKTLRDLQLDYLDLYLIHWPTGFKAGK
EFFPLDEAGNVIPSDTDVLDTWTAMEELVDEGLVAAIGISNFNHLQIERILNKPGLKYKPAV
NQIECHPYLTQEKLVSYCQSKGIVVTAYSPLGSPDRPWAKPDDPSLLEDPRIKEIAAKHNK
TSAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDVTTLLSYNRNWRVCALMSC
ANHKDYPFNEEF
1. We went to this website:- http://cib.cf.ocha.ac.jp/bitool/MIX/
2. The inputted the protein Sequence
Structure Prediction by Chou Fasman
Structure Predition by GOR method
Structure prediction by
NN
BLAST the given sequence against PDB and find a suitable template from any plant
species for homology modelling.
Report the query coverage, percent identity, PDB code, resolution of the data and
the chain ID of the chosen template.
1. The Query Protein Sequence was taken, and then BLAST was performed
2. Then among all the BLAST results, the template chosen was from the plant species:-
Oryza sativa
Query Coverage= 88%
Percent Identity= 49.11%
PDB Code:- 6KBL
Resolution:- 1.7 A
Chain ID:-
Ensure that you fix the template for alternate conformers, anisotropic thermal
parameters and non-standard residues, if any.
• python3 model_default.py
• query.B99990001.pdb
• query.B99990002.pdb
• query.B99990003.pdb
Based on energy, Ramachandran outliers and RMSD with the template, identify the
best model
1. Based on Energy:-
The 3rd Model seems to be the best because it has the least energy
Now,
Model 2 has 7 outliers
Now,