SqueezeMetaManual v1.6.0
SqueezeMetaManual v1.6.0
metagenomics pipeline,
from reads to bins
Version 1.6.0, September 2022
Index
1. WHAT IS SQUEEZEMETA? 3
2. INSTALLATION 5
8. TESTING SQUEEZEMETA 13
17. A BOUT 18
SqueezeMeta v1.6
UTILITIES: INTEGRATION WITH IPATH 47
1. What is SqueezeMeta?
4. The results are stored in a database, where they can be easily exported and
shared, and can be inspected anywhere using a web interface.
5. Internal checks for the assembly and binning steps inform about the consistency
of contigs and bins, allowing to spot potential chimeras.
SqueezeMeta v1.6
6. Metatranscriptomic support via mapping of cDNA reads against reference
metagenomes
● Sequential mode: All samples are treated individually and analysed sequentially.
From v1.0, this mode adds binning capabilities.
● Coassembly mode: Reads from all samples are pooled and a single assembly is
performed. Then reads from individual samples are mapped to the coassembly to
obtain gene abundances in each sample. Binning methods allow to obtain genome
bins.
● Merged mode: if many big samples are available, co-assembly could crash because
of memory requirements. This mode allows the co-assembly of a very large
number of samples, using a procedure inspired by the one used by Benjamin Tully
for analysing TARA Oceans data
(https://dx.doi.org/10.17504/protocols.io.hfqb3mw). Briefly, samples are
assembled individually and the resulting contigs are merged into a single
co-assembly. Then the analysis proceeds as in the co-assembly mode. This is not
the recommended procedure (use co-assembly if possible) since the possibility of
creating chimeric contigs is higher. But it is a viable alternative when standard
co-assembly is not possible.
● Seqmerge mode: This is intended to work with more samples than the merged
mode. Instead of merging all individual assemblies in a single step, which can be
very computationally demanding, seqmerge works sequentially. First, it assembles
individually all samples, as in merged mode. But then it will merge the two most
similar assemblies. Similarity is measured as Amino Acid Identity values using the
wonderful CompareM software by Donovan Parks. After this first merging, it again
evaluates similarity and merge, and proceeds this way until all metagenomes have
been merged in one. Therefore, for n metagenomes, it will need n-1 merging
steps.
SqueezeMeta uses a combination of custom scripts and external software packages for
the different steps of the analysis:
1. Assembly
SqueezeMeta v1.6
6. Taxonomic assignment of genes
2. Installation
This will create a new conda environment named SqueezeMeta, which must then be
activated.
SqueezeMeta v1.6
When using conda, all the scripts from the SqueezeMeta distribution will be available on
$PATH.
Alternatively, just download the latest release from the GitHub repository and
uncompress the tarball in a suitable directory. The tarball includes the SqueezeMeta
scripts as well as the third-party software redistributed with SqueezeMeta (see section
6). The INSTALL files contain detailed installation instructions, including all the external
libraries required to make SqueezeMeta run in a vanilla Ubuntu 16.04 or CentOS7 (DVD
iso) installation.
The test_install.pl script can be run in order to check whether the required
dependencies are available in your environment.
/path/to/SqueezeMeta/utils/install_utils/test_install.pl
SqueezeMeta uses several databases. GenBank nr for taxonomic assignment, and eggnog,
KEGG and Pfam for functional assignment. The script download_databases.pl can be
run to download a pre-formatted version of all the databases required by SqueezeMeta.
/path/to/SqueezeMeta/utils/install_utils/download_databases.pl
/download/path/
Alternatively, the script make_databases.pl can be run to download from source and
format the latest version of the databases.
/path/to/SqueezeMeta/utils/install_utils/make_databases.pl
/download/path/
The databases occupy 200Gb, but we recommend having at least 350Gb free disk space
during the building process.
If the SqueezeMeta databases are already built in another location in the system, a
different copy of SqueezeMeta can be configured to use them with
/path/to/SqueezeMeta/utils/install_utils/configure_nodb.pl
/path/to/db/
After configuring the databases, the test_install.pl can be run in order to check
that SqueezeMeta is ready to work (see previous section). If download_databases.pl
or make_databases.pl can't find our server, you can instead run
SqueezeMeta v1.6
make_databases_alt.pl (same syntax as make_databases.pl) which will try to
download the data from an alternative site.
Scripts location
Execution
Arguments
Mandatory parameters
Restarting
Filtering
SqueezeMeta v1.6
Assembly
Mapping
● -mapping_options [options]: Extra options for the mapper (refer to the manual of
the specific mapper). Please provide all the extra options as a single quoted string (e.g.
-mapping_options “--opt1 foo --opt2 bar”)
Annotation
● --euk: Drop identity filters for eukaryotic annotation. This is recommended for analyses
in which the eukaryotic population is relevant, as it will yield more annotations. See The
LCA algorithm for details.
SqueezeMeta v1.6
● -consensus <value>: Minimum percentage of genes for a taxon needed for contig
consensus (Default: 50)
● -b|-block-size <block size>: block size for DIAMOND against the nr database.
