Simatic Hmi Hmi Device Op 73, Op 77a, Op 77b (Wincc Flexible) (Pdfdrive)

Preface
SIMATIC HMI HMI device OP 73, OP 77A, OP 77B (WinCC flexible)
1
______________
Overview
Safety instructions and

2
SIMATIC HMI ______________
general notes
3
HMI device ______________
Planning use
OP 73, OP 77A, OP 77B 4

(WinCC flexible) ______________
Mounting and connection
Operator control components

5
Operating Instructions ______________
and LEDs
Configuring the operating

6
______________
system
Preparing and backing up a

7
______________
project
8
______________
Operating a project
9
______________
Operating alarms
Operating recipes on
10
______________
OP 77A and OP 77B
11
______________
Maintenance and Service
12
______________
Specifications
A
______________
Appendix
B
Order no. 6AV6691-1DA01-0AB1
______________
Abbreviations
09/2007
A5E01006691-02
Safety Guidelines
Safety Guidelines
This manual contains notices you have to observe in order to ensure your personal safety, as well as to prevent
damage to property. The notices referring to your personal safety are highlighted in the manual by a safety alert
symbol, notices referring only to property damage have no safety alert symbol. These notices shown below are
graded according to the degree of danger.
DANGER
indicates that death or severe personal injury will result if proper precautions are not taken.
WARNING
indicates that death or severe personal injury may result if proper precautions are not taken.
CAUTION
with a safety alert symbol, indicates that minor personal injury can result if proper precautions are not taken.
CAUTION
without a safety alert symbol, indicates that property damage can result if proper precautions are not taken.
NOTICE
indicates that an unintended result or situation can occur if the corresponding information is not taken into
account.
If more than one degree of danger is present, the warning notice representing the highest degree of danger will
be used. A notice warning of injury to persons with a safety alert symbol may also include a warning relating to
property damage.
Qualified Personnel
The device/system may only be set up and used in conjunction with this documentation. Commissioning and
operation of a device/system may only be performed by qualified personnel. Within the context of the safety notes
in this documentation qualified persons are defined as persons who are authorized to commission, ground and
label devices, systems and circuits in accordance with established safety practices and standards.
Prescribed Usage
Note the following:
WARNING
This device may only be used for the applications described in the catalog or the technical description and only
in connection with devices or components from other manufacturers which have been approved or
recommended by Siemens. Correct, reliable operation of the product requires proper transport, storage,
positioning and assembly as well as careful operation and maintenance.
Trademarks
All names identified by ® are registered trademarks of the Siemens AG. The remaining trademarks in this
publication may be trademarks whose use by third parties for their own purposes could violate the rights of the
owner.
Disclaimer of Liability
We have reviewed the contents of this publication to ensure consistency with the hardware and software
described. Since variance cannot be precluded entirely, we cannot guarantee full consistency. However, the
information in this publication is reviewed regularly and any necessary corrections are included in subsequent
editions.
Siemens AG Order number: 6AV6691-1DA01-0AB1 Copyright © Siemens AG 2007.

Automation and Drives Ⓟ 09/2007 Technical data subject to change
Postfach 48 48
90437 NÜRNBERG
GERMANY
Preface
Purpose of the operating instructions

This operating instruction manual provides information based on the requirements defined by
DIN 8418 for mechanical engineering documentation. This information relates to the device,
its place of use, transport, storage, installation, use and maintenance.
These operating instructions are intended for:
● Users
● Commissioning engineers
● Service technicians
● Maintenance technicians
Please read the section "Safety instructions and general notes" carefully.
The help integrated in WinCC flexible, the WinCC flexible Information System, contains
detailed information. The Information System contains instructions, examples and reference
information in electronic form.
Basic knowledge required

General knowledge of automation technology and process communication is needed to
understand the operating instructions.
It is also assumed that those using the manual have experience in using personal computers
and knowledge of Microsoft operating systems.
Operating instructions' range of validity

These operating instructions apply to the HMI devices OP 73, OP 77A and OP 77B in
combination with the WinCC flexible software package.
Position in the information landscape

These operating instructions form part of the SIMATIC HMI documentation. The following
information provides you with an overview of the SIMATIC HMI information landscape.
User manuals
● WinCC flexible Micro:
Describes basic principles of configuration using the WinCC flexible Micro Engineering
System.
OP 73, OP 77A, OP 77B (WinCC flexible)

Operating Instructions, 09/2007, 6AV6691-1DA01-0AB1 3
Preface
● WinCC flexible Compact/Standard/Advanced:

Describes basic principles of configuration using the WinCC flexible Compact
Engineering System/WinCC flexible Standard/WinCC flexible Advanced
● WinCC flexible Runtime:
Describes how to commission and operate your runtime project on a PC.
● WinCC flexible Migration:
– Describes how to convert an existing ProTool project to WinCC flexible.
– Describes how to convert an existing WinCC project to WinCC flexible.
– Describes how to convert an existing ProTool project including a change of the HMI
device, e.g. from OP7 to OP 77B or OP7 to OP 77B.
– Describes how to convert an existing ProTool project including a change from a
graphics device to a Windows CE device.
● Communication:
– Communication Part 1 describes the connection of the HMI device to SIMATIC PLCs.
– Communication Part 2 describes the connection of the HMI device to third-party PLCs.
Operating instructions
● Operating instructions for SIMATIC HMI devices.
– OP 73micro, TP 177micro
– OP 73, OP 77A, OP 77B
– TP 177A
– TP 170micro, TP 170A, TP 170B, OP 170B
– Mobile Panel 170
– TP 270, OP 270
– MP 270B
– MP 370
● Operating instructions (compact) for the HMI devices SIMATIC OP 77B and Mobile
Panel 170
Getting Started
● WinCC flexible for first time users:
Based on an example project, this is a step-by-step introduction to the basics of
configuring screens, alarms, recipes and screen navigation.
● WinCC flexible for advanced users:
configuring logs, project reports, scripts, user management and multilingual projects and
integration in STEP 7.
● WinCC flexible options:
configuring the WinCC flexible Sm@rtServices, Sm@rtAccess and OPC Server options.

4 Operating Instructions, 09/2007, 6AV6691-1DA01-0AB1
Preface
Online availability
Technical documentation on SIMATIC products and SIMATIC systems is available in PDF
format in various languages at the following addresses:
● SIMATIC Guide Technische Dokumentation in Deutsch:
"http://www.ad.siemens.de/simatic/portal/html_00/techdoku.htm"
● SIMATIC Guide for Technical Documentation in English:
"http://www.ad.siemens.de/simatic/portal/html_76/techdoku.htm"
Conventions
Configuration and runtime software differ with regard to their names as follows:
● "WinCC flexible 2004," for example, refers to the configuration software.
The term "WinCC flexible" is used in a general context. The full name, for example
"WinCC flexible 2004", is always used when it is necessary to differentiate between
different versions of the configuration software.
● "WinCC flexible Runtime" refers to the runtime software that can run on HMI devices.
Text is highlighted as follows to simplify reading the operating instructions:
Notation Scope
"Add screen" • Terminology that appears in the user interface, e.g., dialog
names, tabs, buttons, menu entries
• Inputs required, e.g., limit values, tag values
• Path information
"File > Edit" Operational sequences, e.g., menu commands, context menu
commands
<F1>, <Alt+P> Keyboard operation
Please observe notes labeled as follows:
Note
Notes contain important information concerning the product, its use or a specific section of
the documentation to which you should pay particular attention.

Preface
Registered trademarks
Names labeled with a ® symbol are registered trademarks of the Siemens AG. Other names
used in this documentation may be trademarks, the use of which by third parties for their
own purposes could violate the rights of the owner.
● HMI®
● SIMATIC®
● SIMATIC HMI®
● SIMATIC ProTool®
● SIMATIC WinCC®
● SIMATIC WinCC flexible®
● SIMATIC OP 73®
● SIMATIC OP 77A®
● SIMATIC OP 77B®
Representatives and offices

If you have any further questions relating to the products described in this manual, please
contact your local representative at the SIEMENS branch nearest you.
Find your contact partner at:
"http://www.siemens.com/automation/partner"
Training center
Siemens AG offers a variety of training courses in order to familiarize you with automation
systems. Please contact your regional training center or the central training center in
D-90327 Nuremberg, Germany.
Phone: +49 (911) 895-3200
Internet: "http://www.sitrain.com"
Service & support on the Internet

Service & Support offers online services for additional, comprehensive information on
SIMATIC products at
"http://www.siemens.com/automation/support":
● The newsletter offers you the latest information about your products.
● A large document base is available using our Service & Support search engine.
● A forum for global exchange of information by users and experts
● Current product information, FAQs and downloads
● Your local Automation & Drives representative
● Information about field service, repairs, spare parts and much more under the heading
"Services"

Table of contents
Preface ...................................................................................................................................................... 3
1 Overview.................................................................................................................................................. 13
1.1 Product overview .........................................................................................................................13
1.2 Design of the OP 73micro HMI device.........................................................................................14
1.3 Design of the OP 77A HMI device ...............................................................................................15
1.4 Design of the OP 77B HMI device ...............................................................................................16
1.5 Accessories..................................................................................................................................17
1.6 Other ............................................................................................................................................17
1.7 Range of HMI software functions.................................................................................................18
1.8 Communication of OP 73 and OP 77A with Controllers ..............................................................20
1.9 OP 77B communication with PLCs..............................................................................................21
2 Safety instructions and general notes ...................................................................................................... 23
2.1 Safety Information........................................................................................................................23
2.2 Standards, Certificates and Approvals ........................................................................................24
2.3 Notes about usage.......................................................................................................................26
2.4 Electromagnetic compatibility ......................................................................................................29
2.5 Transport and storage conditions ................................................................................................31
3 Planning use............................................................................................................................................ 33
3.1 Mounting information ...................................................................................................................33
3.2 Mounting positions and fixation....................................................................................................35
3.3 Preparing for mounting ................................................................................................................36
3.4 Information on insulation tests, protection class and degree of protection..................................39
3.5 Nominal voltages .........................................................................................................................40
4 Mounting and connection......................................................................................................................... 41
4.1 Checking the package contents...................................................................................................41
4.2 Mounting and connecting the OP 73 ...........................................................................................41
4.2.1 Mounting the HMI device .............................................................................................................41
4.2.2 Connecting the HMI device..........................................................................................................42
4.2.2.1 Interfaces .....................................................................................................................................43
4.2.2.2 Connecting the equipotential bonding circuit ...............................................................................44
4.2.2.3 Connecting the PLC.....................................................................................................................46
4.2.2.4 Connecting the configuration computer .......................................................................................46
4.2.2.5 Connecting the power supply.......................................................................................................47
4.2.3 Switching on power and testing the HMI .....................................................................................49

Table of contents
4.3 Mounting and connecting the OP 77A and OP 77B ................................................................... 51

4.3.1 Mounting the HMI device ............................................................................................................ 51
4.3.2 Connecting the HMI device ......................................................................................................... 52
4.3.2.1 Interfaces .................................................................................................................................... 53
4.3.2.2 Connecting the equipotential bonding circuit .............................................................................. 54
4.3.2.3 Installing the equipotential circuit ................................................................................................ 55
4.3.2.4 Connecting the PLC .................................................................................................................... 56
4.3.2.5 Connecting the configuration computer ...................................................................................... 58
4.3.2.6 Wiring I/O to OP 77B................................................................................................................... 59
4.3.2.7 Connecting the power supply...................................................................................................... 60
4.3.3 Switching on power and testing the HMI..................................................................................... 62
5 Operator control components and LEDs.................................................................................................. 65
5.1 Control elements on the OP 73 front panel................................................................................. 65
5.2 Operator control components and LEDs on the front panel of OP 77A and OP 77B ................. 66
5.3 Additional elements on the OP 77A and OP 77B ....................................................................... 67
5.3.1 Use of a memory card on OP 77B .............................................................................................. 68
5.3.2 Labeling the function keys of OP 77A and OP 77B .................................................................... 70
5.3.3 Setting the DIL switch ................................................................................................................. 71
6 Configuring the operating system ............................................................................................................ 73
6.1 Configuring the operating system of the OP 73 .......................................................................... 73
6.1.1 Overview ..................................................................................................................................... 73
6.1.2 "Info/Settings" menu.................................................................................................................... 74
6.1.2.1 Overview ..................................................................................................................................... 74
6.1.2.2 Setting screen contrast ............................................................................................................... 76
6.1.2.3 Displaying information about the HMI ......................................................................................... 76
6.1.2.4 Viewing information about the version of the HMI image ........................................................... 77
6.1.3 "Settings" menu........................................................................................................................... 77
6.1.3.1 Overview ..................................................................................................................................... 77
6.1.3.2 Setting the delay ......................................................................................................................... 78
6.1.3.3 Setting the screen saver ............................................................................................................. 78
6.1.3.4 Assigning, changing and deleting passwords ............................................................................. 79
6.1.3.5 Configuring the data channel ...................................................................................................... 80
6.2 Configuring the OP 77A and OP 77B operating system............................................................. 84
6.2.1 Overview ..................................................................................................................................... 84
6.2.2 "Info/Settings" menu.................................................................................................................... 85
6.2.2.1 Overview ..................................................................................................................................... 85
6.2.2.2 Setting screen contrast ............................................................................................................... 86
6.2.2.3 Displaying information about the HMI ......................................................................................... 87
6.2.2.4 Viewing information about the version of the HMI image ........................................................... 87
6.2.3 "Settings" menu........................................................................................................................... 88
6.2.3.1 Overview ..................................................................................................................................... 88
6.2.3.2 Setting the delay ......................................................................................................................... 89
6.2.3.3 Setting the Screen Saver ............................................................................................................ 89
6.2.3.4 Changing regional settings for OP 77B....................................................................................... 90
6.2.3.5 Assigning, editing and deleting passwords ................................................................................. 90
6.2.3.6 Backup and restore functions for OP 77B................................................................................... 92
6.2.3.7 Configuring the data channel ...................................................................................................... 92
6.2.4 "Printer Settings" menu of OP 77B ............................................................................................. 99
6.2.4.1 Overview ..................................................................................................................................... 99
6.2.4.2 Set printer language.................................................................................................................. 100
6.2.4.3 Setting the paper format............................................................................................................ 100
6.2.4.4 Setting the print orientation ....................................................................................................... 101

Table of contents
6.2.4.5 Setting the print mode................................................................................................................101

7 Preparing and backing up a project ....................................................................................................... 103
7.1 Overview ....................................................................................................................................103
7.1.1 Setting the operating mode........................................................................................................105
7.1.2 Reusing existing projects ...........................................................................................................106
7.1.3 Data Transfer Options................................................................................................................106
7.2 Transfer......................................................................................................................................107
7.2.1 Overview ....................................................................................................................................107
7.2.2 Starting the transfer manually ....................................................................................................107
7.2.3 Starting the transfer automatically .............................................................................................108
7.2.4 Testing a project ........................................................................................................................110
7.2.5 Uploading a project from OP 77B ..............................................................................................111
7.3 Backup and restore....................................................................................................................113
7.3.1 Overview ....................................................................................................................................113
7.3.2 Backup and Restore via WinCC flexible ....................................................................................114
7.3.3 Backup and Restore via ProSave ..............................................................................................116
7.3.4 Backup and restore operations with MMC on OP 77B ..............................................................118
7.4 Updating the operating system ..................................................................................................121
7.4.1 Overview ....................................................................................................................................121
7.4.2 Updating the Operating System Using WinCC flexible..............................................................122
7.4.3 Updating the Operating System Using ProSave........................................................................123
8 Operating a project ................................................................................................................................ 125
8.1 Operating a project on OP 73 ....................................................................................................125
8.1.1 Overview ....................................................................................................................................125
8.1.2 Setting the project language ......................................................................................................127
8.1.3 Entries and help within a project ................................................................................................127
8.1.3.1 Overview ....................................................................................................................................127
8.1.3.2 Entering and editing numerical and alphanumerical values ......................................................129
8.1.3.3 Entering and editing symbolic values ........................................................................................133
8.1.3.4 Entering and modifying date and time .......................................................................................133
8.1.3.5 Displaying infotext......................................................................................................................134
8.1.4 Project security ..........................................................................................................................135
8.1.4.1 Overview ....................................................................................................................................135
8.1.4.2 User logon..................................................................................................................................137
8.1.4.3 User logoff..................................................................................................................................138
8.1.4.4 Creating users............................................................................................................................138
8.1.4.5 Changing user data....................................................................................................................140
8.1.4.6 Deleting a user ...........................................................................................................................141
8.1.5 Closing the project .....................................................................................................................142
8.2 Operating a project on OP 77A and OP 77B .............................................................................143
8.2.1 Overview ....................................................................................................................................143
8.2.2 Setting the project language ......................................................................................................145
8.2.3 Entries and help within a project ................................................................................................146
8.2.3.1 Overview ....................................................................................................................................146
8.2.3.2 Entering and editing numerical and alphanumerical values ......................................................147
8.2.3.3 Entering and editing symbolic values ........................................................................................151
8.2.3.4 Entering and modifying date and time .......................................................................................152
8.2.3.5 Viewing infotext..........................................................................................................................152
8.2.4 Project security ..........................................................................................................................153
8.2.4.1 Overview ....................................................................................................................................153
8.2.4.2 User logon..................................................................................................................................156
8.2.4.3 User logoff..................................................................................................................................157

Table of contents
8.2.4.4 Creating users........................................................................................................................... 158

8.2.4.5 Changing user data................................................................................................................... 159
8.2.4.6 Deleting a user .......................................................................................................................... 161
8.2.5 Closing the project .................................................................................................................... 162
9 Operating alarms ................................................................................................................................... 163
9.1 Overview ................................................................................................................................... 163
9.2 Alarms on the OP 73................................................................................................................. 165
9.2.1 Displaying alarms...................................................................................................................... 165
9.2.2 Acknowledge alarm................................................................................................................... 167
9.2.3 Edit alarm .................................................................................................................................. 167
9.3 Alarms on the OP 77A and OP 77B.......................................................................................... 168
9.3.1 "Error" alarm class .................................................................................................................... 168
9.3.2 Viewing alarms.......................................................................................................................... 169
9.3.3 Acknowledge alarm................................................................................................................... 171
9.3.4 Edit alarm .................................................................................................................................. 171
10 Operating recipes on OP 77A and OP 77B............................................................................................ 173
10.1 Overview ................................................................................................................................... 173
10.2 Structure of a recipe.................................................................................................................. 174
10.3 Recipes in the Project ............................................................................................................... 176
10.4 Recipe view............................................................................................................................... 178
10.5 Operating the Simple Recipe View ........................................................................................... 179
10.6 Creating a Recipe Data Record ................................................................................................ 182
10.7 Editing a Recipe Data Record................................................................................................... 183
10.8 Deleting a Recipe Data Record ................................................................................................ 184
10.9 Reading a Recipe Data Record from the PLC .......................................................................... 185
10.10 Transferring a Recipe Data Record to the PLC ........................................................................ 186
10.11 Exporting and Importing Recipe Data Records on the OP 77B................................................ 187
11 Maintenance and Service ...................................................................................................................... 189
11.1 Maintenance and service .......................................................................................................... 189
11.2 Servicing and spare parts ......................................................................................................... 190
12 Specifications ........................................................................................................................................ 191
12.1 Dimension drawings.................................................................................................................. 191
12.1.1 Dimension Drawings of the OP 73............................................................................................ 191
12.1.2 Dimension Drawings of OP 77A and OP 77B........................................................................... 192
12.2 Specifications ............................................................................................................................ 193
12.2.1 Specifications of the OP 73....................................................................................................... 193
12.2.2 Specifications of the OP 77A .................................................................................................... 194
12.2.3 Specifications of the OP 77B .................................................................................................... 195
12.3 Description of interfaces............................................................................................................ 197
12.3.1 Power supply............................................................................................................................. 197
12.3.2 RS 485 (IF 1B) on OP 73 .......................................................................................................... 197
12.3.3 RS 485 (IF 1B) on OP 77A........................................................................................................ 198
12.3.4 RS 422/RS 485 (IF 1B) on OP 77B .......................................................................................... 198
12.3.5 RS 232 (IF 1A) on OP 77B........................................................................................................ 199

Table of contents
12.3.6 USB on OP 77B .........................................................................................................................200

A Appendix................................................................................................................................................ 201
A.1 ESD Directives ...........................................................................................................................201
A.2 System alarms ...........................................................................................................................203
B Abbreviations......................................................................................................................................... 227
Glossary ................................................................................................................................................ 229
Index...................................................................................................................................................... 235

Table of contents

Overview 1
1.1 Product overview
Big changes in small plants - the new graphic HMI devices of the 70 series
The new OP 73 and OP 77 operator panels represent low-cost devices in the class of
graphic HMI devices for first-time user. These devices offer many options ranging from a
fully graphical 3" or 4.5" display unit, to their configuration in WinCC flexible in up to 32
engineering and online languages, including Asian and Cyrillic characters. The new operator
panels are therefore highly suitable for small-scale HMI tasks.
OP 73 and OP 77 replace the text-based OP3 and OP7. Existing OP3/OP7 projects in
WinCC flexible can be migrated to OP73/OP77 projects. The previous engineering work is
thus retained.

Overview
1.2 Design of the OP 73micro HMI device
1.2 Design of the OP 73micro HMI device
Views of the HMI device
Figure 1-1 Front and side view
① Display
② Membrane keyboard
③ Clamping recess
④ Mounting seal
Figure 1-2 Bottom view

Overview
1.3 Design of the OP 77A HMI device
1.3 Design of the OP 77A HMI device
2
6
3
① Display
② Construction-related opening – not a slot for a memory card
③ LED display
④ Membrane keyboard
⑤ Clamping recess
⑥ Guides for the labeling strips
⑦ Mounting seal

Overview
1.4 Design of the OP 77B HMI device
1.4 Design of the OP 77B HMI device
2
3
7
4
① Display
② Memory card holder
③ MMC slot
④ LED display
⑤ Membrane keyboard
⑥ Clamping recess
⑦ Guides for the labeling strips
⑧ Mounting seal

Overview
1.5 Accessories
1.5 Accessories
Accessory kit
The accessory kit contains the following:
● A terminal block for the power supply
● Two mounting clamps for installing an OP 73
● Four mounting clamps for installing an OP 77A or OP 77B
Additional documents may be enclosed with the accessory kit.
Memory card
For the OP 77B:
An MMC (Multi Media Card), tested and approved by Siemens AG, can be used as an
external storage medium. The memory card is an option and can be ordered separately.
NOTICE
The MMC of the SIMATIC S7 controller cannot be used.
1.6 Other
PC-PPI adapter for OP 73 and OP 77A

For the conversion from RS 232 to RS 485, order the PC-PPI adapter, order no.
6ES7 901- 3CB30-0XA0, from Siemens AG. You also need the PC-PPI adapter to update
the operating system, for example. The PC-PPI adapter is also used for file transfers.
RS 232-TTY converter for OP 77B

To convert RS 232 to TTY, you can order the TTY-RS 232 converter, order no.
6ES5 734-1BD20, from Siemens AG.
Labeling strips for OP 77A and OP 77B

Labeling strips are not supplied as options. The labeling strips can be produced with the help
of a template. The templates for the labeling strips are in the "SLIDE_OP77B.DOC" file on
the "WinCC flexible" installation CD in the "\Support\Documents" folder. Pay attention to the
information provided in the file.

Overview
1.7 Range of HMI software functions
General
The tables below show the objects which can be integrated in a project for an OP 73,
OP 77A and OP 77B.
Note
The specified values are maximum values of the individual objects. Simultaneous use of
multiple objects with their maximum value can lead to problems in the active project.
Alarms
Object Specification OP 73 OP 77A OP 77B

Alarm Number of discrete alarms 500 1000 1000
Length of the alarm text 80 characters
Number of tags in an alarm max. 8
Display Alarm view, alarm window
Acknowledge single error alarms Yes
Acknowledge several error alarms Yes
simultaneously (group acknowledgement)
Edit alarm Yes
Alarm indicator Yes No No
Volatile alarm buffer Alarm buffer capacity 256
Simultaneously queued alarm events max. 16 max. 64 max. 64
View alarm Yes
Delete alarm buffer Yes
ALARM_S View SIMATIC S7 alarms No No Yes
Tags, values and lists

Tags Number 1000
Limit-value monitoring Input Yes
Linear Scaling Input/Output Yes
Text lists Number 150 300 300

Overview
Screens

Screen Number 500
Fields per screen 20 30 30
Tags per screen 20 30 30
Complex elements per screen 5
(bar graph, for example)
Template Yes
Recipes
The specified values are maximum values and should not be used additively. For example,
you can create 5 recipes each with 20 records and 20 entries for OP 77A.

Recipe Number – 10 100
Data records per recipe – 20 200
Entries per recipe – 50 200
Recipe screens – No Yes
Infotext

Infotext Length (no. of characters) 320
For alarms Yes
For screens Yes
For screen objects (e.g. IO fields) Yes
For recipes No No Yes
Help indicator Yes No No
Additional functions

Monitor settings Contrast Yes
Screen saver – Yes
Language switching Number of languages 5
Graphic objects Graphics Yes
Text objects – 1000 1000 2500
Security Number of users 25 50 50
Print Protocols No Yes
Hardcopy of the screen content No Yes
Alarm logging No Yes

Overview
1.8 Communication of OP 73 and OP 77A with Controllers
1.8 Communication of OP 73 and OP 77A with Controllers
Number of connections
Table 1-1 Number of controllers connected to OP 73 and OP 77A
Interconnection OP 73 OP 77A
Number with MPI/PROFIBUS DP 2 (on the same bus) 4 (on the same bus)
Siemens controllers
The following table shows the Siemens controllers and protocols or profiles that can be used
for OP 73 and OP 77A:
Controller Protocol/Profile OP 73 OP 77A

SIMATIC S7-200 • MPI1 yes yes
SIMATIC S7- • MPI yes yes
300/400 • PROFIBUS DP up to 1.5 Mbps yes yes
• PROFIBUS DP up to 12 Mbps no no
1 Set the "DP" profile in WinCC flexible if you need a transmission rate of 9.6 kbps.

Overview
1.9 OP 77B communication with PLCs
Number of connections
Table 1-2 Number of PLCs connected to OP 77B
Interconnection OP 77B
Number with MPI/PROFIBUS DP 4 (similar PLCs)
Siemens PLCs
The following table shows which Siemens PLCs can be used for OP 77 B.
Controller Protocol
SIMATIC S5 • AS 511, via adapter and converter
• PROFIBUS DP up to 12 Mbps
SIMATIC S7-200 • MPI1
SIMATIC S7-300/400 • MPI
SIMATIC 500/505 • NITP
1 Set the "DP" profile in WinCC flexible if you need a transmission rate of 9.6 kbps.

Overview
PLCs from other manufacturers

The following table shows which third-party PLCs can be used for OP 77 B.
Controller Protocol
Allen-Bradley • DF1 1) 3)
PLC series SLC500, SLC501, SLC502, SLC503, • DH+ via DF1 gateway (KF2 module)2) 3)
SLC504, SLC505, MicroLogix • DH485 via DF1 gateway (via KF3 module)3)
• DH485 3)
Allen-Bradley • DF13)
PLC series PLC5/11, PLC5/20, PLC5/30, PLC5/40, • DH+ via DF13)
PLC5/40L, PLC5/60, PLC 5/60L, PLC5/80
GE Fanuc Automation SNP3)
PLC series 90-30, 90-70, 90-Micro
LG Industrial Systems (Lucky Goldstar)/IMO Dedicated communication 3)
PLC series GLOFA-GM/G4, G6, G7M
Mitsubishi Electric FX3)
PLC series MELSEC FX, MELSEC FX0
Mitsubishi Melsec Protocol 43)
PLC series FX, A, Ans, Q, QnAS
OMRON Hostlink/Multilink (SYSMAC Way)3)
PLC series SYSMAC C, SYSMAC CV, SYSMAC
CS1, SYSMAC alpha, CP
Schneider Automation (Modicon) Modbus RTU 3)
PLC series Modicon 984, TSX Quantum, TSX
Compact
Telemecanique Uni-Telway3)
PLC series:
• TSX 7 with P47 411
• TSX 7 with P47/67/87/107 420
• TSX 7 with P47/67/87/107 425
• Module TSX SCM 21.6 with the aforementioned
TSX 7 CPUs
• TSX 17 with module SCG 1161
• TSX 37 (Micro)
• TSX 57 (Premium)
1) Applies to controllers SLC503, SLC504, SLC505, MicroLogix

2) Applies to controllers SLC504 over DF1.
3) Activate the "Enable (Remote off)" function under "Channel 1 serial" in the "Transfer
Settings".

Safety instructions and general notes 2
2.1 Safety Information
Working on the cabinet
WARNING
Open equipment
The HMI device is an open equipment. This means that the HMI device may only be
installed in cubicles or cabinets, whereby the device can be operated from the front panel.
Access to the cubicle or cabinet in which the HMI device is installed should only be possible
by means of a key or tool and for personnel who have received instruction or are
authorized.
Danger, high voltage
Opening the cabinet will expose high voltage parts. Contact with these parts could be fatal.
Switch off the power supply to the cabinet before opening it.
Hazardous areas
When operating the HMI device in hazardous areas the following warning applies.
WARNING
Explosion Hazard
Do not disconnect while circuit is live unless area is known to be non-hazardous.
Substitution of components may impair suitability for Class I, Division 2 or Zone 2.
High frequency radiation
NOTICE
Unintentional operating situations
High frequency radiation, from mobile phones for example, can cause unintentional
operating situations.
See also
Connecting the HMI device (Page 52)

Safety instructions and general notes
2.2 Standards, Certificates and Approvals
Valid approvals
CAUTION
Valid approvals
The overview below provides information on available approvals
The HMI device itself is certified as shown on the label on its rear panel.
CE approval
The automation system meets the general and safety-related requirements of the following
EC directives and conforms to the harmonized European standards (EN) for programmable
logic controllers published in the official gazettes of the European Union:
● 89/336/EEC "Electromagnetic Compatibility" (EMC guideline)
● 94/9/EG "Equipment and protective systems intended for use in potentially explosive
atmospheres" (ATEX).
EC declaration of conformity
The EC declarations of conformity are kept available for the responsible authorities at the
following address:
Siemens Aktiengesellschaft
Automation & Drives
A&D AS RD ST PLC
PO Box 1963
D-92209 Amberg
UL certification
Underwriters Laboratories Inc. conforming to

● UL 508 (Industrial Control Equipment)
● CSA C22.2 No. 142, (Process Control Equipment)
or

Underwriters Laboratories Inc. conforming to

● UL 508 (Industrial Control Equipment)
● CSA C22.2 No. 142, (Process Control Equipment)
● UL 1604 (Hazardous Location)
● CSA-213 (Hazardous Location)
Approved for use in
● Class I, Division 2, Group A, B, C, D or
● Class I, Zone 2, Group IIC or
● non-hazardous locations
FM Approval
FM
APPROVED
Factory Mutual Research (FM) conforming to

● Approval Standard Class Number 3611, 3600, 3810
Approved for use in
● Class I, Division 2, Group A, B, C, D T4
● Class I, Zone 2, Group IIC T4
Ex approval
In compliance with EN 50021 (Electrical apparatus for potentially explosive atmospheres;

Type of protection "n")
● II 3 G/D EEx nA II T4
● IP65
● 04 ATEX 1297X
Tick-mark for Australia
N117
The HMI device fulfills the requirements of standard AS/NZS 2064 (Class A).

2.3 Notes about usage
IEC 61131
The HMI device fulfills the requirements and criteria conforming to IEC 61131-2,
Programmable Logic PLCs, Part 2: Operating resource requirements and tests.
Use in industry
The HMI device is designed for industrial use. The following standards are met:
● Requirements of the emission of interference EN 61000-6-4: 2001
● Requirements for noise immunity EN 61000-6-2: 2001
Residential use
If the HMI device is used in a residential area, you must take measures to achieve Limit
Class B conforming to EN 55011 for RF interference.
Suitable measures to achieve Limit Class B for suppression of radio interference include:
● Installation of the HMI device in a grounded control cabinet
● Use of filters in electrical supply lines
Use in potentially explosive atmosphere, Zone 2
DANGER
Risk of explosion
Operate the HMI device only in a Zone 2 potentially explosive atmosphere if it has been
identified as approved for such environments.
Figure 2-1 Explosion protection label
● II 3 G/D EEx nA II
● IP65
● 04 ATEX 1297X
WARNING
Personal injury and property damage can occur.
Personal injury and property damage can occur in potentially explosive atmospheres if
an electric plug is disconnected from the HMI device while the system is in operation.
In potentially explosive atmospheres, always turn off power to the HMI device before
disconnecting any connectors.

Potentially explosive atmosphere, Zone 2

Potentially explosive atmospheres are organized by zones. The zones are classified
according to the probability of the presence of an explosive atmosphere.
Zone Risk of explosion Example

2 Infrequent and brief development Areas around flanged pipe joints with flat
of an explosive gas atmosphere gaskets in closed rooms
Safe zone no • Outside Zone 2
• Standard applications of distributed IO
WARNING
Observe the degree of protection
The HMI device must be installed in a metal enclosure or in a cabinet The minimum degree
of protection of these is IP54 (conforming to EN 60529). Make allowances for the ambient
conditions under which you install the HMI device. The enclosure must have a
manufacturer's declaration for Zone 2 (conforming to EN 50021).
Special conditions for operation in potentially explosive atmospheres of Zone 2

● In situations where the temperature on the cable or at the cable inlet of this enclosure
exceeds 70° C is or the temperature on the wire branching point exceeds 80° C under
operating conditions, the properties of the cables used must ensure that these can
withstand the actually measured temperatures.
● The cable inlets must be compliant with the required degree of protection (conforming
to 50021.)
● All peripheral devices connected to the HMI device must be certified conforming to
explosion protection types EEx nA or EEx nC.
● Measures must be taken to prevent transient voltages from causing the voltage to exceed
its nominal value by more than 40%.
● Ambient temperature range: 0° C ... 50° C vertical
● The temperature of the HMI device's cabinet surface should not exceed 60° C.
● The HMI device should be switched off immediately and replaced if damaged.
Such damage might be:
– Tears or detachment of individual membranes
– A tear in proximity to the viewing window

● A label with the following warning must be attached to the inside of the switch
cabinet/cubing at a place that is clearly visible upon opening:
:DUQLQJ
7KHFRQWUROFDELQHWHQFORVXUHLVRQO\DOORZHG
WREHRSHQIRUDVKRUWWLPHHJJUDSKLFGLDJQRVWLFV
,QWKHPHDQWLPH\RXDUHQRWDOORZHGWRSUHVVDVZLWFKSXOORULQVHUW
PRGXOHVDQGGLVFRQQHFWDQ\HOHFWULFOLQHVFRQQHFWRUV
7KLVZDUQLQJGRHVQRWKDYHWREHWDNHQLQWRFRQVLGHUDWLRQ
LI\RXDUHDZDUHWKDWWKHUHLVQRH[SORVLRQKD]DUG
List of approved HMI devices

The list of approved HMI devices is available on the Internet under:
"http://www4.ad.siemens.de/view/cs"
under article ID 13702947.
Further information
The "HMI device in potentially explosive atmospheres of Zone 2 and Zone 22" flyer is part of
the package and must be complied with.
Maintenance
Defective HMI devices must be returned to the manufacturer for repair. Repair may only be
carried out by the manufacturer at his site.
Location of the manufacturer:
Siemens AG
Automation & Drives
Werner-von-Siemens-Straße 50
92224 Amberg
Germany
Approval
Note
HMI devices with approval to II 3 G EEx nA II T4 may only be used on SIMATIC systems of
device category 3.

2.4 Electromagnetic compatibility
Introduction
The HMI device fulfills requirements of the EMC Directive of the domestic European market
and other requirements.
EMC-compliant installation of HMI devices

An EMC-compliant installation of the HMI device and the use of interference-proof cables
form the basis of trouble-free operation. The "Directives for interference-free installation of
PLCs" and the "PROFIBUS Networks" manual also apply for the installation of the HMI
device.
Pulse-shaped interference
The following table shows the EMC properties of the modules with respect to pulse-shaped
interference. A requirement for this is that the HMI device meets the specifications and
directives regarding electrical installation.
Table 2-1 Pulse-shaped interference
Pulse-shaped Tested with Corresponds to test

interference intensity
Electrostatic discharge Air discharge: 8 kV 3
conforming to Contact discharge: 4 kV
IEC 61000-4-2
Burst pulses 2 KV power supply cable 3
(high-speed transient 2 KV signal cable, > 30 m
interference) 1 KV signal cable, < 30 m
conforming to
IEC 61000-4-4
High-power surge pulses conforming to IEC 61000-4-5, external protective circuit required (refer to
S7 300 PLC, Installation, chapter “Lightning and overvoltage protection”).
• Asymmetric coupling 2 kV power cable 3
DC voltage with protective elements
2 KV signal/data cable, > 30 m,
with protective elements as required
• Asymmetric coupling 1 kV power cable 3
DC voltage with protective elements
1 KV signal cable, > 30 m,
with protective elements as required

Sinusoidal interference
The table below shows the EMC properties of the modules with respect to sinusoidal
interference. A requirement for this is that the HMI device meets the specifications and
directives regarding electrical installation.
Table 2-2 Sinusoidal interference
Sinusoidal interference Test values Corresponds to

test intensity
RF interference 3
(electromagnetic fields)
• conforming to 10 V/m with 80 % amplitude modulation of 1 kHz in the
IEC 61000-4-3 range from 80 MHz to 1 GHz and 1.4 GHz to 2 GHz
10 V/m with 50% pulse modulation at 900 MHz
• conforming to 10 V/m with 50% pulse modulation at 1.89 GHz

IEC 61000-4-3
RF interference current Test voltage 10 V with 80% amplitude modulation of 3
on cables and cable 1 kHz in the range from 9 kHz to 80 MHz
shielding conforming to
IEC 61000-4-6
Emission of radio interference

Emission of electromagnetic interference conforming to 55011,
Limit value class A, Group 1, measured at a distance of 10 m:
From 30 to 230 MHz < 40 dB (V/m) quasi-peak

From 230 to 1000 MHz < 47 dB (V/m) quasi-peak
Additional measures
Before you connect an HMI device to the public network, ensure that it is compliant with Limit
Class B conforming to 55022.

2.5 Transport and storage conditions
Mechanical and climatic transport and storage conditions

The transport and storage conditions of this HMI device exceed requirements conforming to
IEC 61131-2. The following specifications apply to the transport and storage of an HMI
device in its original packing.
The climatic conditions comply to the following standards:
● IEC 60721-3-3, Class 3K7 for storage
● IEC 60721-3-2, Class 2K4 for transport
The mechanical requirements are compliant with EC 60721-3-2, Class 2M2.
Table 2-3 Transport and storage conditions
Type of condition Permissible range

Drop test (in transport package) ≤1m
Temperature from –20° C to +60° C
Atmospheric pressure from 1080 hPa to 660 hPa,
corresponds to an elevation of - 1000 m to 3500 m
Relative humidity from 10% to 90% without condensation
Sinusoidal vibration conforming to 5 Hz to 9 Hz: 3.5 mm
IEC 60068-2-6 9 Hz to 150 Hz: 9.8 m/s2
Shock conforming to IEC 60068-2-29 250 m/s2, 6 ms, 1000 shocks
NOTICE
Ensure that no condensation (dewing) develops on or inside the HMI device after
transporting it at low temperatures or after it has been exposed to extreme temperature
fluctuations.
The HMI device must have acquired room temperature before it is put into operation. Do
not expose the HMI device to direct radiation from a heater in order to warm it up. If dewing
has developed, wait approximately four hours before you switch on the HMI device.
Prerequisite for the trouble-free and safe operation of the HMI device is proper transport and
storage, installation and assembly and careful operation and maintenance.
Warranty for the HMI device is deemed void if these specifications are ignored.


Planning use 3
3.1 Mounting information
Mechanical and climatic conditions of use

The HMI device is intended for installation in weatherproof permanent locations. The
conditions of use are compliant with requirements to DIN IEC 60721-3-3:
● Class 3M3 (mechanical requirements)
● Class 3K3 (climatic requirements)
Use with additional measures

Examples of applications where the use of the HMI device requires additional measures:
● In locations with a high degree of ionizing radiation
● In locations with extreme operating conditions resulting from situations as follows:
– Corrosive vapors, gases, oils or chemicals
– Electrical or magnetic fields of high intensity
● In plants requiring special monitoring features, for example:
– Elevator systems
– Systems in especially hazardous rooms
Mechanical ambient conditions

The mechanical ambient conditions for the HMI device are specified in the following table in
terms of sinusoidal vibration.
Table 3-1 Mechanical ambient conditions
Frequency range Continuous Occasional

in Hz
10 ≤ f ≤ 58 Amplitude 0.0375 mm Amplitude 0.075 mm
58 ≤ f ≤ 150 0.5 g constant acceleration Constant acceleration 1 g
Reduction of vibration
If the HMI device is subjected to greater shocks or vibrations, you must take appropriate
measures to reduce acceleration or amplitudes.
We recommend fitting the HMI device to vibration-absorbent material (on metal shock
absorbers, for example).

Planning use
3.1 Mounting information
Check of mechanical ambient conditions

The following table provides information on the type and scope of the check of mechanical
ambient conditions.
Table 3-2 Check of mechanical ambient conditions
The check Test standard Remarks

includes
Vibrations Vibration test conforming to Type of vibration:
IEC 60068, part 2–6 Transitional rate of the frequency:
(sinusoidal) 1 octave/minute.
10 ≤ f ≤ 58,
Constant amplitude 0.075 mm
58 ≤ f ≤ 150,
Constant acceleration 1 g
Vibration duration:
10 frequency cycles per axis in each of the three
axes vertical to each other
Shock Shock test conforming to Type of shock: Half-sine
IEC 60068, part 2–29 Shock intensity:
Peak value 15 g, duration 11 ms
Direction of impact:
3 shocks in ± direction of axis in each of the
three axes vertical to each other
Climatic ambient conditions

The HMI device may be used under the following climatic ambient conditions:
Table 3-3 Climatic ambient conditions
Ambient conditions Permissible range Remarks

Temperature See the "Mounting positions and type of
• Vertical mounting from 0° C to 50° C fixation" section
• Inclined mounting from 0 °C to 40 °C
Relative humidity 10% to 90% Without condensation, corresponds to a
relative humidity, stress class 2
conforming to IEC 61131, part 2
Atmospheric pressure 1080 hPa to 795 hPa Corresponds to an elevation of -1000 to
2000 m
Pollutant concentration SO2: < 0.5 ppm; Test: 10 ppm; 4 days
relative humidity < 60%, no
condensation
H2S: < 0.1 ppm; Test: 1 ppm; 4 days
relative humidity < 60 %, no
condensation

Planning use
3.2 Mounting positions and fixation
3.2 Mounting positions and fixation
Mounting position
The HMI device is designed for mounting in racks, switch cabinets, switchboards and
consoles. In the following, all of these mounting options are referred to by the general term
"cabinet".
The HMI device is self-ventilated and approved for vertical and inclined mounting in
stationary cabinets.
– +

Figure 3-1 Permitted mounting positions
Permitted mounting conditions without auxiliary ventilation
Mounting position Deviation from the vertical

① Inclined ≤ –80°
② Vertical 0°
③ Inclined ≤ 80°
CAUTION
Impermissible ambient temperatures
Do not operate the HMI device without auxiliary ventilation if the maximum permissible
ambient temperature is exceeded. The HMI device may otherwise get damaged and its
approvals and warranty will be void!

Planning use
3.3 Preparing for mounting
Type of fixation
Spring clamps are provided for mounting the device. Hook the clamps into the recesses of
the HMI device. The overall HMI device dimensions are not exceeded by this.
Figure 3-2 View of a mounting clamp
① Hook
② Recessed head screw
Select the HMI device mounting location

What to observe when selecting the mounting location:
● Position the HMI device so that the display is not exposed to direct sunlight or other
sources of light.
● Position the HMI device to provide an ergonomic position for the operator and select a
suitable mounting height.
● Ensure that the air vents are not covered as a result of the mounting.
● Observe the permissible mounting positions for the HMI device.
Preparing the mounting cut-out

The degrees of protection are only guaranteed when the following is observed:
● Applies to OP 73:
Material thickness at the mounting cut-out: 2 mm to 4 mm
● Applies to OP 77A and OP 77B
Material thickness at the mounting cut-out: 2 mm to 6 mm
● The deviation from the plane for the panel cut-out is ≤ 0.5 mm
This condition must be fulfilled for the mounted HMI device.
● Permissible surface roughness in the area of the seal: ≤ 120 µm (friction coefficient 120)

Planning use
The figure below shows the required cut-out:
138 +1
68 +1
Figure 3-3 Cut-out for panel-mounting the OP 73micro
135 +1
+1
171
Figure 3-4 Cut-out for panel-mounting an OP 77A and OP 77B

Planning use
Maintaining clearances
The following clearance is required around the HMI device in order to its ensure self-
ventilation:
50
15 15
50
Figure 3-5 Clearance around OP 73

50
1)
15 15
2)
70
50
Figure 3-6 Clearance around OP 77A and OP 77B
1) Applies to OP 77A
2) Applies to OP 77B
At least 10 mm clearance is required at the rear.
NOTICE
Ensure that the maximum ambient temperature is not exceeded when mounting the device
in a cabinet and especially in a closed enclosure.

Planning use
3.4 Information on insulation tests, protection class and degree of protection
3.4 Information on insulation tests, protection class and degree of

protection
Test voltages
Insulation strength is demonstrated in the type test with the following test voltages
conforming to IEC 61131-2:
Table 3-4 Test voltages
Circuits with a nominal voltage of Ue to other Test voltage

circuits or ground
< 50 V 500 V DC
Class of protection
Protection Class I conforming to IEC 60536, i.e. grounding conductor to profile rail required!
Protection from foreign objects and water
Degree of protection conforming to Explanation

IEC 60529
Front panel When mounted:
• IP65
• NEMA 4X/NEMA 12 (indoor use only)
Rear panel IP20
Protection against touch with standard test fingers.
There is no protection against ingress by water.
The degree of protection provided by the front side can only be guaranteed when the
mounting seal lies completely against the mounting cut-out.
NOTICE
Degree of protection IP65
This degree of protection is only ensured if the following conditions are satisfied:
• The material strength at the mounting cut-out is at least 2 mm.
• The deviation from the plane of the mounting cut-out in an installed HMI device is
≤ 0.5 mm.
Degree of protection NEMA 4X/NEMA 12 (indoor use only)
This degree of protection is only ensured if the following conditions are satisfied:
• The material strength at the mounting cut-out is at least 3 mm.
• The deviation from the plane of the mounting cut-out in an installed HMI device is
≤ 0.5 mm.

Planning use
3.5 Nominal voltages
3.5 Nominal voltages

The following table shows the permitted nominal voltage and the corresponding tolerance
range.
Table 3-5 Permitted nominal voltages
Nominal voltage Tolerance range

+24 V DC 20.4 V to 28.8 V (–15%, +20%)

Mounting and connection 4
4.1 Checking the package contents
Check the package contents for visible signs of transport damage and for completeness.
NOTICE
Do not install parts damaged during shipment. In the case of damaged parts, contact your
Siemens representative.
Keep the supplied documentation in a safe place. The documentation belongs to the HMI
device and is required for subsequent commissioning.
4.2 Mounting and connecting the OP 73
4.2.1 Mounting the HMI device
Requirements
You need two mounting clamps from the accessories kit for the installation. The mounting
seal must be available on the HMI device. If the mounting seal is damaged, order a
replacement seal. The mounting seal is part of the associated service pack.
Mounting
NOTICE
Always mount the HMI device according to the instructions in this manual.

Proceed as follows:
1. Check that the mounting seal is fitted on the HMI device.
Do not install the mounting seal turned inside out. This may cause leaks in the mounting
cut-out.
2. Insert the HMI device into the mounting cut-out from the front.
3. Insert the mounting clamps into the recesses on the side of the HMI device.
Figure 4-1 Inserting the clamp

Adjust and then fasten the clamps.
1. Tighten the clamp by screwing down the recessed head screw; permitted torque: 0.15
N/m.
NOTICE
Check the fit of the mounting seal on the front. The mounting seal must not protrude
from the HMI device
Otherwise, repeat steps 1 to 4.
4.2.2 Connecting the HMI device
Requirement
The HMI device must be mounted according to the specifications of these operating
instructions.
Connection sequence
Connect the HMI device in the following sequence:
1. Equipotential bonding
2. Power supply
Perform a power-up test to ensure that the correct polarity of the supply voltage.
3. PLC/configuration computer as necessary
4. Peripheral equipment as necessary

NOTICE
Connection sequence
Always follow the correct sequence for connecting the HMI device. Failure to do so may
result in damage to the HMI device.
Connecting the cables

When connecting the cables, ensure that you do not bend any of the contact pins.
Secure the connectors with screws.
Always use shielded data cable. Always use standard cables. Additional information can be
found in the SIMATIC HMI Catalog ST 80.
The pin assignment of the interfaces is described in the specifications.
See also
Safety Information (Page 23)
4.2.2.1 Interfaces
The figure below shows the interfaces of the HMI device.

Figure 4-2 Interfaces of the HMI device
① Power supply connector

② RS 485 interface (IF 1B)
③ Chassis ground terminal
See also
Power supply (Page 197)
RS 485 (IF 1B) on OP 73 (Page 197)

4.2.2.2 Connecting the equipotential bonding circuit
Potential differences
Differences in potential between spatially separated system parts can lead to high equalizing
currents over the data cables and therefore to the destruction of their interfaces. This
situation may arise if the cable shielding is terminated at both ends and grounded at different
system parts.
Potential differences may develop when a system is connected to different mains.
General requirements of equipotential bonding

Potential differences must be reduced by means of equipotential bonding in order to ensure
trouble-free operation of the relevant components of the electronic system. The following
must therefore be observed when installing the equipotential bonding circuit:
● The effectiveness of equipotential bonding increases as the impedance of the
equipotential bonding conductor decreases or as its cross-section increases.
● If two system parts are connected to each other via shielded data lines with shielding
connected to the grounding/protective conductor on both sides, the impedance of the
additionally installed equipotential bonding cables may not exceed 10% of the shielding
impedance.
● The cross-section of a selected equipotential bonding conductor must be capable of
handling the maximum equalizing current. The best results for equipotential bonding
between two cabinets were achieved with a minimum conductor cross-section of 16 mm2.
● Use equipotential bonding conductors made of copper or galvanized steel. Establish a
large-surface contact between the equipotential bonding conductors and the
grounding/protective conductor and protect these from corrosion.
● Terminate the shielding of the data cable on the HMI device flush and near the
equipotential busbar using suitable cable clamps.
● Route the equipotential bonding conductor and data cables in parallel with minimum
clearance between these. See the wiring diagram.
NOTICE
Equipotential bonding conductor
Cable shielding is not suitable for equipotential bonding. Always use the prescribed
equipotential bonding conductors. The minimum cross-section of a conductor used for
equipotential bonding is 16 mm². When you install MPI and PROFIBUS DP networks,
always use cables with a sufficient crosssection since otherwise the interface modules
may be damaged or destroyed.

Wiring diagram
3 3
5 6 7 8
Figure 4-3 Installing the equipotential circuit
① Chassis ground terminal on the HMI device (example)

② Equipotential bonding conductor cross-section: 4 mm2
③ Cabinet
④ Equipotential bonding conductor cross-section: min. 16 mm2
⑤ Ground terminal
⑥ Cable clamp
⑦ Voltage bus
⑧ Parallel routing of the equipotential bonding conductor and data cable
See also
Electromagnetic compatibility (Page 29)

4.2.2.3 Connecting the PLC
Wiring diagram
The figure below illustrates the connection between the HMI device and PLC.
SIMATIC S7
RS 485
RS 485
Figure 4-4 Connecting the PLC
NOTICE
Always use the approved cables for connecting a SIMATIC S7 PLC.
Standard cables are available for the connection. For further information, refer to the
SIMATIC HMI Catalog ST 80.
See also
Interfaces (Page 43)
4.2.2.4 Connecting the configuration computer
Wiring diagram
The figure below illustrates the connection between the HMI device and configuration
computer.
PC
MPI
MPI/PROFIBUS DP
PC
RS 485
RS 232
RS 232
Figure 4-5 Connecting the configuration computer

See also
Starting the transfer manually (Page 107)
Starting the transfer automatically (Page 108)
Backup and Restore via WinCC flexible (Page 114)
Backup and Restore via ProSave (Page 116)
Updating the Operating System Using WinCC flexible (Page 122)
Updating the Operating System Using ProSave (Page 123)
4.2.2.5 Connecting the power supply
Wiring diagram for the power supply module

The figure below illustrates the connection between the power supply and the HMI device.
Figure 4-6 Connecting the power supply
Note when connecting

The power terminal block is included in the assembly kit and is designed for conductors with
a maximum cross-section of 1.5 mm2.

Connecting the terminal block
NOTICE
Damage
Pressure on the screwdriver may damage the HMI device socket if the terminal block is
plugged in when you tighten the screws.
Always remove the terminal block to connect the wires.
*1'
DC +24 V
Figure 4-7 Connecting the terminal block
Connect the power supply cables to the terminal block as shown in the figure above. Ensure
that the cables are not crossed. Refer to the label showing the pin-out on the rear of the HMI
device.
Polarity reversal protection

The HMI device is equipped with a polarity reversal protection circuit.
Connecting the power supply
CAUTION
Ensure safe electrical insulation of the power supply. Always use power supply modules
that conform to IEC 364-4-41 or HD 384.04.41 (VDE 0100, Part 410).
Always use power supply modules that comply to SELV (Safety Extra-Low Voltage) and
PELV (Protective Extra Low Voltage) standards.
The power supply voltage must always be within the specified range to prevent
malfunctions on the HMI device.
Equipotential bonding
Therefore, wire the 24 V output of the power supply to the equipotential circuit.
See also

4.2.3 Switching on power and testing the HMI
Procedure
Proceed as follows:
1. Plug the terminal block into the HMI device.
2. Switch on the power supply.
After power is on, the display lights up and the bootloader appears briefly.
OP 73
bootloader vx.xx
(2004-xx-xx)
Figure 4-8 Bootloader display (example)

If the HMI device does not start, it is possible the wires on the terminal block have been
crossed. Check the connected wires and change the connections if necessary. The
Loader opens once the operating system has started.
Loader
Transfer
Start
Figure 4-9 Loader view

The HMI device automatically sets transfer mode during initial startup if it does no contain
any project data yet. The following dialog appears:
Transfer
Connecting to host.
Figure 4-10 "Transfer" dialog

HELP
3. Press to cancel the transfer.

ESC
Result
The Loader appears again.
Note
When restarting the system, a project may already be loaded on the HMI device. The system
then skips transfer mode and starts the project.
Close the project by pressing the corresponding control object.
Further information on this may be available in your plant documentation.

Navigating in the Loader
Button Action
+/– TAB
Press one of these cursor keys to select the next entry in arrow
or direction.
ENTER
• The input is confirmed.
• The submenu or dialog shown below opens.
HELP
ESC
• Move back
Returns to the next higher menu layer.
• Cancel transfer mode
Function test
Perform a function test following commissioning. The HMI device is fully functional when one
of the following states is indicated:
● The "Transfer" dialog is displayed.
● The Loader is displayed.
● A project is started.
Switching off the HMI device

You can switch off the HMI device in the following ways:
● Switch off the power supply.
● Disconnect the terminal block from the HMI device.

4.3 Mounting and connecting the OP 77A and OP 77B
4.3.1 Mounting the HMI device
Requirements
Four mounting clamps from the kit are needed to mount the HMI device. The mounting seal
must be available on the HMI device. If the mounting seal is damaged, order a replacement
seal. The mounting seal is part of the associated service pack.
Mounting
NOTICE
Always mount the HMI device according to the instructions in this manual.
Proceed as follows:
1. Check that the mounting seal is fitted on the HMI device.
Do not install the mounting seal turned inside out. This may cause leaks in the mounting
cut-out.
2. Insert the HMI device into the mounting cut-out from the front.
3. Insert the mounting clamps into the recesses on each side of the HMI device.
Figure 4-11 Inserting the clamp
Insert all four clamps in the HMI device and fasten them.
1. Tighten the clamps by screwing down the recessed head screw; permitted torque:
0.15 N/m.
NOTICE
Check the fit of the mounting seal on the front. The mounting seal must not protrude
from the HMI device
Otherwise, repeat steps 1 to 4.

4.3.2 Connecting the HMI device
Requirement
The HMI device must be mounted according to the specifications of these operating
instructions.
Connection sequence
Connect the HMI device in the following sequence:
1. Equipotential bonding
2. Power supply
Perform a power-up test to ensure that the correct polarity of the supply voltage.
3. PLC/configuration computer as necessary
4. Peripheral equipment as necessary
NOTICE
Connection sequence
Always follow the correct sequence for connecting the HMI device. Failure to do so may
result in damage to the HMI device.
Connecting the cables

When connecting the cables, ensure that you do not bend any of the contact pins.
Secure the connectors with screws.
Always use shielded data cable. Always use standard cables. Additional information can be
found in the SIMATIC HMI Catalog ST 80.
The pin assignment of the interfaces is described in the specifications.

4.3.2.1 Interfaces
The figures below show the interfaces of the HMI device.
1 2 3
Figure 4-12 Interfaces of OP 77A
1 2 3 4 5
Figure 4-13 Interfaces of OP 77B
1 Power supply connector

2 RS 485 interface (IF 1B) of OP 77A
RS 422/RS 485 interface (IF 1B) of OP 77B
3 Chassis ground terminal
4 RS 232 interface (IF 1A)
5 USB port
See also
Power supply (Page 197)
RS 485 (IF 1B) on OP 73 (Page 197)
RS 422/RS 485 (IF 1B) on OP 77B (Page 198)
USB on OP 77B (Page 200)
RS 232 (IF 1A) on OP 77B (Page 199)
RS 485 (IF 1B) on OP 77A (Page 198)

4.3.2.2 Connecting the equipotential bonding circuit
Potential differences
Differences in potential between spatially separated system parts can lead to high equalizing
currents over the data cables and therefore to the destruction of their interfaces. This
situation may arise if the cable shielding is terminated at both ends and grounded at different
system parts.
Potential differences may develop when a system is connected to different mains.
General requirements of equipotential bonding

Potential differences must be reduced by means of equipotential bonding in order to ensure
trouble-free operation of the relevant components of the electronic system. The following
must therefore be observed when installing the equipotential bonding circuit:
● The effectiveness of equipotential bonding increases as the impedance of the
equipotential bonding conductor decreases or as its cross-section increases.
● If two system parts are connected to each other via shielded data lines with shielding
connected to the grounding/protective conductor on both sides, the impedance of the
additionally installed equipotential bonding cables may not exceed 10% of the shielding
impedance.
● The cross-section of a selected equipotential bonding conductor must be capable of
handling the maximum equalizing current. The best results for equipotential bonding
between two cabinets were achieved with a minimum conductor cross-section of 16 mm2.
● Use equipotential bonding conductors made of copper or galvanized steel. Establish a
large-surface contact between the equipotential bonding conductors and the
grounding/protective conductor and protect these from corrosion.
● Terminate the shielding of the data cable on the HMI device flush and near the
equipotential busbar using suitable cable clamps.
● Route the equipotential bonding conductor and data cables in parallel with minimum
clearance between these. See the wiring diagram.
NOTICE
Equipotential bonding conductor
Cable shielding is not suitable for equipotential bonding. Always use the prescribed
equipotential bonding conductors. The minimum cross-section of a conductor used for
equipotential bonding is 16 mm². When you install MPI and PROFIBUS DP networks,
always use cables with a sufficient crosssection since otherwise the interface modules
may be damaged or destroyed.

4.3.2.3 Installing the equipotential circuit
Wiring diagram
3 3
5 6 7 8
Figure 4-14 Installing the equipotential circuit
① Chassis ground terminal on the HMI device (example)

② Equipotential bonding conductor cross-section: 4 mm2
③ Cabinet
④ Equipotential bonding conductor cross-section: min. 16 mm2
⑤ Ground terminal
⑥ Cable clamp
⑦ Voltage bus
⑧ Parallel routing of the equipotential bonding conductor and data cable
See also

4.3.2.4 Connecting the PLC
Wiring diagram
The figure below illustrates the connection between the HMI device and PLC.
SIMATIC S7
RS 485
RS 485
Figure 4-15 Connecting a PLC to OP 77A

See also
4.3.2.6 Wiring I/O to OP 77B
Wiring diagram
The diagram below shows the connection between the HMI device and peripherals.
A printer can be connected as a peripheral.
USB
Figure 4-19 Connecting a printer to the OP 77B
NOTICE
Use the driver for the USB host adapter which is included in the WinCC flexible package.
Do NOT use the driver which is supplied with the adapter kit.
Always use cables with metal shielding braid which is grounded on both ends to connect
the printer to the HMI device.
On some printers you may also have to set the ASCII character set used in the project.
A list of printers released by Siemens AG is available in the Siemens Catalog ST 80, chapter
80. A current list of released printers is available on the Internet under Service & Support.
NOTICE
Rated load of the interface
The load capacity of the USB port is limited to 100 mA. Avoid any higher loads. Equipment
connected to the port may otherwise malfunction.

Note
Documentation for peripherals
Observe the printer documentation when you connect the printer.
See also



See also
4.3.2.6 Wiring I/O to OP 77B
Wiring diagram
The diagram below shows the connection between the HMI device and peripherals.
A printer can be connected as a peripheral.
USB
Figure 4-19 Connecting a printer to the OP 77B
NOTICE
Use the driver for the USB host adapter which is included in the WinCC flexible package.
Do NOT use the driver which is supplied with the adapter kit.
Always use cables with metal shielding braid which is grounded on both ends to connect
the printer to the HMI device.
On some printers you may also have to set the ASCII character set used in the project.
A list of printers released by Siemens AG is available in the Siemens Catalog ST 80, chapter
80. A current list of released printers is available on the Internet under Service & Support.
NOTICE
Rated load of the interface
The load capacity of the USB port is limited to 100 mA. Avoid any higher loads. Equipment
connected to the port may otherwise malfunction.