Lower values reduce RAM memory usage. Set it to 3 or below for running in a desktop
computer (default: calculate automatically)
● --D|--doublepass: extra-sensitive ORF prediction. first pass looking for genes using
gene prediction, second pass using BlastX (Off by default)
Binning
Performance
Other settings
● -test <step>: For testing purposes, stops AFTER the given step number
● --empty: Creates an empty directory structure and configuration files. It does not run
the pipeline
SqueezeMeta v1.6
Information
● -h: help
This will create a project "test" for co-assembling the samples specified in the file
"test.samples", skipping Pfam annotation. The -p parameter indicates the name
under which all results and data files will be saved. This is not required for sequential
mode, where the name will be taken from the samples file instead. The -f parameter
indicates the directory where the read files specified in the sample file are stored.
The samples file specifies the samples, the names of their corresponding raw read files
and the sequencing pair represented in those files, separated by tabulators.
An example could be
The first column indicates the sample ID (this will be the project name in sequential
mode), the second contains the file names of the sequences, and the third specifies the
pair number of the reads. A fourth optional column can take the following
comma-separated values:
10
SqueezeMeta v1.6
"noassembly" indicates that these samples must not be assembled with the rest (but
will be mapped against the assembly to get abundances). This is the case for RNAseq
reads that can hamper the assembly but we want them mapped to get transcript
abundance of the genes in the assembly.
"nobinning" value can be included in order to avoid using those samples for binning.
"extassembly" indicates the external assemblies for each of the samples, if they are to
be used. This allows to specify different external assemblies for each sample when
running in sequential mode. For coassembly, merged or seqmerge modes, use the
SqueezeMeta -extassembly option instead (see Section 5).
Notice that a sample can have more than one set of paired reads. The sequence files can
be in either fastq or fasta format, and can be gzipped.
The file parameters.pl stored in the scripts directory sets several parameters used
by SqueezeMeta's scripts. You can change them to adjust the performance of the
pipeline.
Restart
Any interrupted SqueezeMeta run can be restarted invoking the option - -restart
This command will restart the run of that project by reading the progress.txt file to find
out the point where the run stopped.
Alternatively, the user can specify the step in which to restart the analysis, using the
-step option (refer to the scripts section for the list of steps):
By default, this will NOT redo any step that was already done. If you want to override
this behavior and redo previous steps, please add the - -force_overwrite option.
In sequential mode, where there is not a single project name because several individual
projects are created, you need to restart the interrupted project, rewrite the samples
file to eliminate the samples that were already processed, and then rerun SqueezeMeta
with the remaining samples.
Running scripts
Also, any individual script of the pipeline can be run using the same syntax:
11
SqueezeMeta v1.6
script <project name> (for instance, 04.rundiamond.pl <project name> to
repeat the DIAMOND run for the project)
Version 1.0 of SqueezeMeta implements the possibility of using one or several external
databases (user-provided) for functional annotation. This is invoked using the --extdb
option. The argument must be a file (external database file) with the following format
(tab-separated fields):
For example, we can create the file mydb.list containing information of two databases:
Each database must be a fasta file of amino acid sequences, in which the sequences
must have a header in the format:
>ID|...|Function
Where ID can be any identifier for the entry, and Function is the associated function that
will be used for annotation. For example, a KEGG entry could be something like:
>WP_002852319.1|K02835
MKEFILAKNEIKTMLQIMPKEGVVLQGDLASKTSLVQAWVKFLVLGLDRVDSTPTFSTQKYE...
You can put anything you want between the first and last pipe, because these are the
only fields that matter. For instance, the previous entry could also be:
>WP_002852319.1|KEGGDB|27/02/2019|K02835
MKEFILAKNEIKTMLQIMPKEGVVLQGDLASKTSLVQAWVKFLVLGLDRVDSTPTFSTQKYE...
Just remember not to put blank spaces, because they act as field separators in the fasta
format.
12
SqueezeMeta v1.6
This database must be formatted for DIAMOND usage. For avoiding compatibility issues
between different versions of DIAMOND, it is advisable that you use the DIAMOND that is
shipped with SqueezeMeta, and is placed in the bin directory of SqueezeMeta
distribution. You can do the formatting with the command:
/path/to/SqueezeMeta/bin/diamond makedb -d
/path/to/ext/db/dbname.dmnd --in /path/to/my/ext/dbname.fasta
For each database, you can OPTIONALLY provide a file with functional annotations, such
as the name of the enzyme or whatever you want. Its location must be specified in the
last field of the external database file. It must have only two columns separated by
tabulators, the first with the function, the second with the additional information. For
instance:
The ORF table will show both the database ID and the associated annotation for each
external database you provided.
Version 1.0 implements the -D option (doublepass), that attempts to provide a more
sensitive ORF detection by combining the Prodigal prediction with a BlastX search on
parts of the contigs where no ORFs were predicted, or where predicted ORFs did not
match anything in the taxonomic and functional databases. The procedure starts after
the usual taxonomic and functional annotation. It masks the parts of the contigs in
which there is a predicted ORF with some (taxonomic and functional) annotation. The
remaining sequence corresponds to zones with no ORF prediction or orphan genes (no
hits). The first could correspond to missed ORFs, the second to wrongly predicted ORFs.