Note
Documentation for peripherals
Observe the printer documentation when you connect the printer.
See also



Connecting the terminal block
NOTICE
Damage
Pressure on the screwdriver may damage the HMI device socket if the terminal block is
plugged in when you tighten the screws.
Always remove the terminal block to connect the wires.
*1'
DC +24 V
Figure 4-21 Connecting the terminal block
Connect the power supply cables to the terminal block as shown in the figure above. Ensure
that the cables are not crossed. Refer to the label showing the pin-out on the rear of the HMI
device.
Polarity reversal protection

The HMI device is equipped with a polarity reversal protection circuit.
Connecting the power supply
CAUTION
Ensure safe electrical insulation of the power supply. Always use power supply modules
that conform to IEC 364-4-41 or HD 384.04.41 (VDE 0100, Part 410).
Always use power supply modules that comply to SELV (Safety Extra-Low Voltage) and
PELV (Protective Extra Low Voltage) standards.
The power supply voltage must always be within the specified range to prevent
malfunctions on the HMI device.
Equipotential bonding
Therefore, wire the 24 V output of the power supply to the equipotential circuit.
See also

4.3.3 Switching on power and testing the HMI
Switching on power and testing the HMI device

Proceed as follows:
1. Plug the terminal block into the HMI device.
2. Switch on the power supply.
After power is on, the display lights up and the bootloader appears briefly.
Bootloader
Version x.x
Date: xx.xx.xxxx
Figure 4-22 Bootloader display, example OP 77B
If the HMI device does not start, it is possible the wires on the terminal block have been
crossed. Check the connected wires and change the connections if necessary. The
Loader menu opens after the operating system has started.
Loader B 7.0.0.52
Transfer
Start
Info/Settings
Figure 4-23 Loader view
The HMI device automatically sets transfer mode during initial startup if it does no contain
any project data yet. This opens the following dialog:
Transfer ...
Connecting to host ...
Press ESC to cancel
Figure 4-24 "Transfer" dialog
3. Press ESC
to cancel the transfer.
Result
The Loader appears again.
Note
When restarting the system, a project may already be loaded on the HMI device. The system
then skips transfer mode and starts the project.
Close the project by pressing the corresponding control object.

Button Action
Pressing one of these keys selects the menu command one level up.
or Pressing the key longer moves the selection continuously.
Pressing one of these keys selects the menu command one level down.
or Pressing the key longer moves the selection continuously.
ENTER
• The input is confirmed.
• The submenu or dialog shown below opens.
ESC • Move back
• Cancel transfer mode
Function test
Perform a function test following commissioning. The HMI device is fully functional when one
of the following states is indicated:
● The "Transfer" dialog is displayed.
● The Loader is displayed.
● A project is started.
Switching off the HMI device

Options for switching off the HMI device:
● Switch off the power supply.
● Disconnect the terminal block from the HMI device.


Operator control components and LEDs 5
5.1 Control elements on the OP 73 front panel
Figure 5-1 Operator control components and LEDs
① Soft keys
② System keys – control keys
Standard input device at the HMI device is the keyboard. This is basically composed of two
key groups:
● Soft keys
F1 to F4
The soft keys can only be assigned within a project and do not have any function in the
Loader menu.
● System keys
These include the control keys, for example.
NOTICE
Unintentional actions
Unwanted actions may be triggered if the operator unintentionally actuates several keys
at once.
Never press more than two keys simultaneously.
Keyboard damage
Operation of the keys with hard, pointed or sharp objects or hard impact may lead to a
considerable reduction of the service life and even to complete failure.
Always use your fingers to operate the keys of your HMI device.

Operator control components and LEDs
5.2 Operator control components and LEDs on the front panel of OP 77A and OP 77B
See also
Design of the OP 73micro HMI device (Page 14)
5.2 Operator control components and LEDs on the front panel of OP 77A
and OP 77B
1
4
2 5
Figure 5-2 Operator control components and LEDs
① Function keys without LED

② Function keys with LED
③ System keys – numerical keypad
④ "Alarm indicator" LED
⑤ "Infotext" LED
⑥ System keys – control keys
Standard input device at the HMI device is the keyboard. This is basically composed of two
key groups:
● Soft keys
F1 to F4, and K1 to K4
The soft keys can only be assigned within a project and do not have any function in the
Loader menu.
● System keys
The numerical keypad and control keys belong to this group.

5.3 Additional elements on the OP 77A and OP 77B
NOTICE
Unwanted actions may be triggered if the operator unintentionally actuates several keys
at once.
Keyboard damage
Operation of the keys with hard, pointed or sharp objects or hard impact may lead to a
considerable reduction of the service life and even to complete failure.
Always use your fingers to operate the keys of your HMI device.
See also
Design of the OP 77A HMI device (Page 15)

Operator control components on the side and rear panel of the HMI device:
● Memory Card slot of OP 77B
● Labeling strip guides on OP 77A and OP 77B
● DIL switch for toggling the RS 422/RS 485 ports on OP 77B

5.3.1 Use of a memory card on OP 77B
Procedure - Inserting a memory card

Proceed as follows:
1. Insert the MMC into the memory card slot.
1 3
Figure 5-3 Inserting a memory card
① Memory card slot

② Memory card interlock
③ MMC
When inserting the memory card, please note that it can only be inserted as shown in the
diagram. The MMC is inserted correctly in the memory card slot when the card interlock
engages.
NOTICE
Data loss
When requested by the HMI device to format an MCC for first time use, you should save a
backup copy of MCC data to a PC.
To prevent loss of data:
ESC
1. Cancel the format operation with .
2. Save a backup copy of vital data to a PC.
3. Format the MMC on the HMI device.
4. Restore the backup data to the MMC.
You can now transfer the backup data from the MMC to the HMI device.
Do not insert or remove the MMC while its data is being accessed by an application, for
example, by an active backup function or recipe transfer. The MMC can be inserted and
removed during runtime in any other situation.

Procedure - Removing a memory card
NOTICE
Data loss
All data on the MMC is lost if you attempt to remove it while the HMI device is accessing its
data.
Do not remove the MMC while data is being accessed. Observe the corresponding alarms
on the screen.
Figure 5-4 Removing the memory card
① Eject button
② MMC
Proceed as follows:
1. Press the ejection mechanism.
This slides the MMC out of the slot.
2. Store the memory card in a protective case.
NOTICE
Do not force the ejector. This could damage its mechanism.

5.3.2 Labeling the function keys of OP 77A and OP 77B
Labeling the function keys

Label the function keys as required for your project. Use labeling strips to do so.
Figure 5-5 Labeling the function keys
① Guides for the labeling strips

The labeling strips can be inserted before or after you installed the HMI device.
Printing labeling strips

The labeling strip templates are available on the "WinCC flexible" installation CD, under
"\Support\Documents\SLIDE_OP77B.DOC".
Observe the information in this file.
25,6 25,6 25,6 2 x 45°

16 –1
15
15,3
8,25
160
Figure 5-6 Dimensions of the labeling strip
Printable foil or paper can be used as labeling strips. Use transparent foil to retain visibility of
the function key LED. Permitted thickness of the labeling strip: 0.15 mm.

Procedure
Proceed as follows:
1. Edit and then print the template.
You can also print blank templates and label them manually.
NOTICE
Do not write on the keyboard to label the function keys.
2. Cut out labeling strips

Ensure that the corners are cut according to the diagram shown above. This makes it
easier to slide them into the guide.
3. Remove any old labeling strips.
4. Slide the labeling strips into the guide.
Note
Wait for the printed labeling strips to dry before you insert them.
Figure 5-7 Inserting the labeling strips

① Labeling strips
② Guide
5. Slide the labeling strips into the guide up to the end stop.
The labeling strip will protrude approximately 1 cm out of the guide. Select the template
dimensions so that the labeling is correctly placed behind the function key fields. An
interlock is not required for the labeling strips.
5.3.3 Setting the DIL switch

The DIL switches are already configured for connecting the HMI device to a SIMATIC S7.
See also
Connecting the PLC (Page 56)


Configuring the operating system 6
6.1 Configuring the operating system of the OP 73
6.1.1 Overview
Loader
The figure below shows the Loader. It appears briefly when the HMI device starts up.
Loader
Transfer
Start
Info/Settings
Figure 6-1 Loader
The Loader menu commands have the following functions:

● "Transfer"
Select this menu command to set the HMI device transfer mode.
● "Start"
Select this menu command to start the project which is stored on the HMI device.
● "Info/Settings"
Select this menu command to open the HMI device configuration menu.
The Loader also appears when you close the project.
Button Action
+/– TAB
By pressing one of these buttons, you select the next menu command
or in the direction of the cursor key.
ENTER
The corresponding menu opens.
HELP
ESC

Configuring the operating system
Editing dialog entries
Button Action
+/– TAB
Selects the previous or next list entry.
or
ENTER
The selected list entry is accepted.
You can undo your input as long you have not yet confirmed the
HELP
ESC
selected list entry with .

ENTER
See also
Switching on power and testing the HMI (Page 49)
6.1.2 "Info/Settings" menu
6.1.2.1 Overview
Requirements
"Info/Settings" was called in the Loader.
"Info/Settings" menu
Info/Settings
Contrast
Device Info
Version Info
Logon/Settings
Figure 6-2 "Info/Settings" menu
"Contrast" Menu command for setting the display contrast

"Device Info" Menu command with information on the HMI device
"Version Info" Menu command with information on the version of the HMI device image
"Logon/Settings" Menu command of the "Logon/Settings" menu

Password protection
You can protect the "Logon/Settings" menu from unauthorized access by assigning a
password.
This prevents inadvertent wrong operation and increases security for the plant or machine
security because access to the settings is denied. If the user does not enter a password, this
user can only access the "Contrast", "Device Info" and "Version Info" menu commands.
When a password is assigned, the following dialog appears when the user attempts to open
the "Logon/Settings" menu:
Password
|
Figure 6-3 Password dialog
You need to enter the password again to access the "Logon/Settings" menu after you closed
the previous session.
NOTICE
Password no longer available
If the Loader password is no longer available, you can only call the "Logon/Settings" menu
again after you update the operating system.
All data on the HMI device will be overwritten when you update the operating system.
Note
The currently active entry is always indicated in a dialog.
See also
Assigning, changing and deleting passwords (Page 79)

6.1.2.2 Setting screen contrast
Requirements
"Info/Settings ▶ Contrast" was selected from the Loader menu.
Principle
Contrast
Press Up/Down to
change contrast.
Figure 6-4 "Contrast" dialog
This dialog is used to adjust the contrast and therefore indirectly controls screen brightness.
NOTICE
Screen contrast
The screen contrast can be increased and reduced within a wide range. Note that this may
lead to the screen content becoming unrecognizable under unfavorable lighting conditions.
+/– TAB
reduces the contrast and increases the contrast.
6.1.2.3 Displaying information about the HMI
Requirements
"Info/Settings ▶ Device Info" was selected from the Loader menu.
Principle
Device Info
Device: OP 73
Flashsize: 2 MB
Figure 6-5 "Device Info" dialog
This dialog is used to indicate the name of the HMI device ("Device") and the size of internal
Flash memory ("Flashsize"). The Flash memory is used to store the HMI device image and
project data. The size of the internal Flash memory does not correspond to the available
working memory for a project.

6.1.2.4 Viewing information about the version of the HMI image
Requirements
"Info/Settings ▶ Version Info" was selected from the Loader menu.
Principle
Version Info
01.00.00.00_05.08
BL 0.17/2004-xx-xx
Figure 6-6 "Version Info" dialog – Example
The "Version Info" dialog shows information on the Bootloader and the HMI device image file
and therefore the version of the operating system.
This information is required when you contact A&D Technical Support.
6.1.3 "Settings" menu
6.1.3.1 Overview
Requirement
"Info/Settings ▶ Logon/Settings" was selected from the Loader menu. You have entered the
password for the "Settings" menu.
"Settings" menu
Settings
Startup Delay
Screensaver
---------------
Figure 6-7 "Settings" menu
"Startup Delay" Menu command for setting the startup delay on the HMI device
"Screen Saver" Menu command for the screen saver
"Password" Menu command for the password
"Transfer Settings" Menu command for transfer settings
Select the "Settings" menu to edit the system settings for your HMI device.
Access to this menu can be protected by a password.

Procedure
Proceed as follows:
1. Close the project.
2. Open the "Logon/Settings" menu.
3. Edit the settings.
4. Close the "Logon/Settings" menu.
6.1.3.2 Setting the delay
Requirements
"Info/Settings ▶ Logon/Settings ▶ Startup Delay" was selected from the Loader menu.
Principle
Startup Delay
Value: 3 Sec.
Figure 6-8 "Startup Delay" dialog
The delay defines the period which the HMI device automatically delays the startup of a
stored project.
When the value "0" is set, the project starts immediately. It is then no longer possible to call
the Loader after switching on the HMI device. To handle this situation, you must have
configured an operator control object you can use to close the project.
Valid range of values: 0 s to 60 s.
6.1.3.3 Setting the screen saver
Requirement
"Info/Settings ▶ Logon/Settings ▶ Screen saver" was selected from the Loader menu.
Principle
Screensaver
Value: 0 Min.
Figure 6-9 "Screen saver" dialog
Use this dialog to set the activation delay for the screen saver.
Valid range of values: 5 min to 360 min. The screen saver is disabled when you set 0.

6.1.3.4 Assigning, changing and deleting passwords
Introduction
To restrict access to the "Settings" menu to specific members of staff, define a password in
the "Password" dialog.
Requirements
● "Info/Settings ▶ Logon/Settings ▶ Password" was selected from the Loader menu.
● The "Password" dialog opens.
Password
|
Figure 6-10 "Password" dialog
Procedure – Assigning and editing passwords

Proceed as follows:
1. Enter the password.
TAB +/– INS
Select the first character with or . Press to enter additional characters.
Note
Password entry
The last character of the password entered is shown in plain text. The remaining
characters are represented by a ∗ character.
2. Press ENTER
You have now completed entry of the password. The "Confirm Password" dialog appears.
Confirm Password
|
Figure 6-11 "Confirm Password" dialog
You need to enter the password twice to confirm it.

1. Enter the password again.
2. Press ENTER
,
You have now completed the password confirmation. The password is accepted if both
password entries are identical. Otherwise, an error message appears. The "Settings"
menu opens. Repeat the password input.

Result
● The "Settings" menu opens.
● The "Settings" menu is password protected.
Procedure – Deleting a password

Proceed as follows:
ENTER
1. Press – do not enter any other characters.
The "Confirmation" dialog opens.
2. Press ENTER
– do not enter any other characters.
The system confirms the deletion.
Result
● You have revoked the password protection of the "Settings" menu.
See also
Overview (Page 74)
6.1.3.5 Configuring the data channel
Introduction
By disabling a data channel, you can protect the HMI device from unintentional overwriting of
project data and of the HMI device image.
Requirements
"Info/Settings ▶ Logon/Settings ▶ Transfer Settings" was selected from the Loader menu.
Overview
Transfer Settings
Channel 1: serial
Channel 2: MPI/DP
MPI/DP Address
MPI/DP Baudrate
Figure 6-12 "Transfer Settings" menu
Note
You can set each dialog entry separately. Default entry for "Channel 2: MPI/DP" is
"disabled".

Serial channel
Channel 1: serial
Value: Enable
Figure 6-13 "Channel1: Serial" dialog
+/– TAB
This dialog is used to configure the RS495 port for serial data transfer. Select or
to make the following settings:
● "Disable"
Serial data transfer is disabled.
● "Enable"
Serial data transfer is enabled.
MPI/PROFIBUS DP channel
Channel 2: MPI/DP
Value: Disable
Figure 6-14 "Channel 2: MPI/DP" dialog
Use this dialog to set the transfer parameters for the MPI/PROFIBUS DP interface. Select
+/– TAB
or to make the following settings:

● "Disable"
MPI/PROFIBUS DP data transfer is disabled.
● "Enbl (rem. off)"
MPI/PROFIBUS DP data transfer is enabled. Automatic transfer is disabled.
● "Enbl (rem. off)"
MPI/PROFIBUS DP data transfer is enabled. Automatic transfer is enabled.
MPI/PROFIBUS DP address
MPI/DP Address
Value: 1
Figure 6-15 "MPI/DP Address" dialog
Use this dialog to set the MPI/PROFIBUS DP address of the HMI device. Permitted range of
values: 0 to 126.
Note
The assigned MPI/PROFIBUS DP address must be unique in the network.

MPI/PROFIBUS DP baud rate
MPI/DP Baudrate
Value: 187.5 kBaud
Figure 6-16 "MPI/DP Baudrate" dialog

+/–
Use this dialog to set the MPI/PROFIBUS DP baud rate for the HMI device. Select or
TAB

● "1500 Kbps"
● "187.5 Kbps"
● "19.2 Kbps"
● "9600 bps"
If the HMI device is a node on the MPI/PROFIBUS DP network, the value setting is derived
from MPI/PROFIBUS DP network configuration. Select the corresponding value.
Note
MPI/DP baud rate
The MPI/PROFIBUS DP baud rate must be consistent throughout the network.
Procedure – Setting the serial channel

Proceed as follows:
1. Select "Channel 1: Serial".
Procedure – Setting the MPI/PROFIBUS DP channel

Proceed as follows:
1. Select "Channel 2: MPI/DP".
2. Set automatic transfer.
Enable or disable the automatic transfer of a project. Automatic transfer is enabled when
"Remote on" is set.
3. Set the MPI/PROFIBUS DP address.
4. Set the MPI/PROFIBUS DP baud rate.
5. Open the loader.
Result
The data channel is configured.

General notes
WARNING
Unintentional Transfer mode
Ensure that the configuration computer does not inadvertently switch the HMI device to
Transfer mode during ongoing operation. This could cause unintentional actions to be
triggered in the plant.
NOTICE
Transfer mode using MPI/PROFIBUS DP
For MPI/PROFIBUS DP transfer, the bus parameters, for example the MPI/PROFIBUS DP
address of the HMI device, are read from the current project on the HMI device.
The settings for MPI/PROFIBUS DP transfer can be modified. For this, you must first close
the project and then change the settings on the HMI device. Then go back to "Transfer"
mode.
The HMI device uses the new MPI/DP settings until you transfer a new project to it. During
the next transfer of a project to the HMI device, the MPI/DP settings will be overwritten with
the values from the transferred project.
You can thus edit the MPI/DP settings irrespective of the project settings.
Transfer settings
A project can only be transferred from the configuration computer to the HMI device when
at least one of the data channels is enabled on the HMI device.

6.2 Configuring the OP 77A and OP 77B operating system
6.2.1 Overview
Loader
The figure below shows the Loader. It appears briefly when the HMI device starts up.
Loader B 7.0.0.52
Transfer
Start
Info/Settings
Figure 6-17 Loader on the OP 77B (example)
The Loader menu commands have the following functions:

● "Transfer"
Select this menu command to set the HMI device transfer mode.
● "Start"
Select this menu command to start the project which is stored on the HMI device.
● "Info/Settings"
Select this menu command to open the HMI device configuration menu.
The Loader also appears when you close the project.
Button Action
By pressing one of these buttons, you select the next menu command
or in the direction of the cursor key.
ENTER
The corresponding menu opens.
ESC Returns to the next higher menu layer.
Editing dialog entries
Button Action
Selects the previous or next list entry.
or
END
You can use the numerical keypad for direct input of values.
0 9
up to
ENTER
The selected list entry is accepted.
ESC You can undo your input as long you have not yet confirmed the
selected list entry with .

ENTER

See also
Switching on power and testing the HMI (Page 62)
6.2.2 "Info/Settings" menu
6.2.2.1 Overview
Requirements
"Info/Settings" was called in the Loader.
"Info/Settings" menu
Info/Settings
Contrast
Device Info
Version Info
Logon/Settings
Figure 6-18 "Info/Settings" menu
"Contrast" Menu command for setting the display contrast

"Device Info" Menu command with information on the HMI device
"Version Info" Menu command with information on the version of the HMI device image
"Logon/Settings" Menu command of the "Logon/Settings" menu
Password protection
You can protect the "Logon/Settings" menu from unauthorized access by assigning a
password.
This prevents inadvertent wrong operation and increases security for the plant or machine
security because access to the settings is denied. If the user does not enter a password, this
user can only access the "Contrast", "Device Info" and "Version Info" menu commands.
When a password is assigned, the following dialog appears when the user attempts to open
the "Logon/Settings" menu:
Logon / Settings
Password:
Figure 6-19 Password dialog, example OP 77B
You need to enter the password again to access the "Logon/Settings" menu after you closed
the previous session.

NOTICE
Password no longer available
If the Loader password is no longer available, you can only call the "Logon/Settings" menu
again after you update the operating system.
All data on the HMI device will be overwritten when you update the operating system.
Note
The currently active entry is always indicated in a dialog.
See also
Assigning, editing and deleting passwords (Page 90)
6.2.2.2 Setting screen contrast
Requirements
"Info/Settings ▶ Contrast" was selected from the Loader menu.
Principle
Contrast
Press Up/Down to
change contrast
Figure 6-20 "Contrast" dialog
This dialog is used to adjust the contrast and therefore indirectly controls screen brightness.
NOTICE
Screen contrast
The screen contrast can be increased and reduced within a wide range. Note that this may
lead to the screen content becoming unrecognizable under unfavorable lighting conditions.
reduces the contrast and increases the contrast.

6.2.2.3 Displaying information about the HMI
Requirements
"Info/Settings ▶ Device Info" was selected from the Loader menu.
Principle
Device Info
Device: OP 77A
Flashsize: 2 MB
Figure 6-21 "Device Info" dialog for OP 77A
Device Info
Device: OP 77B
Flashsize: 4 MB
Figure 6-22 "Device Info" dialog for OP 77B
This dialog is used to indicate the name of the HMI device ("Device") and the size of internal
Flash memory ("Flashsize"). The Flash memory is used to store the HMI device image and
project data. The size of the internal Flash memory does not correspond to the available
working memory for a project.
6.2.2.4 Viewing information about the version of the HMI image
Requirements
"Info/Settings ▶ Version Info" was selected from the Loader menu.
Principle
Version Info
01.00.00.00_05.08
BL 0.25/2004-xx-xx
Figure 6-23 "Version Info" dialog for OP 77A, example
Version Info
Bootloader: 1.02/xx.x.2004
Image: B 7.0.0.xx
Figure 6-24 "Version Info" dialog on the OP 77B, example
The "Version Info" dialog shows information on the Bootloader and the HMI device image file
and therefore the version of the operating system.
This information is required when you contact A&D Technical Support.

6.2.3 "Settings" menu
6.2.3.1 Overview
Requirement
"Info/Settings ▶ Logon/Settings" was selected from the Loader menu. You have entered the
password for the "Settings" menu.
"Settings" menu
Settings
Startup Delay
Screensaver
---------------
Figure 6-25 "Settings" menu for OP 77A
Settings
Startup Delay
ScreenSaver
Regional Settings
Password
Backup/Restore
Transfer Settings
Printer Settings
Reset Device
Figure 6-26 "Settings" menu on the OP 77B
"Startup Delay" Menu command for setting the startup delay on the HMI device
"Screen Saver" Menu command for the screen saver
"Regional Settings" Menu command for regional settings
"Password" Menu command for the password
"Backup/Restore" Menu command for backup/restore
"Transfer Settings" Menu command for transfer settings
"Printer Settings" Menu command for printer settings
"Reset Device" Reset menu commands, only appears if a password has been assigned.
Select the "Settings" menu to edit the system settings for your HMI device.
Access to this menu can be protected by a password.
Procedure
Proceed as follows:
1. Close the project.
2. Open the "Info/Settings" menu.
3. Edit the settings.
4. Close the "Info/Settings" menu.

6.2.3.2 Setting the delay
Requirements
"Info/Settings ▶ Logon/Settings ▶ Startup Delay" was selected from the Loader menu.
Principle
Startup Delay
Value: 3 sec
Figure 6-27 "Startup Delay" dialog
The delay defines the period which the HMI device automatically delays the startup of a
stored project.
When the value "0" is set, the project starts immediately. It is then no longer possible to call
the Loader after switching on the HMI device. To handle this situation, you must have
configured an operator control object you can use to close the project.
Valid range of values: 0 s to 60 s.
6.2.3.3 Setting the Screen Saver
Requirement
"Info/Settings ▶ Logon/Settings ▶ Screen saver" was selected from the Loader menu.
Principle
ScreenSaver
Activation: 0 min
Figure 6-28 "Screen Saver" dialog, example OP 77B
Use this dialog to set the activation delay for the screen saver.
You can enter the following values:
● OP 77A: 5 min to 360 min.
● OP 77B: 1 min to 60 min.
The screen saver remains disabled if you enter 0 as the value.

6.2.3.4 Changing regional settings for OP 77B
Requirements
"Info/Settings ▶ Logon/Settings ▶ Regional Settings" was selected from the Loader menu.
Principle
Region
Value: German
Figure 6-29 "Region" dialog
Use this dialog to set the date and time format, for example. The decimal places in numerical
values are delimited either by a point or comma, based on the configured regional language.
Note
If the HMI device operating system does not support a specific project language, it
automatically uses the default set in the "Regional Settings" dialog.
6.2.3.5 Assigning, editing and deleting passwords
Introduction
To restrict access to the "Settings" menu to specific members of staff, define a password in
the "Password" dialog.
Requirements
● "Info/Settings ▶ Logon/Settings ▶ Password" was selected from the Loader menu.
● The "Password" dialog opens.
Password
Password:
Enter new password
Figure 6-30 "Password" dialog, example OP 77B

Procedure – Assigning and editing passwords

Proceed as follows:
Select the first character with or . Press to enter further characters.
Note
Password entry
The last character of the password entered is shown in plain text. The remaining
characters are represented by a ∗ character.
2. Press ENTER
.
You have now completed entry of the password. The "Confirm Password" dialog appears.
Confirmation
Password:
Confirm new password
Figure 6-31 "Confirmation" dialog, example OP 77B

For the password to become valid, it must be entered again to confirm it.
1. Enter the password again.
2. Press ENTER
.
You have now completed entry of the password. The password is accepted if both
password entries are identical. Otherwise, an error message appears. The "Settings"
menu opens. Repeat the password input.
Result
● The "Settings" menu is password protected.
Procedure – Deleting a password

Proceed as follows:
ENTER
1. Press – do not enter any other characters.
The "Confirmation" dialog opens.
2. Press ENTER
– do not enter any other characters.
The system confirms the deletion.
Result
● You have revoked the password protection of the "Settings" menu.

See also
Overview (Page 85)
6.2.3.6 Backup and restore functions for OP 77B
Requirements
● "Info/Settings ▶ Logon/Settings ▶ Backup/Restore" was selected from the Loader menu.
● An MMC is inserted in the HMI device.
Principle
Backup/Restore
Action: Backup
Figure 6-32 "Backup/Restore" dialog
When using an MMC, select the "Backup" and "Restore" functions from this dialog. The
selected "Backup" or "Restore" function is executed immediately when you press ENTER
.
See also
Overview (Page 103)
Backup and restore operations with MMC on OP 77B (Page 118)
6.2.3.7 Configuring the data channel
Introduction
By disabling a data channel, you can protect the HMI device from unintentional overwriting of
project data and of the HMI device image.
Requirements
"Info/Settings ▶ Logon/Settings ▶ Transfer Settings" was selected from the Loader menu.

Overview
Transfer Settings
Channel1: serial
Channel2: MPI/DP
MPI/DP Address
MPI/DP Baudrate
Figure 6-33 "Transfer Settings" menu on OP 77A
Transfer Settings
Channel1: serial
Select Channel2
Channel2: MPI/DP
MPI/DP Address
MPI/DP Baudrate
Figure 6-34 "Transfer Settings" menu for MPI/DP on OP 77B
Transfer Settings
Channel1: serial
Select Channel2
Channel2: USB
Figure 6-35 "Transfer Settings" menu for USB on OP 77B
Note
You can set each dialog entry separately.
Serial channel
Channel1: serial
Value: Enable
Figure 6-36 "Channel1: Serial" dialog on OP 77A
Use this dialog to configure the RS495 port for serial data transfer on the OP 77A. Select
and to make the following settings:
● "Disable"
● "Enable"
Serial data transfer is enabled.

Serial Settings
Value: Enable (remote on)
Figure 6-37 "Channel1: Serial" dialog on OP 77B
Use this dialog to configure the RS232 port for serial data transfer on the OP 77B. Select
● "Disable"
● "Enable (remote off)"
Serial data transfer is enabled. Automatic transfer is disabled.
● "Enable (remote on)"
Serial data transfer is enabled. Automatic transfer is enabled.
USB channel or MPI/PROFIBUS DP channel on OP 77B
Select Channel2
Value: USB
Figure 6-38 "Select Channel2" dialog
Use this dialog to toggle between the MPI/PROFIBUS DP and USB ports. Select and
● "USB"
The USB port is enabled for data channel 2.
● "MPI/DP"
The RS 422/RS 485 interface is enabled for data channel 2.

Channel2: MPI/DP
Value: Disable
Figure 6-39 "Channel2 MPI/DP" dialog on OP 77A
MPI/DP Settings
Figure 6-40 "Channel2 MPI/DP" dialog on OP 77B
Use this dialog to set the transfer parameters for the MPI/PROFIBUS DP interface. Select
● "Disable"
Disables MPI/PROFIBUS DP data transfer.
Enables MPI/PROFIBUS DP data transfer. Automatic transfer is disabled.
Enables MPI/PROFIBUS DP data transfer. Automatic transfer is enabled.
MPI/DP Address
Value: 1
Figure 6-41 "MPI/DP Address" dialog
Use this dialog to set the MPI/PROFIBUS DP address of the HMI device. Permitted range of
values: 0 to 126.
Entries can be made using the numerical keyboard or the cursor keys.
Note
The assigned MPI/PROFIBUS DP address must be unique in the network.

MPI/DP Baudrate
Value: 187,5 kBaud
Figure 6-42 "MPI/DP Baudrate" dialog
Use this dialog to set the MPI/PROFIBUS DP baud rate for the HMI device.
Select and to make the following settings on the OP 77A:

● "1500 Kbps"
● "187.5 Kbps"
● "19.2 Kbps"
● "9600 bps"
Select and to make the following settings on the OP 77B:

● "12 Mbps"
● "6 Mbps"
● "3 Mbps"
● "1.5 Mbps"
● "187.5 Kbps"
● "19.2 Kbps"
If the HMI device is a node on the MPI/PROFIBUS DP network, the value setting is derived
from MPI/PROFIBUS DP network configuration. Select the corresponding value.
Note
MPI/DP baud rate
The MPI/PROFIBUS DP baud rate must be consistent throughout the network.
Procedure – Setting the serial channel

Proceed as follows:
1. Select "Channel 1: Serial".
2. Setting automatic transfer (applies to OP 77B)
"Remote on" is set.

Procedure – Setting the MPI/PROFIBUS DP channel on the OP 77A

Proceed as follows:
1. Select "Channel 2: MPI/DP".
"Remote on" is set.
Procedure – Setting the MPI/PROFIBUS DP channel on the OP 77B

Proceed as follows:
1. Select "Select Channel 2".
2. Select "MPI/PROFIBUS DP".
"Remote on" is set.
WARNING
6. Open the loader.
Result

General notes
NOTICE
Transfer mode using MPI/PROFIBUS DP
For MPI/PROFIBUS DP transfer, the bus parameters, for example the MPI/PROFIBUS DP
address of the HMI device, are read from the current project on the HMI device.
The settings for MPI/PROFIBUS DP transfer can be modified. For this, you must first close
the project and then change the settings on the HMI device. Then go back to Transfer
mode.
OP 77A
The HMI device uses the new MPI/DP settings until you transfer a new project to it. During
the next transfer of a project to the HMI device, the MPI/DP settings will be overwritten with
the values from the transferred project.
You can thus edit the MPI/DP settings irrespective of the project settings.
OP 77B
The HMI device uses the new MPI/DP settings until you start a new project or transfer a
project to it. During the next start or transfer of a project to the HMI device, the MPI/DP
settings will be overwritten with the values from the project.
Transfer settings
A project can only be transferred from the configuration computer to the HMI device when
at least one of the data channels is enabled on the HMI device.
Do not edit the transfer settings while a project is active or the HMI device is in transfer
mode.
Setting the USB channel on OP 77B
USB Settings
Figure 6-43 "Channel 2 USB" dialog on OP 77B
Use this dialog to set the transfer parameters for the USB port. Select and to make
the following settings:
● "Disable"
USB data transfer is disabled.
USB data transfer is enabled. Automatic transfer is disabled.
USB data transfer is enabled. Automatic transfer is enabled.

Procedure – Setting the USB channel on OP 77B

Proceed as follows:
1. Select "Select Channel2".
2. Select "USB".
"Remote on" is set.
WARNING
4. Open the loader.
Result
6.2.4 "Printer Settings" menu of OP 77B
6.2.4.1 Overview
Requirements
"Info/Settings ▶ Logon/Settings ▶ Printer Settings" was selected from the Loader menu.
"Printer Settings" menu
Printer Settings
Printer Language
Paper Size
Orientation
Draft Mode
Figure 6-44 "Printer Settings" menu
"Printer Language" Menu command for setting the printer language

"Paper Size" Menu command for setting the paper format
"Orientation" Menu command for setting the print orientation
"Draft Mode" Menu command for setting the draft mode

6.2.4.2 Set printer language
Requirements
"Info/Settings ▶ Logon/Settings ▶ Printer Settings" was selected from the Loader menu.
Principle
Printer Language
Value: Epson9
Figure 6-45 "Printer Language" dialog
Use this dialog to set the printer language. The following printer languages can be set:
● "Epson9"
● "Epson24"
● "Stylus Color"
● "PLC Laser"
● "PLC Inkjet"
Refer to the printer manual to find out which of these printer languages is used.
6.2.4.3 Setting the paper format
Requirements
"Info/Settings ▶ Logon/Settings ▶ Printer Settings ▶ Paper size" was selected from the
Loader menu.
Principle
Paper Size
Value: A4
Figure 6-46 "Paper Size" dialog
Use this dialog to set the page format for printing. The following page formats are available:
● "A4"
● "Letter"
● "Legal"
● "B5"

6.2.4.4 Setting the print orientation
Requirements
"Info/Settings ▶ Logon/Settings ▶ Printer Settings ▶ Orientation" was selected from the
Loader menu.
Principle
Orientation
Value: Portrait
Figure 6-47 "Orientation" dialog
Use this dialog to set the printer orientation. The following printer orientations are available:
● "Portrait"
The print is output in portrait format.
● "Landscape"
The print is output in landscape format.
6.2.4.5 Setting the print mode
Requirements
The "Info/Settings ▶ Logon/Settings ▶ Printer Settings ▶ Draft Mode" menu command was
selected.
Principle
Draft Mode
Value: Off
Figure 6-48 "Draft Mode" dialog
Use this dialog to set the print quality. The following settings are possible:
● "Off"
Draft mode is disabled. The print is output in best quality.
● "On"
Draft mode is enabled. The print is output in draft quality. The print speed, however, is
higher in this mode.


Preparing and backing up a project 7
7.1 Overview
HMI devices can be used to operate and monitor tasks in process and production
automation. The plant screens on the HMI devices are used to provide a clearer overview of
active processes. The HMI device project, which includes the plant screens, is created
during the configuration phase.
Once the project is transferred to the HMI device and the HMI device is connected to a PLC
in the automation system, processes can be operated and monitored in the process
management phase.
&RQILJXUDWLRQSKDVH &RQILJXUDWLRQ3& &UHDWHSURMHFW

7HVWWKHSURMHFW
6LPXODWHWKHSURMHFW
+0,GHYLFHGHSHQGHQW
6DYHWKHSURMHFW
7UDQVIHUWKHSURMHFW
3URFHVVFRQWUROSKDVH
+0,GHYLFH 2SHUDWHWKHSURMHFW
&RQQHFWLRQWRWKH3/&
3/&
Figure 7-1 Configuration and process management phases

Preparing and backing up a project
7.1 Overview
Transferring the project to the HMI device

The following can be performed to transfer a project to an HMI device:
● Transfer the project from the configuration computer
● Restore the project on the HMI device
A project is restored from the backup copy on MMC to the internal flash memory of the
HMI device.
● Restore the project from a PC using ProSave
In this case, an archived project is transferred from a PC to the HMI device. The
engineering software need not be installed on this PC.
These procedures can be are available for commissioning and recommissioning a project.
Commissioning and recommissioning

● When the HMI device is commissioned there is no project at first.
The HMI device is also in this state after the operating system has been updated.
● When recommissioning, any project on the HMI device is replaced.
Transfer, backup and restore functions

OP 77B supports backup and restore functions with MMC.
2 4
Figure 7-2 Schematic diagram of the transfer, backup and restore functions
① Configuration computer with project file *.hmi

② Transfer, backup and restore operations
③ HMI device with executable *.fwx project
④ Backup and Restore functions
⑤ MMC with compressed project file *.pdz

7.1 Overview
7.1.1 Setting the operating mode
Operating modes
Operating modes of the HMI device:
● Offline
● Online
● Transfer
"Offline mode" and "Online mode" can be set on the configuration computer and on the HMI
device. To set these modes on the HMI device, use a corresponding operator control object
of the project.
Changing the operating mode

The configuration engineer must have configured an appropriate operator control object to
allow a change of the operating mode on the HMI device during ongoing operation.
"Offline" mode
In this mode, there is no communication between the HMI device and PLC. Although the
HMI device can be operated, it cannot exchange data with the PLC.
"Online" mode
In this mode, the HMI device and PLC communicate. You can operate the plant on the HMI
device according to your system configuration.
"Transfer" mode
In this mode, you can transfer a project from the configuration computer to the HMI device or
backup and restore HMI device data, for example.
The following options are available for setting "Transfer" mode on the HMI device:
● When the HMI device starts up
Start "Transfer" mode manually in the HMI device Loader.
● During ongoing operation
Start transfer mode manually within the project using an operator control object. The HMI
device toggles to "Transfer" mode when automatic mode is set and a transfer is initiated
on the configuration computer.

7.1 Overview
7.1.2 Reusing existing projects

You can reuse projects created for an OP3 HMI device on an OP 73. You can also reuse
existing projects created for an OP7 HMI device on an OP 77A or OP 77B.
The following cases are possible:
● OP3 to OP 73
Migrate the project to WinCC flexible.
● OP7 to OP 77B
Migrate the project to WinCC flexible.
● OP7 to OP 77A
Migrate the project to WinCC flexible, then replace OP7 with an OP 77A HMI device in
WinCC flexible.
For further information, refer to the WinCC flexible Online Help or to the "WinCC flexible
Migration" user manual..
7.1.3 Data Transfer Options
Overview
The table below shows the options for transferring data between the configuration computer
and OP 73, OP 77A and OP 77B.
Type Type OP 73 OP 77A OP 77B

Backup Serial (with reset to factory setting) No No No
Serial Yes Yes Yes
MPI/PROFIBUS DP Yes Yes Yes
USB No No Yes
Restore Serial (with reset to factory setting) Yes1/No2 Yes1/No2 No
Serial No1/Yes2 Yes Yes
MPI/PROFIBUS DP No1/Yes2 Yes Yes
USB No No Yes
Operating system Serial (with reset to factory setting) Yes Yes Yes
update Serial Yes Yes Yes
USB No No Yes
Transfer of a project Serial (with reset to factory setting) No No No
Serial Yes Yes Yes
USB No No Yes
1 Applies to complete restore

2 Applies to restoring the password list

7.2 Transfer
Serial data transmission with OP 73 and OP 77A

You can use one of the following adapters for serial transmission between OP 73 or OP 77A
and a configuration PC:
● RS 232/PPI cable MM Multimaster
● USB/PPI cable MM Multimaster (as of manufacturer version 05 of the cable)
Serial data transmission with the OP 77B

Use an RS 232 / null-modem cable for serial transmission between OP 77B and a
configuration PC.
7.2 Transfer
7.2.1 Overview
Transfer
During transfer, the project is downloaded from the configuration computer to the HMI
device.
The "Transfer" mode can be started manually or automatically on the HMI device.
Transferred data is written directly to the flash memory on the HMI device. The transfer
function uses a data channel you need to configure before you initiate any transfers.
7.2.2 Starting the transfer manually
Introduction
You can set "Transfer" mode manually on the HMI device using a configured operator
control object and during ongoing operation.
Requirements
● The *.hmi project is opened in WinCC flexible.
● The HMI device is connected to a configuration computer.
● The data channel is configured on the HMI device.
● The HMI device Loader is opened.

7.2 Transfer
Procedure
Proceed as follows to initiate the transfer:
1. Switch to "Transfer" mode on the HMI device.
2. Proceed as follows on the configuration computer:
– Select the "Project ▶Transfer ▶Transfer Settings" menu command in WinCC flexible.
– Select the HMI device and define the parameters for the connection.
– Start the download with "Transfer".
The configuration computer verifies its connection to the HMI device. If the connection is
not available or is faulty, the configuration computer outputs an alarm. If no
communication error is detected, the project is transferred to the HMI device.
Result
When the transfer is completed successfully, the data can be found on the HMI device. The
transferred project is then started automatically.
See also
Overview (Page 107)
Configuring the data channel (Page 80)
Data Transfer Options (Page 106)
Setting the operating mode (Page 105)
7.2.3 Starting the transfer automatically
Introduction
The HMI device can be automatically switched to "Transfer" mode during runtime as soon as
transfer is started on the configuration computer connected.
Automatic startup is particularly suited for the test phase of a new project since transfer is
completed without interfering with the HMI device.
OP 73 and OP 77A support automatic transfers only via MPI/PROFIBUS DP.

7.2 Transfer
NOTICE
If the automatic transfer has been activated on the HMI device and a transfer is initiated on
the configuration computer, the project currently running is automatically stopped. The HMI
device then automatically switches to "Transfer" mode.
After the commissioning phase, deactivate the automatic transfer so that the HMI device
cannot be inadvertently switched to Transfer mode. The transfer mode can trigger
unintentional actions in the device.
You can set a password in the Loader of the HMI device to restrict access to the transfer
settings and thus avoid unauthorized modifications.
Applies to OP 77B:
The current project can not be closed if there is an active dialog. Close the dialog or cancel
the transfer operation on the configuration computer.
Requirements
● The data channel is configured on the HMI device.
● The automatic transfer is activated in the data channel for the transfer.
● The project is started.
Procedure
Proceed as follows on the configuration computer:
1. Select the "Project ▶Transfer ▶Transfer Settings" menu command in WinCC flexible.
2. Select the HMI device and define the parameters for the connection.
3. Start the download with "Transfer".
The connection to the HMI device is checked. If the connection is not available or
defective, the configuration computer issues the corresponding error message. In the
case of an error-free connection, the HMI device ends the running project and switches to
"Transfer" mode. The selected data is transferred to the HMI device.
Result
When the transfer is completed successfully, the data can be found on the HMI device. The
transferred project is then started automatically.
See also
Overview (Page 107)

7.2 Transfer
7.2.4 Testing a project
Introduction
There are two options on the HMI device testing a project:
● Offline testing of the project
Offline testing means that communication between the HMI device and PLC is down
while the test is being carried out.
● Online testing of the project
Online testing means that the HMI device and PLC communicate with each other during
testing.
Perform both tests, starting with the "Offline test", followed by the "Online test".
Note
Applies to OP 77B:
The project can also be debugged on a configuration computer by means of the Simulator.
For detailed information, refer to the "WinCC flexible" user manual and to the WinCC flexible
Online Help.
Testing a project
You should always test the project on the HMI device on which the project will be used.
Check the following:

1. Check the correct layout of the screens.
2. Check the screen structure.
3. Check the input objects.
4. Enter the tag values.
The test increases the certainty that the project will run error-free on the HMI device.
Requirements for the offline test

● The project has been transferred to the HMI device.
● The HMI device is in "Offline" mode.
Procedure
In "Offline" mode, you can test the various project functions on the HMI device without them
being affected by the PLC. PLC tags, therefore, are not updated.
Test the operator control objects and visualization of the project as far as possible without
connecting to the PLC.

7.2 Transfer
Requirements of the online test

● The project has been transferred to the HMI device.
● The HMI device is in "Online" mode.
Procedure
In "Offline" mode, you can test the various project functions on the HMI device without them
being affected by the PLC. PLC tags are updated in this case.
Test the operator control objects and views of the project.
You should especially test the project objects which require communication with the PLC:
● Alarms
● Screen selection by the PLC or on PLC request.
Applies to OP 77B:
● Recipes
● Print function
See also
7.2.5 Uploading a project from OP 77B
Introduction
When the "Enable Upload" check box is set on the configuration computer for transferring a
project, the corresponding compressed source file is included in the transfer operation. This
allows the upload from the HMI device to the configuration computer.
After you uploaded a compressed source file, you can be analyzed and modify the active
project. This is of particular importance when:
● The original configuration computer is not available.
● The project source file is no longer available.
Requirements
Requirements for uploading the project from the HMI:
● The compressed source file of the project must be available on an MMC which is inserted
in the HMI device.
● A project is open in WinCC flexible.

7.2 Transfer
NOTICE
Project ID
The uploaded compressed source file can only be opened in the engineering software if
the following condition is satisfied:
The project ID of the currently used engineering software is higher than or equal to the
project ID of the engineering software used to create the project.
Verifying the source file
There is no check in WinCC flexible or on the HMI device to determine if the project file
on the HMI device and the compressed source file on the MMC belong to the same
project. Only the project file is transferred when the "Enable Upload" check box is
disabled. Any source file on the MMC must therefore belong to a previously transferred
project.
Procedure
1. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Communication
Settings".
The "Communication Settings" dialog opens.
2. Select the HMI device type.
3. Select the type of connection between the HMI device and the configuration computer.
4. Set the connection parameters.
5. Select "OK".
Proceed as follows on the HMI device:
1. Select transfer mode from the Loader.
1. In WinCC, select the menu command "Project ▶ Transfer ▶ Upload".
This initiates the upload.
Result
When all data are uploaded to the configuration computer, the WinCC flexible engineering
software unpacks the compressed file. The uploaded project can now be opened for editing
on the configuration computer. The file is available in *.hmi format
See also

7.3 Backup and restore
7.3.1 Overview
Introduction
Data located on the HMI device can be backed up using a PC external to the HMI device
and can be restored from it.
The following data in the internal Flash memory can be backed up and restored:
● Project
● HMI device image
● Password list
● Recipe data list (applies only to OP 77B)
Based on the type of HMI device used, you can backup and restore the data using:
● MMC (applies only to OP 77B)
● WinCC flexible
● ProSave
General notes
NOTICE
Power failure
If an operation for restoring data is interrupted due to power failure on the HMI device, the
operating system of the HMI device may be deleted! The operating system then has to be
updated.
Compatibility conflict
If a message is output on the HMI device warning of a compatibility conflict during the
restore operation, the operating system must be updated.
Resetting to factory settings

In ProSave or WinCC flexible, you can perform a restore with or without resetting to factory
settings, depending on the HMI device used.
● Restore without reset to factory setting
First, set "Transfer" mode on the HMI device or use the automatic transfer function if the
project is active. Then start the restore in ProSave or WinCC flexible.
● Restore with reset to factory setting
First, start the restore in ProSave or WinCC flexible and then switch the power on the
HMI device off and on again.

Note
Restoring with reset to factory setting is also possible when the HMI device operating
system is corrupt and you can therefore no longer run the Loader of the HMI device.
Use the "Reset to factor state" check box in ProSave to determine the restoring procedure.
7.3.2 Backup and Restore via WinCC flexible
Introduction
Backup and restore operations transfer the relevant data between flash memory on the HMI
device and a configuration computer.
Requirement
● No project is open in WinCC flexible.
● Relevant only for backup or for restore operations without reset to factory setting:
The data channel is configured on the HMI device.
Procedure - backup
Proceed as follows:
1. Select the menu command "Project ▶ Transfer ▶ Communication Settings" in WinCC
flexible on the configuration computer.
3. Select the type of connection between the HMI device and the configuration computer,
then set the communication parameters.
4. Close the dialog with "OK".
5. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Backup".
The "Backup Settings" dialog opens.
6. Select the data to be backed up.
7. Select a destination folder and a file name for the *.psb backup file.
8. Set "Transfer" mode on the HMI device.
If automatic transfer mode is enabled on the HMI device, the device automatically sets
"Transfer" mode when a backup is initiated.
9. Start the backup operation in WinCC flexible with "OK" on the configuration computer.
Follow the instructions in WinCC flexible.
A status view opens to indicate the progress of the operation.

Result
The system outputs a message when the backup is completed.
The relevant data is now backed up on the configuration computer.
Procedure - restore
Proceed as follows:
5. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Restore".
The "Restore Settings" dialog dialog opens.
6. Select the *.psb backup file to be restored from the "Open" dialog.
The view shows from which HMI device the backup file originates and the type of data it
contains.
"Transfer" mode when a restore operation is initiated.
8. Start the restore operation in WinCC flexible with "OK" on the configuration computer.
Result
The transfer is completed when the backup data is restored from the configuration computer
to the HMI device.
See also
Overview (Page 113)

7.3.3 Backup and Restore via ProSave
Introduction
Backup and restore operations transfer the relevant data between flash memory on the HMI
device and a PC.
Requirement
● The HMI device is connected to a PC on which ProSave is installed.
● Relevant only for backup or for restore operations without reset to factory setting:
Procedure - backup
Proceed as follows:
1. From the Windows Start menu, run ProSave on the PC.
2. Select the HMI device type from the "General" tab.
4. Use the "Backup" tab to select the relevant data.
5. Select a destination folder and a file name for the *.psb backup file.
"Transfer" mode when a backup is initiated.
7. Start the backup operation in ProSave with "Start Backup".
Follow the instructions in ProSave.
Result
The system outputs a message when the backup is completed.
The relevant data is now backed up on the PC.

Procedure - restore
Proceed as follows:
1. When restoring with reset to factory setting only:
Switch off power to the HMI device.
5. Select whether to restore with/without resetting to factory settings by accordingly setting
the "Reset to factory setting" check box in the "Restore" tab.
6. Select the *.psb backup file to be restored from the "Restore" tab.
The view shows from which HMI device the backup file originates and the type of data it
contains.
7. When restoring without reset to factory setting only:
Set "Transfer" mode on the HMI device.
8. Start the restore operation in ProSave with "Start Restore".
Result
The transfer is completed when the backup data is restored from the PC to the HMI device.
See also
Overview (Page 113)

7.3.4 Backup and restore operations with MMC on OP 77B
Introduction
The system generates a backup copy of the operating system, applications and data in flash
memory of the HMI device and writes it to an MMC. Any backup date on the MMC will be
deleted on confirmation.
A restore operation deletes all old data from flash memory of the HMI device on
confirmation. Next, the backup data are copied from the MMC to the internal flash memory.
Requirements
You require an MMC with a minimum capacity of 32 MB.
The system outputs an alarm if no MMC is found in the MMC slot. Insert the required MMC
and confirm with ENTER

. If you do not insert an MMC, acknowledge the alarm to return to the
"Settings" menu.
The system outputs the following message when you insert a SIMATIC S7 MMC memory
card:
Unsupported storage card

detected!
Press ENTER to continue.
Figure 7-3 Dialog box with alarm
Replace the MMC as described in Accessories.
Procedure - Backup
Proceed as follows:
1. Insert the MMC into the memory card slot
2. Select "Info/Settings ▶ Logon/Settings ▶ Backup/Restore" from the Loader menu.
The "Backup/Restore" dialog opens.
3. Select "Backup".
4. Press ENTER
If previous backup data are found on the MMC, the system outputs the following
message:
You may have an old backup
on the storage card. Do you
want to delete it?
ENTER – Yes; ESC – No
Confirm with ENTER

to overwrite any existing backup data on the MMC. Select ESC
to
cancel the backup operation.

After the backup copy has been created, the following alarm appears:
Backup successfully completed.
Press OK and remove your
storage card.
Remove the MMC.
5. Press ENTER
This concludes the backup operation.
Result
The transfer is completed when all HMI data are backed up to the MMC.
Label the MMC with the date and version of the backed up project, for example, and then
store it in a safe place.
Procedure - Restore
Proceed as follows:
1. Insert the MMC into the memory card slot
2. Select "Info/Settings ▶ Logon/Settings ▶ Backup/Restore" from the Loader menu.
The "Backup/Restore" dialog opens.
3. Select "Restore".
Press ENTER
.
The system outputs the following message:
Checking data ...
The MMC content is now checked. The system outputs the following message if a valid
backup copy is found on the MMC:
You are starting RESTORE now.
All installed licenses, all files (except
files on storage card) and the regis-
try will be erased. Are you sure?
ENTER – Yes; ESC – No
An alarm is output if no valid data are found on the MMC. Select ESC
to return to the
"Logon/Settings" menu.

4. Press ENTER
to initiate the restore operation.
The system outputs the following message:
"Deleting files on flash"
The system transfers the HMI device image and outputs the following message:
Restore CE-Image
Select ESC
to cancel the restore operation.
The system outputs the following message when the transfer of the HMI device image
from MMC to the HMI device is completed:
Restore of CE image finished.
Device will be rebooted now.
Don't remove the storage card.
Leave the MMC in the HMI device.
5. Press ENTER
The HMI device performs a restart.

After the HMI device restarts, the system transfers the remaining backup data from the
MMC to the HMI device and then outputs the following message:
Restore successfully finished. Press
OK, remove your storage card and
reboot your device.
Press Enter to continue.
6. Remove the MMC from the HMI device.
7. Press ENTER
The HMI device performs a restart.
Result
The transfer is completed when all backup data were copied from the MMC and are
available on the HMI device.
See also
Backup and restore functions for OP 77B (Page 92)

7.4 Updating the operating system
7.4.1 Overview
Overview
A compatibility conflict may occur when transferring a project to the HMI device. This is
caused by different versions of the engineering software and the HMI device image. The
configuration computer cancels the transfer and triggers an alarm to indicate a compatibility
conflict. You must update the operating system of the HMI device.
NOTICE
Data loss
An operating system update deletes all data such as projects and passwords from the HMI
device.
Resetting to factory settings

In ProSave or WinCC flexible, you can update the operating system with or without resetting
to factory settings, depending on the HMI device used.
● Updating the operating system without reset to factory setting
First, set "Transfer" mode on the HMI device or use the automatic transfer function if the
project is active. Then start the operating system update in ProSave or WinCC flexible.
● Updating the operating system with reset to factory setting
First, start the operating system update in ProSave or WinCC flexible. Then switch the
power on the HMI device off and on again.
Note
You can perform an operating system update with reset to factory setting even if the HMI
device does not yet have an operating system or if the operating system of the HMI
device is corrupt.
In ProSave or WinCC flexible, set the "Reset to factory state" check box status according to
your selected operating system update mode.

7.4.2 Updating the Operating System Using WinCC flexible
Requirement
● No project is open in WinCC flexible.
● When updating the operating system without reset to factory setting only:
Procedure
Proceed as follows:
1. When updating the operating system with reset to factory setting only:
This opens the "Communication Settings" dialog.
6. In WinCC flexible, select the menu command "Project ▶ Transfer ▶ Update operating
system".
7. Select whether to update the operating system with/without resetting to factory settings
by setting the "Reset to factory state" check box accordingly.
8. In "Image path," select the folder which contains the HMI device image file, *.img.
The HMI device image files are available under "WinCC flexible Images" in the WinCC
flexible installation folder and on the corresponding WinCC flexible installation CD.
9. Select "Open".
In the output area, you are provided information on the version of the HMI device image
file after it is opened.
11. In WinCC flexible, select "Update OS" to run the operating system update.
A status view opens to indicate progress.
Result
The system outputs and alarm when the operating system update is completed.
This operation has deleted the project data from the HMI device.

Note
HMI device OP 73
After the transfer via MPI, the transfer settings are automatically reset to serial transfer.
7.4.3 Updating the Operating System Using ProSave
Requirement
● The HMI device is connected to a PC on which ProSave is installed.
● When updating the operating system without reset to factory setting only:
Procedure
Proceed as follows:
1. When updating the operating system with reset to factory setting only:
5. Select the "OS Update" tab.
6. Select whether to update the operating system with/without resetting to factory settings
by setting the "Reset to factory settings" check box accordingly.
7. In "Image path," select the folder which contains the HMI device image file, *.img.
The HMI device image file is available on the corresponding WinCC flexible installation
CD.
8. Select "Open".
In the output area, you are provided information on the version of the HMI device image
file after it is opened.
10. On the PC, select "Update OS" to run the operating system update.
A status view opens to indicate progress.

Result
The system outputs and alarm when the operating system update is completed.
This operation has deleted the project data from the HMI device.
Note
HMI device OP 73
After the transfer via MPI, the transfer settings are automatically reset to serial transfer.

Operating a project 8
8.1 Operating a project on OP 73
8.1.1 Overview
Soft keys with global function assignment

A soft key with global function assignment always triggers the same action on the HMI
device or in the PLC, regardless of the current screen. An example of such an action is the
activation of a screen.
The soft key of a screen can be assigned either a global or a local function. The local
function takes priority over the global setting.
Soft keys with local function assignment

A soft key with local function assignment is screen-specific and is therefore only effective
within the active screen.
The function assigned to a soft key can vary from screen to screen.
Operation with key combinations

Unwanted actions may be triggered if the operator unintentionally actuates a key
combination.
CAUTION
In "Online" mode, simultaneous operation of more than two keys may cause unintentional
actions in the plant.

Operating a project
System keys
The system keys (control keys) are used for operator input on the HMI device.
Table 8-1 Overview of control keys
Function Action
Moving the cursor Activates the next field in horizontal direction
DEL INS
,
TAB +/–
Activates the next field in vertical direction
,
Activate field Activates the next field in the tab order defined in your project
TAB
SHIFT
+
SHIFT Enables an overlay function of a further system key
Viewing infotext Opens a window containing infotext on the selected object

HELP
You can press to toggle between infotext for a screen and an object,
ESC ENTER
SHIFT
+
for example, for an IO field.
Cancel action. • Undo
HELP
ESC You can undo your input as long you have not yet confirmed it with
.
ENTER
• Close the alarm window - if configured.

• Cancel the output of infotext to return to the previous view.
Acknowledge alarm Acknowledges the current indicated or selected alarm or all alarms of an
acknowledgment group, depending on your configuration.
ACK
TAB +/–
ENTER
• Call editing mode – initiates input with and
• Exit editor mode and confirm input
Navigating in lists
Table 8-2 Keys for navigation in lists
Button Action on pressing

TAB +/–
Selects the previous or next list entry
or

Operating a project
8.1.2 Setting the project language
Introduction
The HMI device supports multilingual projects. You need to configure a corresponding
operator control object which lets you change the language setting on the HMI device during
runtime.
The project always starts with the language set in the previous session.
Requirements
● The relevant project language must be available on the HMI device.
● The language changeover function must be logically linked to a configured operator
control object such as a button.
Selecting a language
You can change project languages at any time. Language-specific objects are immediately
output to the screen in the relevant language when you switch languages.
The following options are available for switching the language:
1. A configured operator control object switches from one project language to the next in a
list.
2. A configured operator control directly sets the desired project language.
8.1.3 Entries and help within a project
8.1.3.1 Overview
Procedure
Values are entered in the project input fields. The values are transferred from the input fields
to the PLC.
Proceed as follows:
1. Select the required input field on the screen.
Based on your configuration, you can enter the following type of values in the input field:
– Numerical
– Alphanumerical
– Symbolic
– Date/time
2. Set the value.
HELP
3. Confirm your entries with or cancel your entries with .

ENTER ESC

Operating a project
Numerical values
Enter the characters of numerical values using the system keyboard. Press ENTER
to edit any
character of the value with the help of the cursor keys.
DEL
You can delete a value from the field by pressing SHIFT

+ .
Formats for the visualization of numerical values

You can enter values in numerical input fields based on the following formats:
● Decimal
● Hexadecimal
● Binary
The entry can be aligned left or right, depending on the configuration.
Limit value test of numerical values

Tags can be assigned limit values. If an alarm window has been configured, a system alarm
is automatically output to indicate any violation of set limits of the input value, for example,
80 exceeds the set limit value of 78. The value entered is rejected. The original value is
displayed again.
Decimal places for numerical values

If a numerical input field is configured for a specific number of decimal points, decimal places
in excess of the limit are ignored. Empty decimal places are filled with "0" after the number is
confirmed.
Alphanumerical values
Enter the alphanumerical values, numbers and letters character by character using the
system keyboard. Press ENTER

to edit any character of the value with the help of the cursor
keys.
DEL
You can delete a value from the field by pressing SHIFT

+ .
The extended character set is available for fields with "String" format.
Symbolic values
Symbolic values are by selecting configured entries and not using the keyboard. These
entries are stored in symbolic IO fields.
Date and time

Date and time are entered in alphanumerical format.

Operating a project
8.1.3.2 Entering and editing numerical and alphanumerical values
Requirement
TAB
An IO field has been enabled with SHIFT

+ or using the cursor keys.
Navigating in fields
Table 8-3 Overview of control keys for navigating in fields
Key Action
DEL INS
The previous or following character is marked.
or
Control keys for character input
Table 8-4 Overview of the control keys for character input
Key Action
+/– Changes the sign of a numerical value.
SHIFT
+ +/–
Press SHIFT
+ to toggle between the two characters.
SHIFT This toggles between upper and lower case letters.
TAB +/– All characters available in the extended character set are called in
or succession.
ENTER
Validates the input
HELP
ESC
Deletes the entry
Restores the original value
Options of entering numerical and alphanumerical characters:

● Enters value and thereby fully replace the existing value
● Edit a character in an existing value

Operating a project
Procedure – entering values

To enter a new value instead of editing a character, you can delete the entire contents of the
input field.
Proceed as follows:
DEL
1. press to mark the entire field contents

TAB +/–
2. Enter the value with or .
3. Press ENTER
.
This confirms your entries. To cancel the entry, press ESC

.
Procedure – editing specific characters of a value

Proceed as follows:
ENTER
1. Press .
INS DEL
2. Select the relevant character with or .

TAB +/–
3. Replace the character with or .
4. Press ENTER
.

.
Call sequence of the characters
When you initially enter a value in an alphanumerical input field, the letter "A" is called by
INS
pressing ENTER
or . The same applies when you add characters.
The following applies for further entries:
TAB
● Press to enter letters.

Upper and lower case letters are indicated first, followed by the special characters and
numbers.
To toggle between an upper and a lower case letter, press SHIFT

.
+/–
● Press to enter numbers.

The list opens with various special characters and continues with the numbers.
+/– TAB
Press or to view the next value if you already entered a value.

Operating a project
Procedure – deleting a character

ENTER
1. Press .
2. Position the cursor on the character to be deleted.
DEL
3. Press SHIFT
+ .
The selected character will be deleted. The remaining characters to the right of the cursor
shift by one position to the left.
If the characters are right aligned:
The selected character will be deleted. The remaining characters to the left of the cursor
shift one position to the right.
Procedure – inserting characters

ENTER
1. Press .
2. Move the cursor to the required position.
INS
3. Press SHIFT
+ to insert a space character.
The characters already entered move one position to the right from the cursor position.
The characters already entered move one position to the left from the cursor position.
Example for numerical input

Activate the the input box. The following table shows the keys you need to press to enter
"–12.34":
Key Instruction Display

Press 1 x to begin input
ENTER
DEL Press 5 x to move the marking five positions to the

left
+/– Keep pressing until "-" appears

INS Press 1 x to move the marking one position to the

right
TAB Keep pressing until "1" appears


right


Operating a project

right


right

Press 1 x to end input

ENTER
Example for alphanumerical input

Activate the the input box. The following table shows the keys you need to press to enter
"OP 73":

Press 1 x to begin input
ENTER $
TAB Keep pressing until "O" appears

2
INS Press 1 x to move the marking one position to

2$
the right
TAB Keep pressing until "P" appears

23
INS Press both keys 1 x simultaneously to create a

23
SHIFT space character
+

23 $
the right
+/– Keep pressing until "7" appears

23

23 $
the right
+/– Keep pressing until "3" appears

23
Press 1 x to end input

ENTER 23

Operating a project
8.1.3.3 Entering and editing symbolic values
Requirements
TAB
A symbolic IO field has been with SHIFT

Button Action
TAB +/– Scrolls in a single-line list field until the required entry is found
,
ENTER
Validates the selected entry
Disables editing mode
HELP
ESC
Restores the original entry
Procedure
Proceed as follows:
ENTER
1. Enable the selection list with .
This enables the selection list which contains the configured symbolic entries.
TAB +/–
2. Select an entry with or .

3. Save or cancel the entry.
8.1.3.4 Entering and modifying date and time
Requirements
TAB
A date/time input field has been enabled with SHIFT

Entering the date and time

Use numerical and alphanumerical values to set the date and time.
Note
When entering the date and time, please note that the format is determined by the
configured project language.
See also
Entering and editing numerical and alphanumerical values (Page 129)
Setting the project language (Page 127)

Operating a project
8.1.3.5 Displaying infotext
Introduction
The configuration engineer uses infotext to provide additional information and operating
instructions with respect to screens and operable screen objects.
An infotext may contain information on the value to be set in an IO field, for example.
Enter temperature
setpoint for Tank_1
(Range 40 to 80 °C)
Figure 8-1 Infotext for an IO field, example
A help indicator can also been configured.
Figure 8-2 Help indicator
If there is an infotext available for the active screen, the help indicator is always displayed. If
infotext is available for a screen object, the help indicator is displayed as soon as the cursor
is placed over the screen object. If there is no infotext for the selected operator control object
or the active screen, the help indicator is hidden.
Procedure
HELP
To view an infotext on the HMI device, press + . There are two viewing options:
SHIFT ESC
● If the cursor is positioned in a field for which infotext has been configured, press SHIFT
+
HELP
to view the infotext.

ESC
HELP
● If + is pressed and no infotext is available for the field, the infotext configured
SHIFT ESC
for the active screen is shown instead.

If an infotext is not available for this active screen, the system opens the following dialog:
No info text available!
TAB +/– HELP
In this dialog, scroll through the list with or . Press to close the dialog.
ESC
If you have configured screen and IO field infotexts, you can toggle these in your view by
pressing ENTER
.

Operating a project
8.1.4 Project security
8.1.4.1 Overview
Overview
Operation of a project can be protected by the configuration engineer by implementing a
security system.
The security system of the HMI device is based on authorizations, user groups and users.
If operator control objects protected by a password are operated, the HMI device requests
the entry of a password. A logon screen is displayed in which you enter your user name and
password. After logging in, you can operate the operator control objects for which you have
the necessary authorizations.
The Logon dialog can be set up by the configuration engineer via an individual operator
control object.
In the same way, the configuration engineer can set up an operator control object to log off.
After logging off, objects assigned password protection can no longer be operated; to do so,
log on again.
Additional information on this may be available in your plant documentation.
User groups and authorizations

Project-specific user groups are created by the configuration engineer. The "Administrators"
group is included in all projects by default. User groups are assigned authorizations. The
authorization required for an operation is specifically defined for each individual object and
function in the project.
Users
Each user is assigned to exactly one user group.
Users can be created as follows:
● By the configuration engineer during configuration
● By the administrator on the HMI device
● By a user with user administration authorization on the HMI device
Logoff times
A logoff time is configured in the system for each user. If the time between any two user
actions, e.g, entering a value or changing screens, exceeds this logoff time, the user is
automatically logged off. The user must then log on again to continue to operate objects
assigned password protection.

Operating a project
Passwords
Users can only log on to the HMI device if they are in the list of users and enters their user
name and password. The passwords can be assigned by the configuration engineer, by the
administrator (or by a user who has administration authorization) or by the user himself.
The authorizations of a user after logging on depends on the user group to the user is
assigned.
The user data is encrypted and saved on the HMI device to protect it from loss due to power
failure.
Note
Depending on the transfer settings, changes to the user data is overwritten when the project
is transferred again.
User view
Use the User view to display the users on the HMI device.
8VHUYLHZ
$GPLQ *URXS
3/&XVHU *URXS
8VHU *URXS
1HZXVHU!
All users on the HMI device system are displayed in the User view to the administrator or to
a user with administrator authorizations. When user administration authorization is lacking,
only the personal user entry is displayed.
The group to which each user is assigned is displayed next to the user names.
As administrator or user with user administration authorization, you can also add new users.
To do so, select "<new user>".
Backup and restore

The users, passwords, group assignments and logoff times can be backed up and restored
on the HMI device. This prevents you having to enter all of the data again on another HMI
device.
NOTICE
During a restore, the currently valid user data is overwritten. The restored user data and
passwords are valid immediately.

Operating a project
Limit values for user, password and user view
Number of characters
Length of user name, maximum 40
Length of password, minimum 3
Length of password, maximum 24
Entry in user view, maximum 50
8.1.4.2 User logon
Requirements
Use the logon dialog to log onto the security system of the HMI device. Enter user name and
password in the logon dialog.
User:
Password:
OK Cancel
Figure 8-3 Logon dialog
You have the following options for displaying the logon dialog:
● Touch the operator control object with password protection.
● Touch an operator control object that was configured for displaying the logon dialog.
● Press ENTER
when the user view is active.
● At the beginning of the project, the logon dialog will be automatically displayed in certain
circumstances.
Procedure
Proceed as follows:
1. Enter the user name and password.
TAB
2. Enable the "OK" button with SHIFT

3. Press ENTER
.
Result
After successful logon to the security system, you can execute password-protected functions
on the HMI device for which you have authorizations.
An error message is displayed if you enter the wrong password. In this case, no user is
logged onto the project.

Operating a project
8.1.4.3 User logoff
Requirements
You have logged onto the security system of the HMI device.
Procedure
You have the following options for logging off:
● If the logoff time has been exceeded without user activity, the user is automatically
logged off.
● Touch the operator control object that was configured for logoff.
Result
The user is no longer logged into the project. In order to operate an operator control object
with password protection, you must first log on again.
8.1.4.4 Creating users
Requirements
New users are created in the user view.
To display the user view, switch to the screen that contains the user view.
To add a new user, you must have user administration authorization.
Procedure
Proceed as follows:
+/– TAB
1. In the user view, select "New User" with or .
2. Press ENTER
.
The following dialog appears:
8VHU _
2. &DQFHO
3. Enter the user name.

4. Select "OK".

Operating a project
5. Press ENTER
.
3DVVZRUG _
2. &DQFHO

7. Select "OK".
8. Press ENTER
.
*URXS *URXS
2. &DQFHO
9. From the list of available groups, select the one granted the corresponding user access
rights and assign the user to this group.
10. Select "OK".
11. Press ENTER

.
/RJRIIWLPH
2. &DQFHO
12. Enter the logon timeout value in minutes.

13. Select "OK".
14. Press ENTER

.
Result
The new user is created.

Operating a project
8.1.4.5 Changing user data
Requirements
Change user data in the user view.
The following options are available for the range of changes that can be made:
● The administrator or a user with user administration authorization can change the data for
all users on the HMI device system in the user view.
– User name
– Group assignment
– Password
– Logoff time
● Users without user administration authorization can only change their own user data.
– Password
– Logoff time
Note
You can only change the logoff time and password for the "Admin" user.
You can only change the logoff time for the "PLC_User". This user entry is used for
logging on via the PLC.
Procedure
This procedure describes changing user data by the administrator or a user with user
administration authorization.
Proceed as follows:
1. From the user view, select the profile using the cursor keys.
2. Press ENTER
.
8VHU 8VHU
2. &DQFHO
3. Enter the new user name as required.

4. Select "OK".
5. Press ENTER
.

Operating a project
6. Enter the new password as required.
3DVVZRUG
2. &DQFHO
7. Select "OK".
8. Press ENTER
.
9. Select the new user group as required.
*URXS *URXS
2. &DQFHO
10. Select "OK".
11. Press ENTER

.
12. Edit the logon timeout value as required.
/RJRIIWLPH
2. &DQFHO
13. Select "OK".
14. Press ENTER

.
Result
The user data for the user is changed.
8.1.4.6 Deleting a user
Requirements
You delete users in the user view: Select the screen which contains the user view.
To delete a user, you must have user administration authorization.
There are two methods of deleting a user:
● Directly in the user view
● Using the user dialog
Note
The "Admin" and "PLC_User" users exist by default and cannot be deleted.

Operating a project
Procedure – Deleting users directly in the user view

Proceed as follows:
1. From the user view, select the user you want to delete using the cursor keys.
DEL
2. Press SHIFT
+ .
Result
The user is deleted.
Procedure – Deleting users using the user dialog

Proceed as follows:
1. From the user view, select the user you want to delete using the cursor keys.
2. Press ENTER
.
This opens the user dialog.
8VHU 8VHU
2. &DQFHO
3. Select the "User" input field.

DEL
4. Press SHIFT
+ .
Delete all characters from the input field.
5. Select "OK".
6. Press ENTER
.
Result
8.1.5 Closing the project
Procedure
Proceed as follows:
1. Use the corresponding operator control object to close the project.
Wait for the Loader to open after you closed the project.
2. Switch off power to the HMI device.

Operating a project
8.2 Operating a project on OP 77A and OP 77B
8.2.1 Overview
Soft keys with global function assignment

A soft key with global function assignment always triggers the same action on the HMI
device or in the PLC, regardless of the current screen. These actions include:
● Enabling a screen
● Output of the content of the active screen to a printer (applies to OP 77B)
The soft key of a screen can be assigned either a global or a local function. The local
function takes priority over the global setting.
Soft keys with local function assignment

A soft key with local function assignment is screen-specific and is therefore only effective
within the active screen.
The function assigned to a soft key can vary from screen to screen.
The dual-row keys are particularly suited for controlling binary states and machine functions,
as shown in the figure below.
ON START +
OFF STOP –
Figure 8-4 Example of dual-row, labeled keys
Operation with key combinations

Unwanted actions may be triggered if the operator unintentionally actuates a key
combination.
CAUTION
In "Online" mode, simultaneous operation of more than two keys may cause unintentional
actions in the plant.

Operating a project
System keys
System keys are used to input commands on the HMI device and can be organized as
follows:
● Numerical keypad
● Control keys
Table 8-5 Overview of control keys
Function Action on pressing

Moving the cursor Activates the next field in horizontal direction
,
Activates the next field in vertical direction
,
Select field Activates the next field in the tab order defined in your project
TAB
SHIFT Enables the overlay function of a further key
Reverses the tab order

SHIFT
+ TAB
Deletes characters In input fields, this deletes the character at the current cursor position.
INS The next characters shift one position to the left.
DEL
Viewing infotext Opens a window containing infotext on the selected object Requirement:
HELP
HELP
An infotext exists for the selected object only if the LED is lit.
Pressing can be used to toggle between infotext for a screen and an

ENTER
object, for example, for an IO field.

Cancel action. • Undo
ESC You can undo your input as long you have not yet confirmed it with
.
ENTER
• Close the alarm window - if configured.

• Cancel the output of infotext to return to the previous view.
Acknowledge alarm Acknowledges the current indicated or selected alarm or all alarms of an
acknowledgment group, depending on your configuration.
ACK
• Confirms your entries and closes the dialog.

ENTER
• Initiates input by means of and

Operating a project
Navigating in lists
Table 8-6 Keys for navigation in lists

Selects the previous or next list entry
or
Scrolls one page up or down to open further list entries
SHIFT 9
+
SHIFT 3
+
HOME Selects the first or last entry in a list
SHIFT .
+
END
SHIFT 0
+
8.2.2 Setting the project language
Introduction
The HMI device supports multilingual projects. You need to configure a corresponding
operator control object which lets you change the language setting on the HMI device during
runtime. The project always starts with the language set in the previous session.
Requirements
● The relevant project language must be available on the HMI device.
● The language changeover function must be logically linked to a configured operator
control object such as a button.
Selecting a language
You can change project languages at any time. Language-specific objects are immediately
output to the screen in the relevant language when you switch languages.
The following options are available for switching the language:
1. A configured operator control object switches from one project language to the next in a
list.
2. A configured operator control directly sets the desired project language.
Changing the project language on OP 77B

After the HMI device restart, the new project language is only set if the project was closed by
an operator control object before you switched off power.

Operating a project
8.2.3 Entries and help within a project
8.2.3.1 Overview
Procedure
Values are entered in the project input fields. The values are transferred from the input fields
to the PLC.
Proceed as follows:
1. Select the required input field on the screen.
Based on your configuration, you can enter the following type of values in the input field:
– Numerical
– Alphanumerical
– Symbolic
– Date/time
2. Set the value.
3. Confirm your entries with ENTER

or cancel your entries with ESC
.
Numerical values
Enter the characters of numerical values using the system keyboard. Press ENTER
to edit any
character of the value with the help of the cursor keys.
INS
All values in this input field are deleted by pressing DEL
Formats for the visualization of numerical values

You can enter values in numerical input fields based on the following formats:
● Decimal
● Hexadecimal
● Binary
Limit value test of numerical values

Tags can be assigned limit values. The system automatically outputs a system alarm if a
number entered exceeds a set limit (for example, "80" when a limit of "78" is set), provided
an alarm window has been configured. The value entered is rejected. The original value is
displayed again.

Operating a project
Decimal places for numerical values

If a numeric input field is configured for a specific number of decimal places, decimal places
in excess of the limit are ignored. Empty decimal places are filled with "0" after the value is
confirmed.
Alphanumerical values
Enter the alphanumerical values, numbers and letters character by character using the
system keyboard. Press ENTER

to edit any character of the value with the help of the cursor
keys.
INS
All values in this input field are deleted by pressing DEL
Symbolic values
Symbolic values are by selecting configured entries and not using the keyboard. These
entries are stored in symbolic IO fields.
Date and time

Date and time are entered in alphanumerical format.
8.2.3.2 Entering and editing numerical and alphanumerical values
Requirements
An IO field was selected with TAB

or the cursor keys.
Navigating in fields
Table 8-7 Overview of control keys for navigating in fields

Selects the previous or next character
or

Operating a project
Table 8-8 Overview of the control keys for character input

END Enters the numbers 0 to 9
0 9
up to
+/– HOME Enters a comma separator or a decimal point
, .
,
+/– Changes the sign of a numerical value
SHIFT ,
+ +/–
,
Press SHIFT
and to toggle between the characters.
A The characters A to F can be entered.
SHIFT 1
+ to
F
SHIFT 8
+
The characters of the extended character set are called in succession.
or
ENTER
Validates the input
ESC Deletes the input

Restores the original value
Options of entering numerical and alphanumerical characters:
● Overwrite the existing value
● Edit a character in an existing value
Procedure – Entering a value using the numerical keypad

Proceed as follows:
1. Enter the values using the numerical keypad.
The existing value is deleted when you enter the first character.
2. Press ENTER
.
3. This confirms your entries. To cancel the entry, press ESC

.

Operating a project
Procedure – Entering a value using the cursor keys

Proceed as follows:
ENTER
1. Press .
INS
2. Delete the field content with DEL .
3. Enter the value with or .
4. Press ENTER
.

.
Procedure – Editing values digit by digit using the numerical keypad

Proceed as follows:
ENTER
1. Press .
3. Edit the characters using the numerical keypad.
4. Press ENTER
.

.
Procedure – Editing values digit by digit using the cursor keys

Proceed as follows:
ENTER
1. Press .
3. Replace the character with or .
4. Press ENTER
.

.

Operating a project
Call sequence of the characters
When you initially enter a value in an alphanumerical input field, the letter "A" is called by
pressing ENTER
or . The same applies when you add characters.
The following applies for further entries:
● Press to enter letters.

Upper and lower case letters are output first, followed by the special characters and
numbers.
● Press to enter numbers.

Some special characters are shown, followed by the numbers.
If a value has already been entered, select the next value with or .
Example for alphanumerical input

To enter "OP 77B", activate the combo box. When using the cursor keys, press and hold the
corresponding cursor key or until the required character appears. Press the
following keys:
ENTER A
O 1
OA
OP 1
INS
SHIFT + DEL OP
OP A
E
7 OP 7 2
OP 7A
E
7 OP 77 2
OP 77A
B
SHIFT + 2 OP 77B 2
ENTER OP 77B
Figure 8-5 Example of input using the cursor keys and the numeric keypad
① Input using the cursor keys

② Input using the numeric keypad

Operating a project
Procedure – Deleting a character

ENTER
1. Press .
2. Position the cursor on the character to be deleted.
INS
3. Press DEL .
The selected character will be deleted. The remaining characters to the right of the cursor
shift by one position to the left.
The selected character will be deleted. The remaining characters to the left of the cursor
shift one position to the right.
Procedure – Inserting characters

ENTER
1. Press .
2. Move the cursor to the insert position.
INS
3. Press SHIFT
and DEL to insert a space character.
The characters already entered move one position to the right from the cursor position.
The characters already entered move one position to the left from the cursor position.
8.2.3.3 Entering and editing symbolic values
Requirements
An IO field was selected with TAB

or using the cursor keys.

Scrolls in a single-line list field until the required entry is found
,
ENTER
Validates the selected entry
ESC Restores the original entry

Operating a project
Procedure
Proceed as follows:
ENTER
1. Enable the selection list with .
This enables the selection list which contains the configured symbolic entries.
2. Select an entry with or .

3. Save or cancel the entry.
8.2.3.4 Entering and modifying date and time
Requirements
A date and time field was selected with TAB

or the cursor keys.
Entering the date and time

Use numerical and alphanumerical values to set the date and time.
Note
When entering the date and time, please note that the format is determined by the
configured project language.
See also
Entering and editing numerical and alphanumerical values (Page 147)
Setting the project language (Page 145)
8.2.3.5 Viewing infotext
Introduction
The configuration engineer uses infotext to provide additional information and operating
instructions with respect to screens and operable screen objects.
An infotext may contain information on the value to be set in an IO field, for example.
7HPSHUDWXUHVHWSRLQWIRU
(QWHUWDQN
5DQJHದr&

Figure 8-6 Infotext for an IO field, example

Operating a project
Procedure
HELP
The availability of an infotext is indicated by the lit LED. Press to view the infotext
HELP
on the HMI device. Two cases are possible:
● If the cursor is positioned in a field for which infotext has been configured, press to
HELP
view the infotext.
● When you press and no infotext is available for the box, the system outputs the
HELP
infotext for the active screen.

If an infotext is not available for this active screen, the system opens the following dialog:
1R+HOSDYDLODEOH
In this dialog, scroll through the list with or . Press ESC

to close the dialog.
Provided you have configured screen and IO field infotexts, you can toggle these in your
view by pressing ENTER

.
8.2.4 Project security
8.2.4.1 Overview
Overview
Operation of a project can be protected by the configuration engineer by implementing a
security system.
The security system of the HMI device is based on authorizations, user groups and users.
If operator control objects protected by a password are operated, the HMI device requests
the entry of a password. A logon screen is displayed in which you enter your user name and
password. After logging in, you can operate the operator control objects for which you have
the necessary authorizations.
The Logon dialog can be set up by the configuration engineer via an individual operator
control object.
In the same way, the configuration engineer can set up an operator control object to log off.
After logging off, objects assigned password protection can no longer be operated; to do so,
log on again.

Operating a project
User groups and authorizations

Project-specific user groups are created by the configuration engineer. The "Administrators"
group is included in all projects by default. User groups are assigned authorizations. The
authorization required for an operation is specifically defined for each individual object and
function in the project.
Users
Each user is assigned to exactly one user group.
Users can be created as follows:
● By the configuration engineer during configuration
● By the administrator on the HMI device
● By a user with user administration authorization on the HMI device
Logoff times
A logoff time is configured in the system for each user. If the time between any two user
actions, e.g, entering a value or changing screens, exceeds this logoff time, the user is
automatically logged off. The user must then log on again to continue to operate objects
assigned password protection.
Passwords
Users can only log on to the HMI device if they are in the list of users and enters their user
name and password. The passwords can be assigned by the configuration engineer, by the
administrator (or by a user who has administration authorization) or by the user himself.
The authorizations of a user after logging on depends on the user group to the user is
assigned.
The user data is encrypted and saved on the HMI device to protect it from loss due to power
failure.
Note
Depending on the transfer settings, changes to the user data is overwritten when the project
is transferred again.

Operating a project
User view
Use the User view to display the users on the HMI device.
8VHUYLHZ
$GPLQ *URXS
3/&XVHU *URXS
8VHU *URXS
1HZXVHU!
All users on the HMI device system are displayed in the User view to the administrator or to
a user with administrator authorizations. When user administration authorization is lacking,
only the personal user entry is displayed.
The group to which each user is assigned is displayed next to the user names.
As administrator or user with user administration authorization, you can also add new users.
To do so, select "<new user>".
Backup and restore

The users, passwords, group assignments and logoff times can be backed up and restored
on the HMI device. This prevents you having to enter all of the data again on another HMI
device.
NOTICE
During a restore, the currently valid user data is overwritten. The restored user data and
passwords are valid immediately.
Limit values for user, password and user view
Number of characters
Length of user name, maximum 40
Length of password, minimum 3
Length of password, maximum 24
Entry in user view, maximum 50

Operating a project
8.2.4.2 User logon
Requirements
Use the logon dialog to log onto the security system of the HMI device. Enter user name and
password in the logon dialog.
User:
Password:
OK Cancel
Figure 8-7 Logon dialog
You have the following options for displaying the logon dialog:
● Touch a protected operator control object.
● Touch an operator control object which is assigned a function for opening the Logon
dialog.
● Press ENTER
when the user view is active.
● At the beginning of the project, the logon dialog will be automatically displayed in certain
circumstances.
For further information, refer to your system documentation.
Procedure
Proceed as follows:
1. Enter the user name and password.
2. Enable the "OK" button with TAB

or using the cursor keys.
3. Press ENTER
.
Result
After successful logon to the security system, you can execute password-protected functions
on the HMI device for which you have authorizations.
An error message is displayed if you enter the wrong password. In this case, no user is
logged onto the project.

Operating a project
8.2.4.3 User logoff
Requirements
You have logged onto the security system of the HMI device.
Procedure
You have the following options for logging off:
● If the logoff time has been exceeded without user activity, the user is automatically
logged off.
● Touch the operator control object that was configured for logoff.
Result
The user is no longer logged into the project. In order to operate an operator control object
with password protection, you must first log on again.

Operating a project
8.2.4.4 Creating users
Requirements
New users are created in the user view.
To add a new user, you must have user administration authorization.
Procedure
Proceed as follows:
1. In the user view, select "New User" with or .
2. Press ENTER
.
User: |
Password:
OK Cancel
3. Press ENTER
.
4. Enter the user name.
5. Select TAB
to move to the next input field.
7. Select "OK".
8. Press ENTER
.
*URXSV 2SHUDWRUV
/RJRIIWLPH
2. &DQFHO
9. From the list of available groups, select the one granted the corresponding user access
rights and assign the user to this group.
10. Select TAB

11. Enter the logon timeout value in minutes.
12. Select "OK".
13. Press ENTER

.

Operating a project
Result
The new user is created.
8.2.4.5 Changing user data
Requirements
Change user data in the user view.
The following options are available for the range of changes that can be made:
● The administrator or a user with user administration authorization can change the data for
all users on the HMI device system in the user view.
– User name
– Group assignment
– Password
– Logoff time
● Users without user administration authorization can only change their own user data.
– Password
– Logoff time
Note
You can only change the logoff time and password for the "Admin" user.
You can only change the logoff time for the "PLC_User". This user entry is used for
logging on via the PLC.

Operating a project
Procedure
This procedure describes changing user data by the administrator or a user with user
administration authorization.
Proceed as follows:
1. Select an entry from the user view with or .
2. Press ENTER
.
User: User 1
Password: ******
OK Cancel
3. Edit the user name as required.

4. Select TAB
5. Edit the password as required.
6. Select "OK".
7. Press ENTER
.
*URXSV 2SHUDWRUV
/RJRIIWLPH
2. &DQFHO
8. Edit the user group as required.

9. Select TAB
10. Edit the logon timeout as required.
11. Select "OK".
12. Press ENTER

.
Result
The user data for the user is changed.

Operating a project
8.2.4.6 Deleting a user
Requirements
You delete users in the user view: Select the screen which contains the user view.
To delete a user, you must have user administration authorization.
There are two methods of deleting a user:
● Directly in the user view
● By means of the user dialog
Note
The "Admin" and "PLC_User" users exist by default and cannot be deleted.
Procedure – Deleting users directly in the user view

Proceed as follows:
1. In the user view, select or to select the user you want to delete.
INS
2. Press DEL .
Result

Operating a project
Procedure – Deleting users by means of the user dialog

Proceed as follows:
1. In the user view, select or to select the user you want to delete.
2. Press ENTER
.
This opens the user dialog.
User: User 1
Password: ******
OK Cancel
3. Select the "User" input field with TAB

.
4. Press ENTER
.
INS
5. Press DEL .
Delete all characters from the input field.
6. Select "OK" with TAB
.
7. Press ENTER
.
Result
8.2.5 Closing the project
Procedure
Proceed as follows:
1. Use the corresponding operator control object to close the project.
Wait for the Loader to open after you closed the project.
2. Switch off power to the HMI device.

Operating alarms 9
9.1 Overview
Alarms
Alarms indicate events and states on the HMI device which have occurred in the system, in
the process or on the HMI device itself. A status is reported when it is received.
An alarm could trigger one of the following alarm events:
● Activate
● Deactivate
● Acknowledge
The configuration engineer defines which alarms must be acknowledged by the user.
An alarm may contain the following information:
● Date
● Time
● Alarm text
● Location of fault
● Status
● Alarm class
● Alarm number
● Acknowledgement group

Operating alarms
9.1 Overview
Alarm classes
Alarms are assigned to various alarm classes:
● Error
Alarms in this class must always be acknowledged. Alarms normally indicate critical
errors within the plant such as "Motor temperature too high".
● Warning
Warning alarms usually indicate states of a plant such as "Motor switched on".
● System
System alarms indicate states or events which occur on the HMI device.
● User-specific alarm classes
The properties of this alarm class are defined in the configuration.
● STEP 7 alarm classes (applies to OP 77B)
The alarm classes configured in STEP 7 are also available to the HMI device.
Alarm buffer
Alarm events are saved to an internal, volatile buffer. The size of this alarm buffer depends
on the HMI device type.
Alarm log (only for OP 77B)

When alarm logging is enabled, alarm events are output directly to the printer.
You can set the logging function separately for each alarm. The system outputs "activated"
and "deactivated" alarm events to the printer.
The output of alarms of the "System" class to a printer must be initiated by means of the
corresponding alarm buffer. This outputs the content of the alarm buffer to the printer. To be
able to initiate this print function, you need to configure a corresponding control object in the
project.

Operating alarms
9.2 Alarms on the OP 73
9.2.1 Displaying alarms
Alarm view and alarm window

Alarms are indicated in the alarm view or in the alarm window on the HMI device.
156 12:05:49 Alarm

Engine 23 too hot
Figure 9-1 Alarm view
34541
156 12:05:49 Alarm
45238
Engine 23 too hot
12584
Figure 9-2 Alarm window
The layout and operation of the alarm window correspond to that of the alarm view.
The alarm window is independent of the process screen. Depending on the configuration,
the alarm window appears automatically as soon as a new, unacknowledged alarm has been
received. The alarm window can be configured so that it only closes after all the alarms have
been acknowledged.

Functions of the HMI device keys in the alarm view:
Button Function
HELP
ESC
Show an alarm infotext
SHIFT
+
ENTER
Edit alarm
ACK
Acknowledge alarm
INS
Show the full text of the selected alarm in a separate window, the alarm text
window. You can scroll the alarm text window using the cursor keys.
TAB +/– Select the next or previous alarm from the alarm view
,

Operating alarms
Alarm class layout

The various alarm classes are identified in order to distinguish between them in the alarm
view.
Symbol Alarm class

! Error
(empty) Warning
(depending on the User-defined alarm classes
configuration)
$ System
The configuration engineer can edit the alarm class symbols. Additional information on this
may be available in your plant documentation.
Displaying infotext
An alarm can be assigned an infotext.
Proceed as follows to view the infotext:
1. Select the relevant alarm in the alarm view using the cursor keys.
HELP
2. Press and .
SHIFT ESC
The infotext assigned to this alarm is shown.

HELP
3. Press to close the infotext.

ESC
Viewing long alarm text

The alarm text window can be used to view infotexts which can not be output in full length in
the alarm view.
1. Select the alarm using the cursor keys.
INS
2. Press .
This opens the alarm text window shown below.
502 15:05:49 Alarm
switch off unit 4,
disconnect main linkage,
close by-pass stop valve 2,
start cooling unit 23 and
open pipes 12 and 53,
acknowledge buttom ACK
+/– TAB
3. Press or to view the full alarm text.

HELP
4. Press .
ESC
This closes the alarm text window.

Operating alarms
Alarm indicator
The alarm indicator is a graphic symbol that shows alarms to be acknowledged.
The following figure shows the alarm indicator:
The alarm indicator flashes as long as alarms are queued for acknowledgment. The alarm
indicator is displayed and does not flash as long as acknowledged alarms are still queued.
When no alarm is in the queue, the alarm indicator is hidden.
9.2.2 Acknowledge alarm
Requirements
● The alarm to be acknowledged is shown in the alarm window or in the alarm view.
● Either the alarm window or the alarm view is enabled.
● The alarm must be acknowledged.
Procedure
Proceed as follows to acknowledge an alarm:
1. From the alarm window or alarm view, select the relevant alarm using the cursor keys.
2. Press .
ACK
Result
The alarm or all alarms of the corresponding acknowledgement group are acknowledged.
You may find additional information about acknowledgment groups in your plant
documentation.
9.2.3 Edit alarm
Introduction
The configuration engineer can assign additional functions to each alarm. These functions
are executed when the alarm is processed.
Requirements
● The alarm to be edited is indicated in the alarm window or in the alarm view.

Operating alarms
9.3 Alarms on the OP 77A and OP 77B
Procedure
Proceed as follows to edit an alarm:
1. From the alarm view, select the alarm you want to edit using the cursor keys.
2. Press ENTER
.
Result
The system executes the additional functions of the alarm. You may find additional
information on this in your plant documentation.
Note
When you edit an unacknowledged alarm, it is acknowledged automatically.
9.3.1 "Error" alarm class

"Error" class alarms are indicated by the "alarm indicator" LED:
Figure 9-3 "Alarm indicator" LED
The "alarm indicator" LED can signal the following states:

● LED off
No "error" class alarm.
● LED flashes
At least on unacknowledged "error" class alarm.
● LED is lit
At least one acknowledged "error" class alarm, but no unacknowledged alarms.

Operating alarms
9.3.2 Viewing alarms
Alarm view and alarm window

Alarms are indicated on the HMI device in the Alarm View or Alarm Window.
156 12:05:49 Alarm

Engine 23 too hot
Figure 9-4 Alarm view
12847
156 12:05:49 Alarm
52687
Engine 23 too hot
24558
68124
Figure 9-5 Alarm window
The layout and operation of the alarm window correspond to that of the alarm view.
The alarm window is independent of the process screen. Depending on the configuration,
the alarm window appears automatically as soon as a new, unacknowledged alarm has been
received. The alarm window can be configured so that it only closes after all the alarms have
been acknowledged.
For further information, refer to your plant documentation.

Functions of the HMI device keys in the alarm view:
Button Function
HELP
Displays an alarm infotext
ENTER
Edits an alarm
ACK
Acknowledges an alarm
Displays the full text of the selected alarm in a separate window, the alarm text
window You can scroll in the alarm text window.
Selects the next or previous alarm from the alarm view
,

Operating alarms
Alarm class layout

The following identifiers are used to distinguish between the various alarm classes in the
alarm view:
Symbol Alarm class

! Error
(empty) Warning
(depending on the User-defined alarm classes
configuration)
$ System
The configuration engineer can edit the alarm class symbols. Further information on this may
be available in your plant documentation.
Viewing infotext
An alarm can be assigned an infotext.
To view the infotext:
1. Select the relevant alarm in the alarm view using the cursor keys.
2. Press .
HELP
The infotext assigned to this alarm is shown.
3. Press ESC
to close the infotext.
Viewing long alarm text

The alarm text window can be used to view infotexts which can not be output in full length in
the alarm view.
1. Select the alarm using the cursor keys.
2. Press .
This opens the alarm text window shown below.
502 15:05:49 Alarm
switch off unit 4,
disconnect main linkage,
close by-pass stop valve 2,
start cooling unit 23 and
open pipes 12 and 53,
acknowledge buttom ACK
3. Press or to view the full alarm text.
4. Press ESC
.
This closes the alarm text window.

Operating alarms
9.3.3 Acknowledge alarm
Requirements
● The alarm to be acknowledged is shown in the alarm window or in the alarm view.
● The alarm must be acknowledged.
Procedure
Proceed as follows to acknowledge an alarm:
1. From the alarm window or alarm view, select the relevant alarm using the cursor keys.
2. Press .
ACK
Result
The alarm or all alarms of the corresponding acknowledgement group are acknowledged.
You may find additional information about acknowledgment groups in your plant
documentation.
9.3.4 Edit alarm
Introduction
The configuration engineer can assign additional functions to each alarm. These functions
are executed when the alarm is processed.
Requirements
● The alarm to be edited is indicated in the alarm window or in the alarm view.
Procedure
Proceed as follows to edit an alarm:
1. From the alarm view, select the alarm you want to edit using the cursor keys.
2. Press ENTER
.
Result
The system executes the additional functions of the alarm. You may find additional
information on this in your plant documentation.
Note
When you edit an unacknowledged alarm, it is acknowledged automatically.

Operating alarms

Operating recipes on OP 77A and OP 77B 10
10.1 Overview
Introduction
Recipes are used when different variants of a product are manufactured with the same
process. In this case, the product variants differ in terms of their type and quantity of the
components, but not in terms of the manufacturing process sequence. The configuration
engineer can store the combination of each individual product variant in a recipe.
Field of application
Recipes can be used everywhere the same product components are used in variable
combinations to create different product variants.
Examples:
● Beverage industry
● Food processing industry
● Pharmaceutical industry
● Paint industry
● Building materials industry
● Steel industry

Operating recipes on OP 77A and OP 77B
10.2 Structure of a recipe
Recipes
The recipe collection for the production of a product family can be compared to a file cabinet.
A recipe which is used to manufacture a product corresponds to a drawer in a file cabinet.
Example:
In a plant for producing fruit juice, recipes are required for different flavors. There is a recipe,
for example, for the flavors orange, grape, apple and cherry.
① File cabinet Recipe collection Recipes for a fruit juice plant

② Drawer Recipe Orange flavored drinks
③ Drawer Recipe Grape flavored drinks
④ Drawer Recipe Apple flavored drinks
⑤ Drawer Recipe Cherry flavored drinks

Recipe data records

The drawers of the file cabinet are filled with suspension folders. The suspension folders in
the drawers represent records required for manufacturing various product variants.
Example:
Product variants of the flavor apple might be a soft drink, a juice or nectar, for example.

① Drawer Recipe Product variants of apple flavored drinks

② Suspension folder Recipe data record Apple drink
③ Suspension folder Recipe data record Apple nectar
④ Suspension folder Recipe data record Apple juice
Elements
In the figure showing the file cabinet, each suspension folder contains the same number of
sheets. Each sheet in the suspension folder corresponds to an element of the recipe data
record. All the records of a recipe contain the same elements. The records differ, however, in
the value of the individual elements.
Example:
All drinks contain the same components: water, concentrate, sugar and flavoring. The
records for soft drink, fruit juice or nectar differ, however, in the quantity of sugar used in
production.

10.3 Recipes in the Project
Overview
If recipes are used in a project, the following components interact:
● HMI device recipe memory
Recipes are saved in the form of data records in the HMI device recipe memory.
The recipe data can also be saved in recipe tags.
● Recipe view / recipe screen
On the HMI device, recipes are displayed and edited in the recipe view or in a recipe
screen.
– The recipe data records from the internal memory of the HMI device are displayed and
edited in the recipe view.
– The values of the recipe tags are displayed and edited in the recipe screen.
Note
The same recipe tags can be configured in a variety of recipes. If you modify the value
of a recipe tag in a recipe, the value of this recipe tag changes in all other recipes.
● Recipe tags on OP 77A

The recipe tags contain recipe data. Recipe tags configured in IO fields are always
automatically synchronized with the recipe view. You can exchange the values of the
recipe tags with the PLC.
● Recipe tags on OP 77B
The recipe tags contain recipe data. When you edit recipes in a recipe screen, the recipe
values are stored in recipe tags.
The recipe tags are not automatically synchronous with the recipe view. You can
synchronize the recipe tags with the recipe data records so that the same values are
saved in both. Depending on the configuration, the values of the recipe tags are
exchanged with the PLC.
● Memory card of OP 77B
The memory card is an external storage medium for recipe data records. The recipe data
records are exported from the HMI device recipe memory and are saved on the memory
card in a CSV file. The records can be imported again from the memory card to the recipe
memory.

Data Flow
The following figure shows the data flow in a project with recipes:
+0,GHYLFH 5HFLSHPHPRU\
5HFLSHYLHZ
5HFLSH
5HFLSH
5HFLSH
5HFLSHQ
5HFLSHWDJ
5HFLSH
VFUHHQ

3/&

0HPRU\FDUG
① Editing, saving or deleting a recipe data record

② Display recipe data record
③ Synchronize or do not synchronize recipe tags
The recipe tags are always synchronized on the OP 77A.
④ Display and edit recipe tags in the recipe screen
⑤ Write records from the recipe view to the PLC or read records from the PLC and
display them in the recipe view.
⑥ OP 77B: Recipe tags are to the PLC online or offline
⑦ OP 77B: Export or import recipe data record to memory card

10.4 Recipe view
10.4 Recipe view
Recipe view
You display recipes and edit them in the recipe view. A recipe view is a screen object used
to manage recipe data records. The recipe view shows recipe data records in tabular form.
The configuration engineer defines which operator controls are displayed in the recipe view.
Only a simple recipe view can be configured on the OP 77A and OP 77B.
Layout of the Simple Recipe View

The simple recipe view consists of three areas:
● Recipe list
● Record list
● Element list
In the simple recipe view, each area is shown separately on the HMI device. Depending on
the configuration, the simple recipe view starts with the recipe list.
The figure below shows an example of the simple recipe view with a data record list.
-XLFH
%HYHUDJH
1HFWDU

① Number of the recipe data record

② Recipe data records
③ Buttons for changing the displayed list and calling the menu

10.5 Operating the Simple Recipe View
Introduction
The simple recipe view consists of three areas:
● Recipe list
● Record list
● Element list
You can use the shortcut menu to operate each of these display areas.
Operation
The simple recipe view can be operated as follows:
● Create recipe data records
● Save recipe data records or save them under a new name
● Rename recipe data records
● Delete recipe data records
● Transfer recipe data records from the PLC and to the PLC
Operator controls of the simple recipe view

Toggle between the display areas and the shortcut menus to operate the simple recipe
views.
The table below shows the operation of the display area:
Key Function
ENTER
The next lower display area opens, i.e. the data record list or the
element list.
ESC The next higher display area opens, i.e. the recipe list or the data record
list.
The shortcut menu of the display area opens.
The previous/next entry is selected in the display area.
A display page is scrolled up in the display area.

SHIFT 9
+
A display page is scrolled down in the display area.
SHIFT 3
+
HOME The first entry is selected and highlighted.
SHIFT .
+
END The last entry is selected and highlighted.
SHIFT 0
+

The table below shows the operation of the shortcut menu.
Key Function
ESC The menu is closed. The display area opens.
Number of the menu The menu command is executed.

command
Shortcut menus of the simple recipe view
A shortcut menu can be called for each display area by pressing the key. The
commands available in the shortcut menu depend on the currently selected display area. A
number is assigned to each command. The command is executed when you enter the
number of the command. You can also use the system keys for some commands.
● Recipe list
Menu System Key Function
command
New SHIFT
INS A new recipe data record is created for the selected recipe. If an initial
+ DEL
value has been configured, this is shown in this input field.
Viewing HELP
The infotext configured for the simple recipe view is displayed.
infotext
Open ENTER
The record list of the selected recipe opens.
● Record list
command
New SHIFT
INS A new data record is created. If an initial value has been configured,
+ DEL
this is shown in this input field.
Delete INS The selected recipe data record is deleted.
DEL
Save as The selected recipe data record is saved under another name. A dialog
box opens in which the name is entered.
Rename The selected recipe data record is renamed. A dialog box opens in
which the name is entered.
Open ENTER
The element list of the selected recipe data record opens.
Back ESC The recipe list opens.
With the OP 77A HMI device, the following menu commands can also be configured for the record
list:
To PLC The displayed values of the selected recipe data record are transferred
from the HMI device to the PLC.
From PLC The recipe values from the PLC are displayed on the HMI device in the
recipe view.
Viewing HELP
infotext

● Element list
command
Save The selected recipe data record is saved.
To PLC The displayed values of the selected recipe data record are transferred
from the HMI device to the PLC.
From PLC The recipe values from the PLC are displayed on the HMI device in the
recipe view.
Save as The selected recipe data record is saved under a new name. A dialog
box opens in which the name is entered.
With the OP 77A HMI device, the following menu commands can also be configured for the element
list:
Viewing HELP
infotext
Rename The selected record is renamed. A dialog box opens in which the name
is entered.
Back ESC The data record list opens.
Keyboard operation of the simple recipe view

TAB
1. Press until the simple recipe view is selected.
2. Select the desired recipe with the cursor keys.
3. Press .
The shortcut menu opens.
4. Use the cursor keys to select the desired menu command and confirm it with the ENTER
key.
Alternatively, press the number of the desired menu command.
The menu command is executed.

10.6 Creating a Recipe Data Record
10.6 Creating a Recipe Data Record
Introduction
Create a new recipe data record in the recipe list or in the record list. Then enter the values
for the new record in the element list and save the record.
Requirement
A screen with a simple recipe view is displayed.
Procedure
Proceed as follows:
1. If the recipe list contains several recipes: Select the recipe for which you want to create a
new recipe data record.
2. Open the recipe list menu.
3. Select the menu command "New".
A new record is created.
The element list of the new record opens.
4. Enter values for the elements of the data record.
The tags of the record can be assigned default values depending on the configuration.
5. Open the menu of the element list and select the command "Save".
6. Enter a name for the new record.
7. Confirm your entries.
If you change the new data record number to an existing data record number, the existing
data record is overwritten.
Result
The new recipe data record is saved to the selected recipe.
See also
Operating the Simple Recipe View (Page 179)

10.7 Editing a Recipe Data Record
10.7 Editing a Recipe Data Record
Introduction
Edit the values of the recipe data records in a simple recipe view.
Synchronization with the PLC

If you want to display the current recipe values from the PLC in the simple recipe view, you
first have to read the current values from the PLC with the menu command "From PLC" in
the element list.
The values changed in the recipe view only take effect in the PLC when you transfer the
edited data record to the PLC with the menu command "To PLC".
Requirement
Procedure
Proceed as follows:
1. If the recipe list contains several recipes: Select the recipe which contains the desired
recipe data record.
2. Open the data record list.
3. Select the recipe data record you want to change.
4. Open the element list.
5. Change the values of the records as required.
6. Save your changes with the menu command "Save".
The recipe data record is saved.
Result
The edited recipe data record has now been saved in the selected recipe.
See also

10.8 Deleting a Recipe Data Record
10.8 Deleting a Recipe Data Record
Introduction
You can delete all the data records which are not required.
Requirement
Procedure
Proceed as follows:
recipe data record.
2. Open the data record list.
3. Select the data record you want to delete.
4. Open the menu.
5. Select the menu command "Delete".
Result
The data record is deleted.
See also

10.9 Reading a Recipe Data Record from the PLC
10.9 Reading a Recipe Data Record from the PLC
Introduction
The values of recipe elements are exchanged with the PLC via tags.
In the current project, the values which are also stored in the recipes in the HMI device can
be changed directly in the plant. This is the case, for example, if a valve was opened further
directly at the plant than is stored in the recipe. The values of the tags on the HMI device
possibly no longer match the values in the PLC.
To synchronize the recipe values, read the values from the PLC and display them in the
recipe view.
OP 77A
With the OP 77A HMI device, the "From PLC" menu command can also be configured for
the data record list: In this case, you can also select the "From PLC" menu command in the
data record list.
Requirement
Procedure
Proceed as follows:
recipe data record.
2. Select the element list of the recipe data record to which you want to apply the values
from the PLC.
3. Open the menu.
4. Select the menu command "From PLC".
The values are read from the PLC.
5. If you want to save the displayed values in the HMI device, select the menu command
"Save".
Result
The values were read from the PLC, displayed on the HMI device and saved to the selected
recipe data record.
See also

10.10 Transferring a Recipe Data Record to the PLC
10.10 Transferring a Recipe Data Record to the PLC
Introduction
In order for an edited recipe data record to take effect in the process, you must transfer the
values to the PLC.
The displayed values in the recipe view are always transferred to the PLC.
OP 77A
With the OP 77A HMI device, the "To PLC" menu command can also be configured for the
data record list: In this case, you can also select the "To PLC" menu command in the data
record list.
Requirement
Procedure
Proceed as follows:
recipe data record.
2. Select the element list of the recipe data record whose values you want to transfer to the
PLC.
3. Open the menu.
4. Select the menu command "To PLC".
Result
The values of the recipe data record were transferred to the PLC and take effect in the
process.
See also

10.11 Exporting and Importing Recipe Data Records on the OP 77B
Introduction
Based on your configuration, you can either export recipe data records to a CSV file for
editing in MS Excel, for example, or import these from a CSV file. The extent to which you
can influence these processes is determined by the project configuration. For example, you
can configure various input fields on the user interface:
● Input of the path to the CSV file
● Selection of the recipe data records for export
● Overwriting an existing CSV file
Export recipe data record
Requirement
Export functions are configured.
Procedure
1. Customize the export settings on the user interface of the HMI device.
2. Press the button or the corresponding key on the HMI device configured with the "Export
recipe records" function.
Result
The recipe data records are exported to a CSV file.
Note
New data records created in runtime can be exported to an external file.
Importing recipe records
Requirement
Import functions are configured.
Procedure
1. Customize the import settings on the user interface of the HMI device.
2. Use the button or the key on the HMI device which is assigned the "Import recipe
records" function.

Result
The recipe data records are imported. If the structure of the CSV file is different from the
recipe structure, deviations are treated as follows:
● Any additional values in the CSV file will be rejected.
● If the CSV file contains values of the wrong data type, the configured default value is set
in the recipe record.
Example:
The CSV file contains values that show the tank contents and were input as floating point
numbers. However, the corresponding recipe tag expects an integer value. In this case,
the system discards the imported value and uses the configured default.
● The system also applies the configured default value to the recipe data record if the CSV
file contains an insufficient number of values.

Maintenance and Service 11
11.1 Maintenance and service
Scope of maintenance
The HMI device is designed for maintenance-free operation. However, you should clean the
keyboard membrane and the display unit at regular intervals.
Preparation
CAUTION
Faulty operation
Always switch off the HMI device before cleaning it. This will ensure that you do not trigger
unintended functions when you touch the keys.
Use a cloth dampened with a cleaning agent to clean the equipment. Only use water with a
little liquid soap or a screen cleaning foam.
Procedure
Never spray the cleaning agent directly onto the HMI device. Apply it to a cloth. Never use
aggressive solvents or scouring powder.
CAUTION
Do not clean the HMI device with compressed air or steam jet blowers.

Maintenance and Service
11.2 Servicing and spare parts
11.2 Servicing and spare parts
Repairs
A defective device must be returned to the manufacturer's site for repair. The HMI device
may only be repaired at the manufacturer's site.
Service pack
A service pack can be ordered for servicing purposes. It contains the following spare parts:
● Mounting seal
● Labeling strips
● Mounting clamps
● Terminal block
The service pack can be ordered from your Siemens representative.

Specifications 12
12.1 Dimension drawings
12.1.1 Dimension Drawings of the OP 73
153 28
83
67
137
6.2
Figure 12-1 Overall dimensions of the HMI device

Specifications
12.1 Dimension drawings
12.1.2 Dimension Drawings of OP 77A and OP 77B
150 38.5
186
170
134
6.2
Figure 12-2 Dimension drawings of OP 77A and OP 77B

Specifications
12.2 Specifications
12.2 Specifications
12.2.1 Specifications of the OP 73
Enclosure
Weight without packing Approx. 250 g
Display
Type LCD STN

Display area, active 79.98 mm x 23.98 mm or 3"
Resolution 160 x 48 pixels
Colors, displayable 2
Contrast control Yes
Back-lighting LED green
Half Brightness Life, typical 100,000 h
Input unit
Type Membrane keyboard

System keys with dedicated functions 8
Soft keys 4
Of those freely configurable 4
Memory
Working memory 256 KB
Power supply
Nominal voltage +24 V DC

Range, permissible 20.4 V to 28.8 V (–15 %, +20 %)
Transients, maximum permissible 35 V (500 msec)
Time between two transients, minimum 50 s
Current consumption at nominal power
• Typical • Approx. 80 mA
• Constant current, maximum • Approx. 210 mA
• Power on current surge I2t • Approx. 0.5 A2s
Fuse, internal Electronic

Specifications
12.2 Specifications
See also
Standards, Certificates and Approvals (Page 24)
Transport and storage conditions (Page 31)
Mounting information (Page 33)
Mounting positions and fixation (Page 35)
Information on insulation tests, protection class and degree of protection (Page 39)
12.2.2 Specifications of the OP 77A
Enclosure
Display
Type LCD STN

Display area, active 102.38 mm x 40.94 mm or 4.3"
Colors, displayable Monochrome, yellow-green
Brightness, typical 20 cd/m2
Input unit

Soft keys 8
Labeling strips 2 for the keys:
F1 to F4 and K1 to K4
Keys with LEDs 4, keys K1 to K4
Memory
Working memory 256 KB

Specifications
12.2 Specifications
Power supply

Range, permissible 20.4 V to 28.8 V (─15%, +20%)
See also
12.2.3 Specifications of the OP 77B
Enclosure
Display
Type LCD STN

Display area, active 102.38 mm x 40.94 mm or 4.3"
Colors, displayable Monochrome, yellow-green
Brightness, typical 20 cd/m2

Specifications
12.2 Specifications
Input unit

Soft keys 8
Labeling strips 2 for the keys:
F1 to F4 and K1 to K4
Keys with LEDs 4, keys K1 to K4
Memory
Working memory 1 MB
Memory card MMC, optional
Power supply

Range, permissible 20.4 V to 28.8 V (–15%, +20%)
See also

Specifications
12.3 Description of interfaces
12.3.1 Power supply

Plug connector, 2-pin
1 2
Figure 12-3 Power supply pin assignment
PIN Assignment
1 +24 V DC
2 GND 24 V
12.3.2 RS 485 (IF 1B) on OP 73

Sub-d socket, 9-pin, with screw lock
5 1
9 6
Figure 12-4 RS 485 interface pin assignment
PIN Assignment
1 n. c.
2 GND 24 V
3 Data channel B (+)
4 RTS
5 GND 5 V, floating potential
6 +5 V DC, floating potential
7 +24 V DC, out (max. 100 mA) or +24 V DC in1
8 Data channel A (–)
9 n. c.
1 Applies when power is supplied from the CPU
CAUTION
Power supply
When the HMI device is supplied with power from the CPU, do not connect an external
power supply to it.

Specifications
12.3.3 RS 485 (IF 1B) on OP 77A

5 1
9 6
PIN Assignment
1 n. c.
2 GND 24 V
3 Data channel B (+)
4 RTS 1
7 +24 V DC, out (max. 100 mA)
8 Data channel A (–)
9 RTS 1
1 On pin 4 or 9, set with DIL switch
12.3.4 RS 422/RS 485 (IF 1B) on OP 77B

5 1
9 6
Figure 12-6 Pin assignment of the RS 485 and RS 422 interfaces
PIN Pin assignment RS 422 Pin assignment RS 485

1 n. c.
2 GND 24 V
3 TxD+ Data channel B (+)
4 RxD+ RTS 1
7 +24 V DC, out (max. 100 mA)
8 TxD– Data channel A (–)
9 RxD– RTS 1
1 On pin 4 or 9, set with DIL switch

Specifications
12.3.5 RS 232 (IF 1A) on OP 77B
1
2
3
4
5
6
7
8
9
Figure 12-7 Pin switching
Sub-D plug, 9-pin, secured by screws
5 1
9 6
PIN Assignment
1 DCD
2 RxD
3 TxD
4 DTR
5 GND
6 DSR
7 RTS
8 CTS
9 n. c.

Specifications
12.3.6 USB on OP 77B

USB standard connector
1 4
Figure 12-9 USB standard connector pin assignment
PIN Assignment
1 +5 V DC, out (max. 100 mA)
2 USB-DN
3 USB-DP
4 GND 5 V

Appendix A
A.1 ESD Directives
What does ESD mean?

All electronic modules are equipped with highly integrated modules or components. Based
on their design, these electronic components are highly sensitive to overvoltage and thus to
discharge of static electricity. These electronic components are therefore specially identified
as ESD.
Abbreviation
The following abbreviations are commonly used for electrostatic sensitive devices:
● ESD – Electrostatic Sensitive Devices
● ESD – Electrostatic Sensitive Device as common international designation
Labeling
ESD modules are labeled with the following symbol:
Figure A-1 ESD label

Appendix
A.1 ESD Directives
Electrostatic charge
CAUTION
Electrostatic charge
ESDs may be destroyed by voltages well below the perception threshold of persons
Voltages of this kind develop when a component or an assembly is touched by a person
who is not grounded against static electricity. Usually, it is unlikely that damage to an ESD
as a result of overvoltage is detected immediately but may become apparent only after a
longer period of operation.
Prevent electrostatic charge of your body before you touch the ESD!
Anyone who is not connected to the electrical potential of their surroundings is subjected to
electrostatic charge.
The figure indicates the maximum electrostatic charge anyone is subjected to when
contacting the materials shown. These values correspond with specifications to IEC 801-2.
>9@
9ROWDJH

>@
5HODWLYHKXPLGLW\
Figure A-2 Electrostatic voltages with which a person can be charged.
① Synthetic materials
② Wool
③ Antistatic materials such as wood or concrete

Appendix
A.2 System alarms
Protective measures against discharge of static electricity
CAUTION
Grounding measures
When working with electrostatic sensitive devices, make sure that the person, the
workplace and the packaging are properly grounded. This helps to avoid electrostatic
charge.
As a rule, only touch the ESD if this is unavoidable. Example: for maintenance. When you
touch modules, make sure that you do not touch the pins on the modules or the PCB tracks.
This prevents any discharge of static electricity to sensitive component and thus avoids
damage.
Discharge electrostatic electricity from your body if you are performing measurements on an
ESD. To do so, touch a grounded metallic object.
Always use grounded measuring instruments.
A.2 System alarms
Introduction
System alarms on the HMI device provide information about internal states of the HMI device
and PLC.
The overview below shows the causes of system alarms and how to eliminate the cause of
error.
Depending on functionality, only parts of the system alarms described in this section apply to
the various HMI devices.
Note
System alarms are only indicated if an alarm window was configured. System alarms are
output in the language currently set on your HMI device.
System alarm parameters

System alarms may contain encrypted parameters which are relevant to troubleshooting
because they provide a reference to the source code of the Runtime software. These
parameters are output after the text "Error code:"

Appendix
A.2 System alarms
Meaning of the system alarms
Number Effect/cause Remedy

10000 The print job could not be started or was canceled Check the printer settings, cable connections and the
due to an unknown error. Faulty printer setup. Or: power supply.
Access to the network printer is not allowed. Set up the printer once again. Obtain a network printer
Power supply failure during data transfer. authorization.
If the error persists, contact the Hotline!
10001 No printer is installed or a default printer has not Install a printer and/or select it as the default printer.
been set up.
10002 Overflow of the graphics buffer for printing. Up to Allow sufficient intervals between successive print jobs.
two images are buffered.
10003 Images can now be buffered again. -
10004 Overflow of the buffer for printing lines in text mode Allow sufficient intervals between successive print jobs.
(e.g.alarms). Up to 1000 lines are buffered.
10005 Text lines can now be buffered again. -
10006 The Windows printing system reports an error. Repeat the action if necessary.
Refer to the output text and the error ID to
determine the possible causes. Nothing is printed
or the print is faulty.
20010 An error has occurred in the specified script line. Select the specified script line in the configuration.
Execution of the script was therefore aborted. Note Ensure that the tags used are of the allowed types.
the system alarm that may have occurred prior to Check system functions for the correct number and types
this. of parameters.
20011 An error has occurred in a script that was called by In the configuration, select the script that has been called
the specified script. directly or indirectly by the specified script.
Execution of the script was therefore aborted in the Ensure that the tags used are of the allowed types.
called script. Check the system functions for the correct number and
Take the system alarm that may have occurred type of parameters.
prior to this into account.
20012 The configuration data is inconsistent. The script Recompile the configuration.
could therefore not be generated.
20013 The scripting component of WinCC flexible Runtime Reinstall WinCC flexible Runtime.
is not correctly installed. Therefore, no scripts can
be executed.
20014 The system function returns a value that is not Select the specified script in the configuration.
written in any return tag. Check if the script name has been assigned a value.
20015 Too many successive scripts have been triggered Find what is triggering the scripts. Extend the times, e.g.
in short intervals. When more than 20 scripts are the polling time of the tags which trigger the scripts.
queued for processing, any subsequent scripts are
rejected. In this case, the script indicated in the
alarm is not executed.
30010 The tag could not accept the function result, e.g. Check the tag type of the system function parameter.
when it has exceeded the value range.
30011 A system function could not be executed because Check the parameter value and tag type of the invalid
the function was assigned an invalid value or type parameter. If a tag is used as a parameter, check its
in the parameter. value.
40010 The system function could not be executed since Check the parameter types in the configuration.
the parameters could not be converted to a
common tag type.

Appendix
A.2 System alarms

40011 The system function could not be executed since Check the parameter types in the configuration.
the parameters could not be converted to a
common tag type.
50000 The HMI device is receiving data faster than it is -
capable of processing. Therefore, no further data is
accepted until all current data have been
processed. Data exchange then resumes.
50001 Data exchange has been resumed. -
60000 This alarm is generated by the -
“DisplaySystemAlarms” function. The text to be
displayed is transferred to the function as a
parameter.
60010 The file could not be copied in the direction defined Restart the system function or check the paths of the
because one of the two files is currently open or the source/target files. Using Windows NT/2000/XP: The user
source/target path is not available. executing WinCC flexible Runtime must be granted
It is possible that the Windows user has no access access rights for the files.
rights to one of the two files.
60011 An attempt was made to copy a file to itself. Check the path of the source/target file.
It is possible that the Windows user has no access Using Windows NT/2000/XP with NTFS: The user
rights to one of the two files. executing WinCC flexible Runtime must be granted
access rights for the files.
70010 The application could not be started because it Check if the application exists in the specified path or
could not be found in the path specified or there is close other applications.
insufficient memory space.
70011 The system time could not be modified. Check the time which is to be set.
The error alarm only appears in connection with Using Windows NT/2000/XP: The user executing WinCC
area pointer "Date/time PC". Possible causes: flexible Runtime must be granted the right to change the
• An invalid time was transferred in the job system time of the operating system.
mailbox.
• The Windows user has no right to modify the
system time.
If the first parameter in the system alarm is
displayed with the value 13, the second parameter
indicates the byte containing the incorrect value.
70012 An error occurred when executing the function Close all programs currently running.
"StopRuntime" with the option "Runtime and Then close Windows.
operating system".
Windows and WinCC flexible Runtime are not
closed.
One possible cause is that other programs cannot
be closed.
70013 The system time could not be modified because an Check the time which is to be set.
invalid value was entered. Incorrect separators may
have been used.
70014 The system time could not be modified. Possible Check the time which is to be set.
causes: Using Windows NT/2000/XP: The user executing WinCC
• An invalid time was transferred. flexible Runtime must be granted the right to change the
system time of the operating system.
• The Windows user has no right to modify the
system time.
• Windows rejects the setting request.

Appendix
A.2 System alarms

70015 The system time could not be read because -
Windows rejects the reading function.
70016 An attempt was made to select a screen by means Check the screen number in the function or job with the
of a system function or job. This is not possible screen numbers configured.
because the screen number specified does not Assign the number to a screen if necessary.
exist.
Or: A screen could not be generated due to
insufficient system memory.
70017 Date/Time is not read from the area pointer Change the address or set up the address in the
because the address set in the controller is either controller.
not available or has not been set up.
70018 Acknowledgment that the password list has been -
successfully imported.
70019 Acknowledgment that the password list has been -
successfully exported.
70020 Acknowledgment for activation of alarm reporting. -
70021 Acknowledgment for deactivation of alarm -
reporting.
70022 Acknowledgment to starting the Import Password -
List action.
70023 Acknowledgment to starting the Export Password -
List action.
70024 The value range of the tag has been exceeded in Check the desired calculation and correct it if necessary.
the system function.
The calculation of the system function is not
performed.
70025 The value range of the tag has been exceeded in Check the desired calculation and correct it if necessary.
the system function.
The calculation of the system function is not
performed.
70026 No other screens are stored in the internal screen -
memory.
No other screens can be selected.
70027 The backup of the RAM file system has been -
started.
70028 The files from the RAM have been copied in the -
Flash memory.
The files from the RAM have been copied in the
Flash memory. Following a restart, these saved
files are copied back to the RAM file system.
70029 Backup of the RAM file system has failed. Check the settings in the "Control Panel > OP" dialog and
No backup copy of the RAM file system has been save the RAM file system using the "Save Files" button in
made. the "Persistent Storage" tab.
70030 The parameters configured for the system function Compare the parameters configured for the system
are faulty. function with the parameters configured for the controllers
The connection to the new controller was not and correct them as necessary.
established.
70031 The controller configured in the system function is Compare the S7 controller name parameter configured
not an S7 controller. for the system function with the parameters configured for
The connection to the new controller was not the controller and correct them as necessary.
established.

Appendix
A.2 System alarms

70032 The object configured with this number in the tab Check the number of the tab order and correct it if
order is not available in the selected screen. necessary.
The screen changes but the focus is set to the first
object.
70033 An e-mail cannot be sent because a TCP/IP Check the network connection to the SMTP server and
connection to the SMTP server no longer exists. re-establish it if necessary.
This system alarm is generated only at the first
attempt. All subsequent unsuccessful attempts to
send an e-mail will no longer generate a system
alarm. The event is regenerated when an e-mail
has been successfully sent in the meantime.
The central e-mail component in WinCC flexible
Runtime attempts, in regular intervals (1 minute), to
establish the connection to the SMTP server and to
send the remaining e-mails.
70034 Following a disruption, the TCP/IP connection to -
the SMTP server could be re-established.
The queued e-mails are then sent.
70035 The e-mail queue of the central component in Check if
WinCC flexible Runtime responsible for sending • the network connection still exists or
e-mails is full. The e-mail could therefore not be
• the connection is overloaded (for example, due to
entered into the queue and therefore not sent. reoccurring system alarms resulting from disruptions).
The cause may be a broken connection to the
SMTP server or an overload resulting from too
much e-mail traffic.
This system alarm is generated only at the first
attempt. The next system alarm is only generated
when at least one e-mail has been successfully
sent to the queue in the meantime.
70036 No SMTP server for sending e-mails is configured. Configure an SMTP server:
An attempt to connect to an SMTP server has failed In WinCC flexible Engineering System
and it is not possible to send e-mails. using "Device settings > Device settings"
WinCC flexible Runtime generates the system
In the Windows CE operating system
alarm after the first attempt to send an e-mail.
using "Control Panel > Internet Settings > E-mail > SMTP
Server"
70037 An e-mail cannot be sent for unknown reasons. Check the e-mail parameters (recipient etc.).
The contents of the e-mail are lost.
70038 The SMTP server has rejected sending or Check the domain of the recipient address or deactivate
forwarding an e-mail because the domain of the the authentication on the SMTP server if possible. SMTP
recipient is unknown to the server or because the authentication is currently not used in WinCC flexible
SMTP server requires authentication. Runtime.
The contents of the e-mail are lost.
70039 The syntax of the e-mail address is incorrect or Check the e-mail address of the recipient.
contains illegal characters.
The contents of the e-mail are discarded.
70040 The syntax of the e-mail address is incorrect or -
contains illegal characters.
80001 The log specified is filled to the size defined (in Store the file or table by executing a ‘move’ or ‘copy’
percent) and must be stored elsewhere. function.
80002 A line is missing in the specified log. -

Appendix
A.2 System alarms

80003 The copying process for logging was not -
successful.
In this case, it is advisable to check any
subsequent system alarms, too.
80006 Since logging is not possible, this causes a In the case of databases, check if the corresponding data
permanent loss of the functionality. source exists and start up the system again.
80009 A copying action has been completed successfully. -
80010 Since the storage location was incorrectly entered Configure the storage location for the respective log
in WinCC flexible, this causes a permanent loss of again and restart the system when the full functionality is
the functionality. required.
80012 Log entries are stored in a buffer. If the values are Archive fewer values.
read to the buffer faster than they can be physically Or:
written (using a hard disk, for example), Increase the logging cycle.
overloading may occur and recording is then
stopped.
80013 The overload status no longer applies. Archiving -
resumes the recording of all values.
80014 The same action was triggered twice in quick -
succession. Since the process is already in
operation, the action is only carried out once.
80015 This system alarm is used to report DOS or -
database errors to the user.
80016 The logs are separated by the system function Reconnect the logs.
"CloseAllLogs" and the incoming entries exceed the
defined buffer size.
All entries in the buffer are deleted.
80017 The number of incoming events cause a buffer Stop the copy action.
overflow. his can be caused, for example, by
several copying actions being activated at the same
time.
All copy jobs are deleted.
80018 All connections between WinCC flexible and the -
logs have been reestablished, for example, after
executing the system function "OpenAllLogs".
Entries are written into the logs again.
80019 The connection between WinCC flexible and all -
logs were closed, for example, after executing the
system function "CloseAllLogs".
Entries are written to the buffer and are then written
to the logs when a connection is re-established.
There is no connection to the storage location and
the storage medium may be replaced, for example.
80020 The maximum number of simultaneously copy Wait until the current copying actions have been
operations has been exceeded. Copying is not completed, then restart the last copy action.
executed.
80021 An attempt was made to delete a log which is still Wait until the current copying actions have been
busy with a copy action. Deletion has not been completed, then restart the last action
executed.

Appendix
A.2 System alarms

80022 An attempt was made to start a sequence log, In the project, check
which is not a sequence log, from a log using the • if the "StartSequenceLog" system function was
system function "StartSequenceLog". No sequence properly configured
log file is created. • if the tag parameters are properly provided with data
on the HMI device
80023 An attempt was made to copy a log to itself. In the project, check
The log is not copied. • if the "CopyLog" system function was properly
configured
• if the tag parameters are properly provided with data
on the HMI device
80024 The "CopyLog" system function does not allow Edit the "CopyLog" system function in the project if
copying when the target log already contains data necessary. Before you initiate the system function, delete
("Mode" parameter). The log is not copied. the destination log file.
80025 You have canceled the copy operation. -
Data written up to this point are retained. The
destination log file (if configured) is not deleted.
The cancellation is reported by an error entry
$RT_ERR$ at the end of the destination log.
80026 This alarm is output after all logs are initialized. -
Values are written to the logs from then on. Prior to
this, no entries are written to the logs, irrespective
whether WinCC flexible Runtime is active or not.
80027 The internal Flash memory has been specified as Configure "Storage Card" or a network path as the
the storage location for a log. This is not storage location.
permissible.
No values are written to this log and the log file is
not created.
80028 The alarm returns a status report indicating that the -
logs are currently being initialized. No values are
logged until the alarm 80026 is output.
80029 The number of logs specified in the alarm could not Evaluate the additional system alarms , related to this
be initialized. The logs are initialized. alarm which is also generated.
The faulty log files are not available for logging Check the configuration, the ODBC (Open Database
jobs. Connectivity) and the specified drive.
80030 The structure of the existing log file does not match Delete the existing log data manually, in advance.
the expected structure.
Logging is stopped for this log.
80031 The log in CSV format is corrupted. Delete the faulty file.
The log cannot be used.
80032 Logs can be assigned events. These are triggered Close WinCC flexible Runtime, delete the log, then restart
as soon as the log is full. If WinCC flexible Runtime WinCC flexible Runtime.
is started and the log is already full, the event is not Or:
triggered. Configure a button which contains the same actions as
The log specified no longer logs data because it is the event and press it.
full.
80033 "System Defined" is set in the data log file as the Install MSDE again.
data source name. This causes an error. No data is
written to the database logs, whereas the logging to
the CSV logs works.

Appendix
A.2 System alarms

80034 An error has occurred in the initialization of the No action is necessary. However, it is recommended to
logs. An attempt has been made to create the save the backup files or delete them in order to make the
tables as a backup. This action was successful. A space available again.
backup has been made of the tables of the
corrupted log file and the cleared log was restarted.
80035 An error has occurred in the initialization of the It is recommended to save the backups or to delete them
logs. An attempt has been made to create backups in order to release memory.
of the tables and this has failed. No logging or
backup has been performed.
110000 The operating mode was changed. "Offline" mode -
is now set.
110001 The operating mode was changed. "Online" mode -
is now set.
110002 The operating mode was not changed. Check the connection to the controllers.
Check if the address area for the area pointer 88
“Coordination" in the controller is available.
110003 The operating mode of the specified controller was -
changed by the system function
"SetConnectionMode".
The operating mode is now "offline".
110004 The operating mode of the specified controller has -
been changed by the system function
"SetConnectionMode".
The operating mode is now "online".
110005 An attempt was made to use the system function Switch the complete system to "online" mode, then
SetConnectionMode to switch the specified execute the system function again.
controller to "online" mode, although the entire
system is in "offline" mode. This changeover is not
allowed. The controller remains in "offline" mode.
110006 The content of the "project version" area pointer Check:
does not match the user version configured in • the project version entered on the controller
WinCC flexible. WinCC flexible Runtime is
• the project version entered in WinCC flexible
therefore closed.
120000 The trend is not shown because you configured an Change the configuration.
incorrect axis to the trend or an incorrect trend.
120001 The trend is not shown because you configured an Change the configuration.
incorrect axis to the trend or an incorrect trend.
120002 The trend is not displayed because the tag Check if the data area for the tag exists in the controller,
assigned attempts to access an invalid controller the configured address is correct and the value range for
address. the tag is correct.
130000 The action was not executed. Close all other programs.
Delete files no longer required from the hard disk.
130001 The action was not executed. Delete files no longer required from the hard disk.
130002 The action was not executed. Close all other programs.
Delete files no longer required from the hard disk.
130003 No data medium found. The operation is canceled. Check, for example, if
• the correct data medium is being accessed
• the data medium is inserted
130004 The data medium is write-protected. The operation Check if access has been made to the correct data
is canceled. carrier. Remove the write protection.

Appendix
A.2 System alarms

130005 The file is read only. The operation is canceled. Check if access has been made to the correct file. Edit
the file attributes if necessary.
130006 Access to file failed. The operation is canceled. Check, for example, if
• the correct file is being accessed
• the file exists
• another action is preventing simultaneous access to
the file
130007 The network connection is interrupted. Check the network connection and eliminate the cause of
Data records cannot be saved or read over the error.
network connection.
130008 The storage card is not available. Insert the storage card.
Data records cannot be saved to / read from the
storage card.
130009 The specified folder does not exist on the storage Insert the storage card.
card.
Any files saved to this directory are not backed up
when you switch off the HMI device.
130010 The maximum nesting depth can be exhausted Check the configuration.
when, for example, a value change in a script
results in the call of another script and the second
script in turn has a value change that results in the
call of yet a further script etc.
The configured functionality is not supported.
140000 An online connection to the controller is -
established.
140001 The online connection to the controller was shut -
down.
140003 No tag updating or writing is executed. Check the connection and if the controller is switched on.
Check the parameter definitions in the Control Panel
using "Set PG/PC interface".
Restart the system.
140004 No tag update or write operations are executed Verify the connection and check if the controller is
because the access point or the module switched on.
configuration is faulty. Check the access point or the module configuration (MPI,
PPI, PROFIBUS) in the Control Panel with "Set PG/PC
interface".
Restart the system.
140005 No tag updating or writing is executed because the Use a different HMI device address.
HMI device address is incorrect (possibly too high). Verify the connection and check ifthe controller is
switched on.
Check the parameter definitions in the Control Panel
using "Set PG/PC interface".
Restart the system.
140006 No tag updating or writing is executed because the Select a different baud rate in WinCC flexible (according
baud rate is incorrect. to module, profile, communication peer, etc.).

Appendix
A.2 System alarms

140007 Tag are not updated or written because the bus Check the user-defined bus profile.
profile is incorrect (see %1). Check the connection and if the controller is switched on.
The following parameter could not be written to the Check the parameter definitions in the Control Panel
registry:: using "Set PG/PC interface".
1: Tslot Restart the system.
2: Tqui
3: Tset
4: MinTsdr
5: MaxTsdr
6: Trdy
7: Tid1
8: Tid2
9: Gap Factor
10: Retry Limit
140008 No tag updating or writing is executed because Check the connection and if the controller is switched on.
baud rate is incorrect. The following parameters Check the parameter definitions in the Control Panel
could not be written to the registry: using "Set PG/PC interface".
0: General error Restart the system.
1: Wrong version
2: Profile cannot be written to the registry.
3: The subnet type cannot be written to the
registry.
4: The Target Rotation Time cannot be written to
the registry.
5: Faulty Highest Address (HSA).
140009 Tags are not updated or written because the Reinstall the module in the Control Panel using "Set
module for S7 communication was not found. PG/PC interface".
140010 No S7 communication partner found because the Switch the controller on.
controller is shut down. DP/T:
DP/T: If only one master is connected to the network, disable
The option “PG/PC is the only master” is not set in "PG/PC is the only master" in "Set PG/PC interface".
the Control Panel under “Set PG/PC interface.” If several masters are connected to the network, enable
these. Do not change any settings, for this will cause bus
errors.
140011 No tag updating or writing is executed because Check the connection and that the communication
communication is down. partner is switched on.
140012 There is an initialization problem (e.g. when WinCC Restart the HMI device.
flexible Runtime was closed in Task Manager). Or:
Or: Run WinCC flexible Runtime, then start your other
Another application (e.g.STEP7) with different bus applications.
parameters is active and the driver cannot be
started with the new bus parameters (transmission
rate, for example).
140013 The MPI cable is disconnected and, thus, there is Check the connections.
no power supply.
140014 The configured bus address is in already in use by Edit the HMI device address in the controller
another application. configuration.
140015 Wrong transmission rate Correct the relevant parameters.
Or:
Faulty bus parameters (e.g.HSA)
Or:
OP address > HSA or: Wrong interrupt vector
(interrupt does not arrive at the driver)

Appendix
A.2 System alarms

140016 The hardware does not support the configured Change the interrupt number.
interrupt.
140017 The set interrupt is in use by another driver. Change the interrupt number.
140018 The consistency check was disabled by SIMOTION Enable the consistency check with SIMOTION Scout and
Scout. Only a corresponding note appears. once again download the project to the PLC.
140019 SIMOTION Scout is downloading a new project to Wait until the end of the reconfiguration.
the controller. Connection to the controller is
canceled.
140020 The version in the controller and that of the project The following remedies are available:
(FWX file) do not match. Download the current version to the PLC using
Connection to the controller is canceled SIMOTION Scout.
Regenerate the project using WinCC flexible ES, close
WinCC flexible Runtime and restart with a new
configuration.
150000 No more data is read or written. Possible causes: Ensure that the cable is plugged in, the controller is
• The cable is defective. operational, the correct interface is being used.
Restart the system if the system alarm persists.
• The PLC does not respond, is defective, etc.
• The wrong port is used for the connection.
• System overload.
150001 Connection is up because the cause of the -
interruption has been eliminated.
160000 No more data is read or written. Possible causes: Ensure that the cable is plugged in, the controller is
• The cable is defective. operational, the correct interface is being used.
• The wrong port is used for the connection.
160010 No connection to the server because the server Check access rights.
identification (CLS-ID) cannot be determined.
Values cannot be read or written.
160011 No connection to the server because the server Check, for example, if
identification (CLS-ID) cannot be determined. • the server name is correct
• the computer name is correct
• the server is registered
160012 No connection to the server because the server Check, for example, if
identification (CLS-ID) cannot be determined. • the server name is correct
• the computer name is correct
• the server is registered
Note for advanced users:
Interpret the value from HRESULT.
160013 The specified server was started as InProc server. Configure the server as OutProc Server or Local Server.
This has not been released and may possibly lead
to incorrect behavior because the server is running
in the same process area as the WinCC flexible
Runtime software.

Appendix
A.2 System alarms

160014 Only one OPC server project can be started on a Do not start a second project with OPC server
PC/MP. An alarm is output when an attempt is functionality on the computer.
made to start a second project.
The second project has no OPC server functionality
and cannot be located as an OPC server by
external sources.
170000 S7 diagnostics events are not indicated because it -
is not possible to log on to the S7 diagnostics
functions at this device. The service is not
supported.
170001 The S7 diagnostics buffer cannot be viewed Set the controller to online mode.
because communication with the controller is shut
down.
170002 The S7 diagnostics buffer cannot be viewed -
because reading of the diagnostics buffer (SSL)
was canceled with error.
170003 An S7 diagnostics event cannot be visualized. The -
system returns internal error %2.
170004 An S7 diagnostics event cannot be visualized. The -
system returns an internal error of error class %2,
error number %3.
170007 It is not possible to read the S7 diagnostics buffer -
(SSL) because this operation was canceled with an
internal error of class %2 and error code %3.
180000 A component/OCX received configuration data with Install a newer component.
a version ID which is not supported.
180001 System overload because too many actions Several remedies are available:
running in parallel. Not all the actions can be • Increase the configured cycle times or basic clock.
executed, some are rejected.
• Generate the alarms at a slower rate (polling).
• Initiate scripts and functions at greater intervals.
If the alarm appears more frequently:
Restart the HMI device.
180002 The on-screen keyboard could not be activated. Reinstall WinCC flexible Runtime.
Possible causes:
"TouchInputPC.exe" was not registered due to a
faulty Setup.
190000 It is possible that the tag is not updated. -
190001 The tag is updated after the cause of the last error -
state has been eliminated (return to normal
operation).
190002 The tag is not updated because communication Select the system function "SetOnline" to go online.
with the controller is down.
190004 The tag is not updated because the configured tag Check the configuration.
address does not exist.
190005 The tag is not updated because the configured Check the configuration.
controller type does not exist for this tag.
190006 The tag is not updated because it is not possible to Check the configuration.
map the controller type in the data type of the tag.

Appendix
A.2 System alarms

190007 The tag value is not modified because the Set online mode or reconnect to the controller.
connection to the controller is interrupted or the tag
is offline.
190008 The threshold values configured for the tag have Observe the configured or current threshold values of the
been violated, for example, by tag.
• a value entered
• a system function
• a script
190009 An attempt has been made to assign the tag a Observe the range of values for the data type of the tags.
value which is outside the permitted range of
values for this data type.
For example, a value of 260 was entered for a byte
tag or a value of -3 for an unsigned word tag.
190010 Too many values are written to the tag (for Increase the time interval between multiple write actions.
example, in a loop triggered by a script).
Values are lost because only up to 100 actions are
saved to the buffer.
190011 Possible cause 1:
The value entered could not be written to the Make sure that the value entered lies within the range of
configured controller tag because the high or low values of the control tags.
limit was exceeded.
The system discards the entry and restores the
original value.
Possible cause 2:
The connection to the controller was interrupted. Check the connection to the PLC.
190012 It is not possible to convert a value from a source Check the range of values or the data type of the tags.
format to a target format, for example:
An attempt is being made to assign a value to a
counter that is outside the valid, PLC-specific value
range.
A tag of the type Integer should be assigned a
value of the type String.
190100 The area pointer is not updated because the Check the configuration.
address configured for this pointer does not exist.
Type
1 Warning alarms
2 Error alarms
3 Controller acknowledgment
4 HMI device acknowledgment
5 LED mapping
6 Trend request
7 Trend transfer 1
8 Trend transfer 2
No.:
consecutive number shown in WinCC flexible ES.
190101 The area pointer is not updated because it is not -
possible to map the PLC type to the area pointer
type.
Parameter type and no.:
see alarm 190100

Appendix
A.2 System alarms

190102 The area pointer is updated after the cause of the -
last error state has been eliminated (return to
normal operation). Parameter type and no.: See
alarm 190100.
200000 Coordination is not executed because the address Change the address or set up the address in the
configured in the controller does not exist/is not set. controller.
200001 Coordination is canceled because the write access Change the address or set the address in the controller at
to the address configured in the PLC is not an area which allows write access.
possible.
200002 Coordination is not carried out at the moment Internal fault
because the address format of the area pointer
does not match the internal storage format.
200003 Coordination can be executed again because the -
last error state is eliminated (return to normal
operation).
200004 The coordination may not be executed. -
200005 No more data is read or written. Possible causes: Ensure that the cable is plugged in and the controller is
• The cable is defective. operational.
200100 Coordination is not executed because the address Change the address or set up the address in the
configured in the controller does not exist/is not set. controller.
200101 Coordination is canceled because the write access Change the address or set the address in the controller at
to the address configured in the PLC is not an area which allows write access.
possible.
200102 Coordination is not carried out at the moment Internal fault
because the address format of the area pointer
does not match the internal storage format.
200103 Coordination can be executed again because the -
last error state is eliminated (return to normal
operation).
200104 The coordination may not be executed. -
200105 No more data is read or written. Possible causes: Ensure that the cable is plugged in and the controller is
• The cable is defective. operational.
210000 Jobs are not processed because the address Change the address or set up the address in the
configured in the controller does not exist/has not controller.
been set up.
210001 Jobs are not processed because read/write access Change the address or set up the address in the
to the address configured in the controller is not controller in an area which allows read/write access.
possible.
210002 Jobs are not executed because the address format Internal fault
of the area pointer does not match the internal
storage format.
210003 The job buffer is processed again because the last -
error status has been eliminated (return to normal
operation).

Appendix
A.2 System alarms

210004 It is possible that the job buffer will not be -
processed.
210005 A control request with an illegal number was Check the controller program.
initiated.
210006 An error occurred while attempting to execute the Check the parameters of the control request. Recompile
control request. As a result, the control request is the configuration.
not executed. Observe the next/previous system
alarms.
220001 The tag is not downloaded because the associated Change the configuration.
communication driver / HMI device does not
support the download of Boolean/discrete data
types.
220002 The tag is not downloaded because the associated Change the configuration.
communication driver / HMI device does not
support write access to the data type BYTE.
220003 The communication driver cannot be loaded. The Install the driver by reinstalling WinCC flexible Runtime.
driver may not be installed.
220004 Communication is down and no update data is Check the connection.
transferred because the cable is not connected or
defective etc.
220005 Communication is up. -
220006 The connection between the specified PLC and the -
specified port is active.
220007 The connection to the specified controller is Check if
interrupted at the specified port. • the cable is plugged in
• the controller is OK
• the correct port is used
• the configuration is OK (interface parameters, protocol
settings, PLC address).
220008 The communication driver cannot access or open Close all the applications which access this port and
the specified port. The port may be in use by restart the computer.
another application or the port used is not available Use another port of the system.
on the destination device.
There is no communication with the controller.
230000 The value entered could not be accepted. The Enter a permissible value.
entered value is discarded and the previous value
is restored.
Either the value range has been exceeded or
impermissible characters were entered.
230002 The currently logged on user is not granted write Log on as a user with appropriate rights.
access rights. The system therefore discards the
input and restored the previous value.
230003 Changeover to the specified screen failed because Configure the screen and check the screen selection
the screen is not available/configured. The current function.
screen remains selected.
230005 The value range of the tag has been exceeded in Observe the range of values for the tag when entering a
the IO field. value.
The original value of the tag is retained.

Appendix
A.2 System alarms

230100 During navigation in the web browser, the system Navigate to another page.
returned a message which may be of interest to the
user.
The web browser continues to run but may not
(fully) show the new page.
230200 The connection to the HTTP channel was Check the network connection.
interrupted due to an error. This error is explained Check the server configuration.
in detail by another system alarm.
Data is no longer exchanged.
230201 The connection to HTTP channel was established. -
Data is exchanged.
230202 WININET.DLL has detected an error. This error Depending on the cause:
usually occurs when an attempt to connect to the When an attempt to connect fails or a timeout error
server fails or the server refuses to connect occurs:
because the client lacks the proper authorization.
• Check the network connection and the network.
An unknown server certificate may also be the
cause if the connection is encrypted by means of • Check the server address.
SSL. • Check if the web server is actually running on the
The alarm text provides details. destination computer.
This text is always in the language of the Windows Faulty authorization:
installation because it is returned by the Windows • The configured user name and/or password do not
OS. match those on the server. Establish consistency.
Process values are no longer exchanged.
When the server certificate is rejected:
Certificate signed by an unknown CA ( ):
• Either ignore this item in your project, or
• Install a certificate that has been signed with a root
certificate known to the client computer.
The date of the certificate is invalid:
• Install a certificate with a valid date on the server.
Invalid CN (Common Name or Computer Name):
• Install a certificate with a name that corresponds to
that of the server address.
230203 Although a connection can be made to the server, Error 503 Service unavailable: Check if
the HTTP server refuses to connect because WinCC flexible Runtime is running on the server
• WinCC flexible Runtime is not running on the the HTTP channel is supported.
server, or
• the HTTP channel is not supported
(503 Service unavailable).
Other errors can only occur if the web server does
not support the HTTP channel. The language of the
alarm text depends on the web server.
Data is not exchanged.
230301 An internal error has occurred. An English text -
explains the error in more detail. This may be
caused by insufficient memory.
OCX does not work.
230302 The name of the remote server cannot be resolved. Check the configured server address.
The attempt to connect failed. Check if the DNS service is available on the network.

Appendix
A.2 System alarms

230303 The remote server is not running on the addressed Check the configured server address.
computer. Check if the remote server is running on the target
Wrong server address. computer.
The attempt to connect failed
230304 The remote server on the addressed computer is Use a compatible remote server.
incompatible to VNCOCX.
The attempt to connect failed.
230305 The authentication has failed because the Configure the correct password.
password is incorrect.
230306 Error in the connection to the remote server. This Check if
may occur as a result of network problems. • the bus cable is plugged in
• there are network problems
230307 The connection to the remote server was shut -
down because
• the remote server was shut down, or
• the user instructed the server to close all
connections.
The connection is closed.
230308 This alarm provides information on the connection -
status.
An attempt is made to connect.
240000 WinCC flexible Runtime is operating in demo mode. Install the authorization.
You have no authorization or your authorization is
corrupted.
240001 WinCC flexible Runtime is operating in demo mode. Load an adequate authorization / powerpack.
Too many tags are configured for the installed
version.
240002 WinCC flexible Runtime is operating with a time- Restore the full authorization.
limited emergency authorization.
240003 Authorization failed. Restart WinCC flexible Runtime or reinstall it.
Without authorization, WinCC will run in demo
mode.
240004 Error while reading the emergency authorization. Restart WinCC flexible Runtime, install the authorization
WinCC flexible Runtime is operating in demo mode. or repair the authorization (see Commissioning
Instructions Software Protection).
250000 The tag in the specified line in "Status force" is not Check the set address and then verify that the address is
updated because the address configured for this set up in the controller.
tag is not available.
250001 The tag in the specified line in "Status force" is not Check the set address.
updated because the controller type configured for
this tag does not exist.
250002 The tag in the specified line in "Status force" is not Check the set address.
updated because it is not possible to map the
controller type in the tag type.
250003 An attempt to connect to the PLC failed. The tags Check the connection to the PLC. Check that the
are not updated. controller is switched on and is online.
260000 An unknown user or an unknown password has Log on to the system as a user with a valid password.
been entered in the system.
The current user is logged off from the system.

Appendix
A.2 System alarms

260001 The logged on user does not have sufficient Log on to the system as a user with sufficient
authorization to execute the protected functions on authorization.
the system.
260002 This alarm is triggered by the system function -
"TrackUserChange".
260003 The user has logged off from the system. -
260004 The user name entered into the user view already Select another user name because user names have to
exists in the user administration. be unique in the user administration.
260005 The entry is discarded. Use a shorter user name.
260006 The entry is discarded. Use a shorter or longer password.
260007 The logon timeout value entered is outside the valid Enter a logon timeout value between 0 and 60 minutes.
range of 0 to 60 minutes.
The new value is discarded and the original value is
retained.
260008 An attempt was made to read a PTProRun.pwl file -
created with ProTool V 6.0 in WinCC flexible.
Reading the file was canceled due to incompatibility
of the format.
270000 A tag is not indicated in the alarm because it Check if the data area for the tag exists in the controller,
attempts to access an invalid address in the the configured address is correct and the value range for
controller. the tag is correct.
270001 There is a device-specific limit as to how many -
alarms may be queued for output (see the
operating instructions). This limit has been
exceeded.
The view no longer contains all the alarms.
However, all alarms are written to the alarm buffer.
270002 The view shows alarms of a log for which there is Delete older log data if necessary.
no data in the current project.
Wildcards are output for the alarms.
270003 The service cannot be set up because too many Reduce the number of HMI devices which want to use the
devices want to use this service. service.
A maximum of four devices may execute this
action.
280001 No more data is read or written. Possible causes: Check if
• The cable is defective. • the cable is plugged in
• The PLC does not respond, is defective, etc. • the controller is OK
• The wrong port is used for the connection. • the correct port is used
• System overload. Restart the system if the system alarm persists.
280002 The connection used requires a function block in -
the controller.
The function block has responded. Communication
is now enabled.

Appendix
A.2 System alarms

280003 The connection used requires a function block in Check if
the controller. • the cable is plugged in
The function block has not responded.
• the controller is OK
• the correct port is used
Remedy depends on the error code:
1: The function block must set the COM bit in the
response container.
2: The function block must not set the ERROR bit in the
response container.
3: The function block must respond within the specified
time (timeout).
4: Go online to the PLC.
280004 The connection to the controller is interrupted. Check the connection parameters in WinCC flexible.
There is no data exchange at present. Ensure that the cable is plugged in, the controller is
operational, the correct interface is being used.
290000 The recipe tag could not be read or written. It is Check in the configuration that the address has been set
assigned the start value. up in the controller.
The alarm can be entered in the alarm buffer for up
to four more failed tags if necessary. After that,
alarm 290003 is output.
290001 An attempt has been made to assign a value to a Observe the value range for the tag type.
recipe tag which is outside the value range
permitted for this type.
to four more failed tags if necessary. After that,
alarm 290004 is output.
290002 It is not possible to convert a value from a source Check the value range or type of the tag.
format to a target format.
to four more failed recipe tags if necessary. After
that, alarm 290005 is output.
290003 This alarm is output when alarm number 290000 is Check in the configuration that the tag addresses have
triggered more than five times. been set up in the controller.
In this case, no further separate alarms are
generated.
290004 This alarm is output when alarm number 290001 is Observe the value range for the tag type.
triggered more than five times.
generated.
290005 This alarm is output when alarm number 290002 is Check the value range or type of the tag.
triggered more than five times.
generated.
290006 The threshold values configured for the tag have Observe the configured or current threshold values of the
been violated by values entered. tag.

Appendix
A.2 System alarms

290007 There is a difference between the source and target Insert the specified data recipe tag in the source
structure of the recipe currently being processed. structure.
The target structure contains an additional data
recipe tag which is not available in the source
structure.
The data recipe tag specified is assigned its start
value.
290008 There is a difference between the source and target Remove the specified data recipe tag in the specified
structure of the recipe currently being processed. recipe from the project.
The source structure contains an additional data
recipe tag which is not available in the target
structure and therefore cannot be assigned.
The value is rejected.
290010 The storage location configured for the recipe is not Check the configured storage location.
permitted.
Possible causes:
Illegal characters, write protection, data carrier out
of space or does not exist.
290011 The data record with the specified number does not Check the source for the number (constant or tag value).
exist.
290012 The recipe with the specified number does not Check the source for the number (constant or tag value).
exist.
290013 An attempt was made to save a data record under The following remedies are available:
a data record number which already exists. • Check the source for the number (constant or tag
The action is not executed. value).
• First, delete the data record.
• Change the "Overwrite" function parameter.
290014 The file specified to be imported could not be Check:
found. • The file name
• Ensure that the file is in the specified directory.
290020 Message reporting that the download of data -
records from the HMI device to the PLC has
started.
records from the HMI device to the PLC was
completed.
290022 Message reporting that the download of data Check in the configuration whether:
records from the HMI device to the PLC was • The tag addresses are configured in the controller
canceled due to an error.
• The recipe number exists
• The data record number exist
• The "Overwrite" function parameter is set
records from the PLC to the HMI device has
started.
records from the PLC to the HMI device was
completed.

Appendix
A.2 System alarms

290025 Message reporting that the download of data Check in the configuration whether:
records from the PLC to the HMI device was • The tag addresses are configured in the controller
canceled due to an error.
• The recipe number exists
• The data record number exist
• The "Overwrite" function parameter is set
290026 An attempt has been made to read/write a data Set the data record status to zero.
record although the data record is not free at
present.
This error may occur in the case of recipes for
which downloading with synchronization has been
configured.
290027 Unable to connect to the controller at present. As a Check the connection to the PLC.
result, the data record can neither be read nor
written.
Possible causes:
No physical connection to the controller (no cable
plugged in, cable is defect) or the controller is
switched off.
290030 This alarm is output after you selected screen Reload the data record from the storage location or retain
which contains a recipe view in which a data record the current values.
is already selected.
290031 While saving, it was detected that a data record Overwrite the data record or cancel the action.
with the specified number already exists.
290032 While exporting data records it was detected that a Overwrite the file or cancel the process.
file with the specified name already exists.
290033 Confirmation request before deleting data records. -
290040 A data record error with error code %1 that cannot Check the storage location, the data record, the "Data
be described in more detail occurred. record" area pointer and if necessary, the connection to
The action is canceled. the controller.
It is possible that the data record was not installed Restart the action after a short time.
correctly on the controller. If the error persists, contact Customer Support. Forward
the relevant error code to Customer Support.
290041 A data record or file cannot be saved because the Delete files no longer required.
storage location is full.
290042 An attempt was made to execute several recipe Trigger the action again after waiting a short period.
actions simultaneously. The last action was not
executed.
290043 Confirmation request before storing data records. -
290044 The data store for the recipe has been destroyed -
and is deleted.
290050 Message reporting that the export of data records -
has started.
290051 Message reporting that the export of data records -
was completed.
290052 Message reporting that the export of data records Ensure that the structure of the data records at the
was canceled due to an error. storage location and the current recipe structure on the
HMI device are identical.
290053 Message reporting that the import of data records -
has started.

Appendix
A.2 System alarms

290054 Message reporting that the import of data records -
was completed.
290055 Message reporting that the import of data records Ensure that the structure of the data records at the
was canceled due to an error. storage location and the current recipe structure on the
HMI device are identical.
290056 Error when reading/writing the value in the Check the specified line/column.
specified line/column.
The action was canceled.
290057 The tags of the recipe specified were toggled from -
"offline" to "online" mode.
Each change of a tag in this recipe is now
immediately downloaded to the controller.
290058 The tags of the specified recipe were toggled from -
"offline" to "online" mode.
Modifications to tags in this recipe are no longer
immediately transferred to the controller but must
be transferred there explicitly by downloading a
data record.
290059 Message reporting that the specified data record -
was saved.
290060 Message reporting that the specified data record -
memory was cleared.
290061 Message reporting that clearing of data record -
memory was canceled due to an error.
290062 The data record number is above the maximum of Select another number.
65536.
This data record cannot be created.
290063 This occurs with the system function Check the "ExportDataRecords" system function.
"ExportDataRecords" when the parameter
"Overwrite" is set to No.
An attempt has been made to save a recipe under
a file name which already exists.
The export is canceled.
290068 Request to confirm if all data records in the recipe -
should be deleted.
290069 Request to confirm if all data records of all recipes -
should really be deleted.
290070 The data record specified is not in the import file. Check the source of the data record number or data
record name (constant or tag value).
290071 During the editing of data record values, a value Enter a value within the limits of the recipe tag.
was entered which exceeded the low limit of the
recipe tag.
The entry is discarded.
290072 When editing data record values, a value was Enter a value within the limits of the recipe tag.
entered which exceeds the high limit of the recipe
tag.
The entry is discarded.

Appendix
A.2 System alarms

290073 An action (e.g. saving a data record) failed due to -
an unknown error.
The error corresponds to the status alarm
IDS_OUT_CMD_EXE_ERR in the large recipe
view.
290074 While saving, it was detected that a data record Overwrite the data record, change the data record
with the specified number already exists but under number or cancel the action.
another name.
290075 A data record with this name already exists. Please select a different data record name.
The data record is not saved.
300000 Faulty configuration of process monitoring (e.g. Change the controller configuration.
using PDiag or S7-Graph): More alarms are
queued than specified in the specifications of the
CPU. No further ALARM_S alarms can be
managed by the PLC and reported to the HMI
devices.
300001 ALARM_S is not registered on this controller. Select a controller that supports the ALARM_S service.
310000 An attempt is being made to print too many reports Wait until the previous active log was printed.
in parallel. Repeat the print job if necessary.
Only one log file can be output to the printer at a
given time; the print job is therefore rejected.
310001 An error occurred on triggering the printer. The Evaluate the additional system alarms related to this
report is either not printed or printed with errors. alarm.
Repeat the print job if necessary.
320000 The movements have already been indicated by Deselect the movements on the other display units and
another device. select the motion control screen on the required display
The movements can no longer be controlled. unit.
320001 The network is too complex. View the network in STL.
The faulty addresses cannot be indicated.
320002 No diagnostics alarm selected. Select a diagnostics alarm from the ZP_ALARM alarm
The unit belonging to the alarm could not be screen.
selected.
320003 No alarms exists for the selected unit. The detail Select the defective unit from the overview screen.
view cannot visualize any networks.
320004 The required signal states could not be read by the Check the consistency between the configuration on the
PLC. The faulty addresses cannot be found. display unit and the PLC program.
320005 The project contains ProAgent elements which are In order to run the project, install the optional ProAgent
not installed. ProAgent diagnostic functions cannot package.
be performed.
320006 You have attempted to execute a function which is Check the type of the selected unit.
not supported in the current constellation.
320007 No error-triggering addresses were found on the Switch the detail screen to STL layout mode and check
networks. the status of the addresses and exclusion addresses.
ProAgent cannot indicate any faulty addresses.
320008 The diagnostic data stored in the configuration are Download the project to the HMI device again.
not synchronized with those in the PLC.
ProAgent can only indicate the diagnostic units.

Appendix
A.2 System alarms

not synchronized with those in the PLC. The
diagnostic screens can be operated as usual.
ProAgent may be unable to show all diagnostic
texts.
not synchronized with those in STEP7.
The ProAgent diagnostics data is not up-to-date.
320011 A unit with the corresponding DB number and FB Check the parameters of the "SelectUnit" function and the
number does not exist. units selected in the project.
The function cannot be executed.
320012 The "Step sequence mode" dialog is no longer Use the ZP_STEP step sequence screen from the
supported. corresponding standard project for your project. Instead
of calling the Overview_Step_Sequence_Mode function,
call the "FixedScreenSelection" function using ZP_STEP
as the screen name.
320014 The selected controller cannot be evaluated for Check the parameters of the "EvaluateAlarmDisplayFault"
ProAgent. system function.
The alarm view assigned to the
"EvaluateAlarmDisplayFault" system function could
not be found.
330022 Too many dialogs open on the HMI device. Close all dialogs you do not require on the HMI device.

Abbreviations B
CPU Central Processing Unit
CSV Comma Separated Values
CTS Clear To Send
DC Direct Current
DCD Data Carrier Detect
DIL Dual-in-Line (electronic chip housing design)
DP Distributed I/O
DSN Data Source Name
DSR Data Set Ready
DTR Data Terminal Ready
EMC Electromagnetic Compatibility
EN European standard
ES Engineering System
ESD Electrostatic Discharge, the components and modules endangered by
such
ESD Electrostatic Sensitive Device
GND Ground
HF High Frequency
HMI Human Machine Interface
IEC International Electronic Commission
IF Interface
LED Light Emitting Diode
MMC Multi-Media Card
MOS Metal Oxide Semiconductor
MPI Multipoint Interface (SIMATIC S7)
MS Microsoft
MTBF Mean Time Between Failures
n. c. Not connected
OP Operator Panel
PC Personal Computer
PG Programming device
PLC Programmable Logic Controller
PPI Point to Point Interface (SIMATIC S7)
RAM Random Access Memory
RTS Request To Send

Abbreviations
RxD Receive Data

SELV Safety Extra Low Voltage
SP Service pack
STN Super Twisted Nematic
Sub-D Subminiature D (plug)
TAB Tabulator
TCP/IP Transmission Control Protocol/Internet Protocol
TFT Thin Film Transistor
TxD Transmit Data
UL Underwriter’s Laboratory

Glossary
Acknowledge
Acknowledging an alarm confirms that you have noted it.
AG
Controller of the SIMATIC S5 series such as the AG S5-115U, for example
Alarm logging
Output of user-specific alarms to a printer, in parallel to their output to the HMI device
screen.
Alarm, acknowledging
Acknowledgement of an alarm confirms that it has been noted.
Alarm, activated
Moment at which an alarm is triggered by the controller or HMI device.
Alarm, deactivated
Moment at which the initiation of an alarm is reset by the controller.
Alarm, user-specific
A user-specific alarm can be assigned to one of the following alarm classes:
● Error
● Warning
● User-specific alarm classes
A user-specific alarm designates a certain operating status of the plant connected to the HMI
device via the controller.
AS
Controller of the SIMATIC S7 series such as a SIMATIC S7-300

Glossary
AS 511
Protocol of the programming device interface of a SIMATIC S5 controller
Boot loader
Used to start the operating system. Automatically started when the HMI device is switched
on. A start screen appears during startup. After the operating system has been loaded, the
Loader opens.
Configuration computer
General term for programming devices (PGs) and PCs on which plant projects are created
using an engineering software.
Control request
Triggers a function via the controller.
Controller
General term for devices and systems with which the HMI device communicates, e.g.
SIMATIC S7.
Display duration
Defines whether and how long a system alarm is displayed on the HMI device.
EMC
Electromagnetic compatibility is the ability of electrical equipment to function properly in its
electromagnetic environment without influencing this environment.
Engineering software
Software for the creation of projects for process visualization – see also project, process
visualization and runtime software
Event
Functions are triggered by defined incoming events. Events can be configured. Events which
can be assigned to a button include "Press" and "Release", for example.
Fault time
Refers to the time interval between an activated and deactivated alarm.

Glossary
Field
Area reserved in configured screens for the input and output of values.
Flash memory
Non-volatile memory with EEPROM chips, used as mobile storage medium or as memory
module installed permanently on the motherboard.
Half brightness lifetime

Time period until the brightness degrades to 50% of its original value. The specified value is
dependent on the operating temperature.
Hardcopy
Output of the screen content to a printer.
HMI device image

File which can be transferred from the programming device to the HMI device. The HMI
device image contains the operating system and elements of the runtime software required
to run a project.
Infotext
Configured information on objects within a project. An alarm infotext, for example, may
contain information on the cause of the fault and troubleshooting routines.
IO field
Enables the input or output of values on the HMI device which are transferred to the
controller.
Notation
System consisting of characters, symbols and rules. In particular used to define the write
format of a programming language in data processing.
Object
Component of a project. Example: screen or alarm. Objects are used to view or enter texts
and values on the HMI device.
Operator control object

Component of a project which is used to enter values and trigger functions. A button, for
example, is an operator control object.

Glossary
Process visualization
Visualization of processes from the areas of production, logistics and services in text-based
and graphics format. Configured plant screens allow operator intervention in active plant
processes by means of the input and output data.
Project
Result of a configuration using an engineering software. The project normally contains
several screens with embedded system-specific objects, basic settings and alarms. The
project file of a project configured in WinCC flexible is saved under the file name extension
*.hmi.
You distinguish between the project on the configuration computer and that on an HMI
device. A project may be available in more languages on the configuration computer than
can be managed on the HMI device. The project on the configuration computer can also be
set up for different HMI devices. Only the project set up for a particular HMI device can be
transferred to that HMI device.
Project file
File which is generated based on a source file for a specific HMI device when the
configuration is completed. The project file is transferred to the corresponding HMI device
and is used to operate and monitor plants. Refer to Source file.
Recipe
Combination of tags forming a fixed data structure. The data structure configured can be
assigned data on the HMI device and is then referred to as a data record. The use of recipes
ensures that when a data record is downloaded, all the assigned data is transferred
synchronously to the controller.
Runtime software
Process visualization software which can be used to debug a project on a configuration
computer. Also refer to "Project" and "Engineering software".
Screen
Form of the visualization of all logically related process data for a plant. The visualization of
the process data can be supported by graphic objects.
Screen object
Configured object for operating and monitoring the system, e.g. a rectangle, an IO field or a
recipe view.
Softkey
Key on the HMI device which supports user-specific functions. A function is assigned to the
key in the configuration. The assignment of the keys may be specific to an active screen or
not.

Glossary
Source file
File from which various project files can be created, depending on the configuration. The
source file is not transferred and remains on the configuration computer.
The file name extension of a source file is *.hmi. Refer to Source file, compressed and
Project file.
Source file, compressed

Compressed form of the source file. Can be transferred in addition to the project file to the
corresponding HMI device. "Enable Upload" must be set in the project on the configuration
computer. The file extension of a compressed source file is *.pdz. The standard memory
location for a compressed source file is the external MMC. Refer to Source file.
To restore a source file, it is necessary to use the same WinCC flexible version which was
used to configure the project.
STEP 7
Programming software SIMATIC S7, SIMATIC C7 and SIMATIC WinAC controllers.
STEP 7 Micro/WIN
Programming software for controllers of the SIMATIC S7-200 series.
Symbolic IO field
Box for the input/output of a parameter. Contains a list of default entries from which one can
be selected.
System alarms
Assigned to the "System" alarm class. A system alarm refers to internal states on the HMI
device and the controller.
Tab order
In the configuration, this sets the sequence in which objects are focused on pressing the
<TAB> key.
Tag
Defined memory location to which values can be written to and read from. This can be done
from the controller or the HMI device. Based on whether the tag is interconnected with the
controller or not, we distinguish between "external" tags (process tags) and "internal" tags.
Transfer
The transfer of an executable project to the HMI device.

Glossary
"Transfer" mode
HMI device operating mode, set to transfer an executable project from the configuration
computer to the HMI device.

Index
Bootloader, 49, 62
Bottom view OP 73, 14
A Bottom view OP 77A, 15
Bottom view OP 77B, 16
Accessories
Accessory kit, 17
Memory card, 17
C
Accessory kit, 17
Acknowledging Call sequence
Alarm, 167, 171 Characters, 130, 150
Alarm, 18 Calling
Acknowledging, 167, 171 HMI device information, 76, 87
Editing, 168, 171 Regional settings, 90
Infotext for, 166, 170 Version information, 77, 87
Viewing, 165, 169 Channel 1:
Alarm buffer, 164 Serial, 81, 93
Alarm class, 164, 168 Channel 2:
Layout, 166, 170 MPI/DP, 81, 95
Alarm indicator, 167, 168 USB, 98
Alarm log, 164 Character input
Alarm text Using control keys, 129, 133, 148, 151
Long, 166, 170 Characters
Alarm text window, 166, 170 Call sequence, 130, 150
Alarm view, 165, 169 Delete, 131
Alarm window, 165, 169 Deleting, 151
Alphanumerical characters Inserting, 131, 151
Editing, 130, 149 Cleaning agents, 189
Entering, 130, 148 Clearance, 36
Alphanumerical value, 128, 147 Climatic
Alphanumerical values Storage conditions, 31
Entering, 130 Transport conditions, 31
Approvals, 24, 28 Conductor cross-section, 47, 60
Authorization, 135, 154 Configuring
Automatic transfer, 108 Interfaces, 57
Operating system, 73, 84
Connecting
B Configuration computer, 46, 58
Connection sequence, 42, 52
Backing up, 113, 114, 116
Controller, 46, 56
Using ProSave, 116
Equipotential bonding, 44, 54
Using WinCC flexible, 114
HMI device, 42, 52
Backup, 92, 106, 118
Peripherals, 59
From MMC, 119
Connecting peripherals
Schematic, 104
Wiring diagram, 59
to memory card, 92
Connecting the configuration computer
to MMC, 118
Wiring diagram, 46, 58

Index
Connecting the terminal block, 48, 61 Alphanumerical characters, 130, 148

Connection sequence, 42, 52 Alphanumerical value, 128, 147
Connections Alphanumerical values, 130
Number, 20, 21 Date and time, 128, 133, 147
Contrast, 76, 86 Numerical characters, 130, 148
Setting, 76, 86 Numerical value, 128, 146
Control keys, 144 Numerical values, 130
For symbolic input, 129, 133, 148, 151 Symbolic value, 128, 147
Controller Equipotential bonding
Configuring the interface, 57 Connecting, 44, 54
Connecting, 46, 56 Installing, 45, 55
Protocols of SIMATIC controllers, 20 Requirements, 44, 54
Creating Wiring diagram, 45, 55
Recipe data record, 182 Equipotential bonding cable, 44, 54
Explosion protection
Labels, 26
D Exporting
Recipe, 187
Data channel
Recipe record, 187
Configuring, 80, 92
Data flow, 177
Data record
F
Exporting, 187
Importing, 187 Factory settings
Date and time, 128, 147 Resetting to, 113, 121
Entering, 133, 152 Field
Decimal places, 128, 147 Activate, 126
Delay time Navigating in the, 129, 147
Setting, 78, 89 Front view OP 73, 14
Delete Front view OP 77A, 15
Recipe data record, 184 Front view OP 77B, 16
Deleting Function test, 50, 63
Password, 80, 91
Users, 141, 161
Device Info, 76, 87 H
Dialog entries
Help in a project, 152
Editing, 74, 84
Help indicator, 134
DIL switch
High frequency radiation, 23
Setting, 57
HMI device
Display, 193, 194, 195
Bottom view, 15, 16
Display format, 128, 146
Connecting, 42, 52
Draft Mode, 101
EMC-compliant installation, 29
Front view, 15, 16
Initial startup, 104
E
Interfaces, 53
EC declaration of conformity, 24 Mounting position, 35
Editing Recommissioning, 104
Recipe data record, 183 Side view, 15, 16
Electrostatic charge, 202 Switching off, 50, 63
Element list, 178, 181 Switching on, 49, 62
Enclosure, 193, 194, 195 Testing, 49, 62
Ensclosure, 196 Type of fixation, 36
Entering

Index
HMI device information Limit values for user, password and user view, 137,
Calling, 76, 87 155
List, 18
Lists
I Navigating in, 126, 145
Loader, 49, 62
IF 1A, 199
Navigating in the, 73, 84
IF 1B, 197, 198
OP 73, 73
Importing
OP 77A, 84
Recipe, 187
OP 77B, 84
Recipe record, 187
Location of the manufacturer, 28
Info/Settings, 74, 85
Logging off
Infotext, 19
Users, 138, 157
Viewing, 134, 166, 170
Logging on
Input
Users, 137, 156
Alphanumerical, 131, 150
Logoff time, 135, 154
Example, 131, 150
Numerical, 131, 150
Input on the HMI device M
System keys, 144
Maintenance, 189, 190
Using soft keys, 125, 143
Manual transfer, 107
Using system keys, 126, 144
Mechanical
Input unit, 193, 194, 196
Storage conditions, 31
Instructions
Transport conditions, 31
General, 26
Memory, 193, 194, 196
Security, 23, 26
Memory card, 17
Working on the cabinet, 23
Backup to, 92
Interfaces, 43, 53
Restoring from, 92
Configuring, 57
Using, 68
Rated load, 59
Menu
Interference
Info/Settings, 74, 85
Pulse-shaped, 29
Printer Settings, 99
Sinusoidal, 30
Settings, 77
Transfer settings, 93
MMC, 68
K
Mounting
Keyboard operation EMC-compliant, 29
Simple recipe view, 181 Mounting clamp, 36
using, 41, 51
Mounting cut-out
L Clearance, 38
Dimensions, 36
Labeling
Preparing, 36
Approvals, 24
Mounting position, 35
EC declaration of conformity, 24
MPI/DP address, 81, 95
Soft keys, 70, 143
MPI/DP baud rate, 82, 96
Labeling strips, 17, 67, 70
MPI/DP settings, 95
Labels
Explosion protection, 26
Setting, 81, 95
Language
Setting, 127
Setting, 82, 96
LEDs, 65, 66
Limit value test, 128, 146
Setting, 81, 94

Index
N P
Navigating Paper size
In lists, 126, 145 Setting, 100
In the field, 129, 147 Paper Size, 100
in the Loader, 50, 63, 73, 84 Password, 79, 91, 136, 154
Nominal voltage, 40 Assigning, 79, 91
Numerical characters Backup and restore, 136, 155
Editing, 130, 149 Deleting, 80, 91
Entering, 130, 148 Editing, 79, 91
Numerical keypad, 144 Limit values, 137, 155
Numerical value Password entry, 79, 91
Decimal places, 128, 147 Password list, 136, 154
Display format, 128, 146 Password protection, 75, 85
Limit value test, 128, 146 PC-PPI adapter, 17
Numerical values Peripherals
Entering, 130 Rated load, 59
Pin assignment
Power supply, 197
O RS 485, 197
RS-232, 199
Object
RS-422, 198
Additional, 19
USB, 200
Alarms, 18
PLC
Infotext, 19
Reading recipe data record, 185
Recipe, 19
Transferring recipe data record, 186
Screens, 19
Polarity reversal protection, 48, 61
Tags, values, lists, 18
Potential differences, 44, 54
Offices, 6
Potentially explosive atmosphere, 26
Offline, 105
Power failure, 113
Offline test, 110
Power supply, 193, 195, 196
Online, 105
Conductor cross-section, 47, 60
Online test, 111
Connecting, 48, 61
Operating mode
Connecting the terminal block, 48, 61
Changing, 105
Polarity reversal protection, 48, 61
Offline, 105
Wiring diagram, 47, 60
Online, 105
Print orientation
Overview, 105
Setting, 101
Transfer, 105
Print quality
Operating system
Setting, 101
Configuring, 73, 84
Printer language
Updating, 106, 121
Setting, 100
Operation with key combinations, 125
Printer Language, 100
Operator control components, 65, 66, 67
Printer Settings, 99
Labeling strips, 67
Project
Operator controls
Closing, 142, 162
Simple recipe view, 179
Help, 152
Orientation, 101
Testing offline, 110
Overall dimensions
Testing online, 111
OP 73, 191
Transfer, 106
OP 77A, 192
Transferring, 104
OP 77B, 192
Upload, 111
Project ID, 112

Index
Project language Using WinCC flexible, 115

Setting, 145 With reset to factory setting, 113
Protocol Without reset to factory setting, 113
SIMATIC controllers, 20 RS 232 (IF 1A), 199
RS 232-TTY converter, 17
RS 422 (IF 1B), 198
R RS 485 (IF 1B), 197, 198
Radiation
High frequency, 23
S
Rated load
Interface, 59 Safety instructions
Reading out High frequency radiation, 23
Recipe data record, 185 Potentially explosive atmosphere, 26
Recipe, 19, 174 Working on the cabinet, 23
Control, 175 Scope of maintenance, 189
Data flow, 177 Screen, 19
Data record, 175 Screen saver, 78, 89
Exporting, 187 Setting, 78, 89
Field of application, 173 Security, 135, 153
Importing, 187 Security system, 135, 153
Recipe view, 178 Select Channel 2, 94
Recipe data record Selecting
Creating, 182 In the field, 126
Delete, 184 Serial channel
Editing, 183 Setting, 81, 93
Reading from PLC, 185 Service
Transferring to PLC, 186 On the Internet, 6
Recipe list, 178, 180 Service pack, 190
Recipe record Setting
Exporting, 187 Contrast, 76, 86
Importing, 187 Delay time, 78, 89
Recipe view, 178 Paper size, 100
Menu commands, 180 Print orientation, 101
Operator controls, 179 Print quality, 101
Simple, 178 Printer language, 100
Record list, 178, 180 Project language, 145
Region, 90 Screen saver, 78, 89
Regional settings Settings, 77
Calling, 90 Side view OP 73, 14
Registered trademarks, 6 Side view OP 77A, 15
Representatives, 6 Side view OP 77B, 16
Reset to factory setting, 106 SIMATIC controllers
Reset to factory settings, 113 Protocol, 20
Resetting to factory settings, 121 Simple recipe view
Restore, 92, 106 Keyboard operation, 181
to MMC, 118 Menu commands, 180
Restoring, 113, 115, 117, 118 Operator controls, 179
from MMC, 119 Simple Recipe View, 178
In the case of compatibility conflict, 113 Soft keys, 65, 66
Schematic, 104 Global function assignment, 125, 143
To memory card, 92 Labeling, 70, 143
Using ProSave, 117 Local function assignment, 125, 143

Index
Source file Type of fixation, 36

Verifying, 112
Specifications
Display, 193, 194, 195 U
Enclosure, 193, 194, 195 Upkeep, 189
Input unit, 193, 194, 196 Upload, 111, 112
Memory, 193, 194, 196 USB channel
OP 77A overall dimensions, 192 Setting, 94
OP 77B overall dimensions, 192 USB settings, 98
Overall dimensions OP 73, 191 Use
Power supply, 193, 195, 196, 197 Conditions, 33
RS 485, 197 In industry, 26
RS-232, 199 In residential areas, 26
RS-422, 198 In the potentially explosive atmosphere, 26
Startup delay, 78, 89 With additional measures, 33
Storage conditions, 31 User data
Support Backup and restore, 136, 155
On the Internet, 6 User group, 135, 154
Switching off User view, 136, 155
HMI device, 50, 63 Limit values, 155
Switching on Limits, 137
HMI device, 49, 62 Users, 135, 154
Symbolic value, 128, 147 Change password, 140, 159
Entering, 152 Changing group assignments, 140, 159
Symbolic values Changing the logoff time, 140, 159
Entering, 133 Changing the user name, 140, 159
System alarms Changing user data, 140, 159
Meaning, 204 Creating, 138, 158, 160
Parameters, 203 Deleting, 141, 161
System keys, 65, 66, 126, 144 Limit values, 155
Limits, 137
Logging off, 138, 157
T Logging on, 137, 156
Tag, 18
Testing
V
HMI device, 49, 62
Project, 110 Value, 18
Time, 128, 147 Version Info, 77, 87
Training center, 6 Version information
Transfer, 104, 105, 106 Calling, 77, 87
Automatic, 108
Backup, 104
Manual, 107 W
Restoring, 104 Wiring diagram
Transfer mode Connecting peripherals, 59
Unintentional, 83, 97, 99 Connecting the configuration computer, 46, 58
Transfer settings, 80, 83, 93, 98 Connecting the equipotential bonding circuit, 45, 55
Menu, 80 Connecting the PLC, 46, 56
Transferring Connecting the power supply, 47, 60
Project, 104 Working on the cabinet, 23
Recipe data record, 186
Transport conditions, 31


Simatic Hmi Hmi Device Op 73, Op 77a, Op 77b (Wincc Flexible) (Pdfdrive)

Uploaded by

Copyright:

Available Formats

Simatic Hmi Hmi Device Op 73, Op 77a, Op 77b (Wincc Flexible) (Pdfdrive)

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

Simatic Hmi Hmi Device Op 73, Op 77a, Op 77b (Wincc Flexible) (Pdfdrive)

Uploaded by

Copyright:

Available Formats

Preface

SIMATIC HMI HMI device OP 73, OP 77A, OP 77B (WinCC flexible)

Safety instructions and

OP 73, OP 77A, OP 77B 4

Operator control components

Configuring the operating

Preparing and backing up a

Siemens AG Order number: 6AV6691-1DA01-0AB1 Copyright © Siemens AG 2007.

Purpose of the operating instructions

Basic knowledge required

Operating instructions' range of validity

Position in the information landscape

OP 73, OP 77A, OP 77B (WinCC flexible)

● WinCC flexible Compact/Standard/Advanced:

OP 73, OP 77A, OP 77B (WinCC flexible)

Please observe notes labeled as follows:

OP 73, OP 77A, OP 77B (WinCC flexible)

Representatives and offices

Service & support on the Internet

OP 73, OP 77A, OP 77B (WinCC flexible)

OP 73, OP 77A, OP 77B (WinCC flexible)

4.3 Mounting and connecting the OP 77A and OP 77B ................................................................... 51

OP 73, OP 77A, OP 77B (WinCC flexible)

6.2.4.5 Setting the print mode................................................................................................................101

OP 73, OP 77A, OP 77B (WinCC flexible)

8.2.4.4 Creating users........................................................................................................................... 158

OP 73, OP 77A, OP 77B (WinCC flexible)

12.3.6 USB on OP 77B .........................................................................................................................200

OP 73, OP 77A, OP 77B (WinCC flexible)

OP 73, OP 77A, OP 77B (WinCC flexible)

OP 73, OP 77A, OP 77B (WinCC flexible)

1.2 Design of the OP 73micro HMI device

Views of the HMI device

Figure 1-1 Front and side view

Figure 1-2 Bottom view

OP 73, OP 77A, OP 77B (WinCC flexible)

1.3 Design of the OP 77A HMI device

Views of the HMI device

Figure 1-3 Front and side view

Figure 1-4 Bottom view

OP 73, OP 77A, OP 77B (WinCC flexible)

1.4 Design of the OP 77B HMI device

Views of the HMI device

Figure 1-5 Front and side view

Figure 1-6 Bottom view

OP 73, OP 77A, OP 77B (WinCC flexible)

PC-PPI adapter for OP 73 and OP 77A

RS 232-TTY converter for OP 77B

Labeling strips for OP 77A and OP 77B

OP 73, OP 77A, OP 77B (WinCC flexible)

1.7 Range of HMI software functions

Object Specification OP 73 OP 77A OP 77B

Tags, values and lists

Object Specification OP 73 OP 77A OP 77B

OP 73, OP 77A, OP 77B (WinCC flexible)

Object Specification OP 73 OP 77A OP 77B

Object Specification OP 73 OP 77A OP 77B

Object Specification OP 73 OP 77A OP 77B

Object Specification OP 73 OP 77A OP 77B