Then a DIAMOND BlastX is run only on these zones, using the same databases. The
resulting hits are added as newly predicted ORFs, and the pipeline continues taking into
account these new ORFs.
The pros: This procedure is able to detect missing genes or correct errors in gene
prediction (for example, these derived from frameshifts). For prokaryotic metagenomes,
we estimate a gain of 2-3% in the number of ORFs. This method is especially useful when
you suspect that gene prediction can underperform, for instance in cases in which
eukaryotes and viruses are present. Prodigal is a prokaryotic gene predictor and its
behaviour for other kingdoms is uncertain. In these cases, the gain can be higher than
for prokaryotes.
The con: Since it has to do an additional DIAMOND run (and using six frame-Blastx) it
slows down the analysis, especially in the case of big and/or many metagenomes.
13
SqueezeMeta v1.6
8. Testing SqueezeMeta
Since version 0.3.0, SqueezeMeta is able to seamlessly work with single-end reads. In
order to obtain better mappings of MinION and PacBio reads against the assembly, we
advise to use minimap2 for read counting, by including the -map minimap2-ont
(MinION) or -map minimap2-pb (PacBio) flags when calling SqueezeMeta. We also
include the canu assembler, which is specially tailored to work with long, noisy reads. It
can be selected by including the -a canu flag when calling SqueezeMeta. As a shortcut,
the --minion flag will use both canu and minimap2 for Oxford Nanopore MinION reads.
Since version 1.3 we also include flye as an optional assembler for long reads.
14
SqueezeMeta v1.6
11. Tips for working in a computing cluster
SqueezeMeta will work fine inside a computing cluster, but there are some extra things
that must be taken into account. Here is a list in progress based on frequent issues that
have been reported.
Assuming your databases are not inside the SqueezeMeta directory, just remove it,
download the new version and configure it with
/path/to/SqueezeMeta/utils/install_utils/configure_nodb.pl
/path/to/db/
1) Integration with R: We provide the SQMtools R package, which allows to easily load a
whole SqueezeMeta project and expose the results into R. The package includes
functions to select particular taxa or functions and generate plots. The package also
makes the different tables generated by SqueezeMeta easily available for third-party R
packages such as vegan (for multivariate analysis), DESeq2 (for differential abundance
testing) or for custom analysis pipelines. SQMtools can also be used in Mac or
Windows, meaning that you can run SqueezeMeta in your Linux server and then move
15
SqueezeMeta v1.6
the results to your own computer and analyze them there. See advice on how to install
SQMtools in Mac/Windows here.
2) Integration with the anvi'o analysis pipeline: We provide a compatibility layer for
loading SqueezeMeta results into the anvi'o analysis and visualization platform
(http://merenlab.org/software/anvio/). This includes a built-in query language for
selecting the contigs to be visualized in the anvi'o interactive interface.
We also include utility scripts for generating itol and pavian -compatible outputs.
16
SqueezeMeta v1.6
Next, edit the SqueezeMeta_conf.pl in the scripts directory of the SqueezeMeta
installation. You will see a line like this:
%binscripts=('maxbin',"$installpath/lib/SqueezeMeta/bin_maxbin.pl"
,'metabat2',"$installpath/lib/SqueezeMeta/bin_metabat2.pl",'concoc
t',"$installpath/lib/SqueezeMeta/bin_concoct.pl");
This tells SqueezeMeta the available scripts for running binners. Add your new script:
%binscripts=('maxbin',"$installpath/lib/SqueezeMeta/bin_maxbin.pl"
,'metabat2',"$installpath/lib/SqueezeMeta/bin_metabat2.pl",'concoc
t',"$installpath/lib/SqueezeMeta/bin_concoct.pl",’amazingbinner’,"
mylocation/amazingbinner.py");
Where “mylocation” is the directory where you put your script (You may want to move it
to the lib/SqueezeMeta directory in the SqueezeMeta installation, to have all binning
scripts in one place).
Next, give execution permissions to the script (for instance, sudo chmod a+x
mylocation/amazingbinner.py).Notice that the script can be written in any
language (python in this example), as long as it is executable and provides the results in
the expected place.
And you are done! Now, for running SqueezeMeta with your new binner, just mention it
using the -binners option, for instance:
From version 1.6, SqueezeMeta also allows the connection of other assemblers than the
ones shipped with the distro (Megahit, Spades, Canu and Flye). Here I will teach you a
practical example of how to do it, showing the plugging of the IDBA-UD assembler
(https://github.com/loneknightpy/idba) (Peng et al, Bioinformatics 2012,
28:111420–1428; https://doi.org/10.1093/bioinformatics/bts174)
I will assume that you already installed the IDBA-UD software and put it somewhere in
your system, for instance the /software/idba directory (my choice, but you can put it
wherever you want)
What you need to do is to create a script to run the assembler. Your script will be called
by the SqueezeMeta pipeline. I called my script “assembly_idba.pl”, and it looks like
this:
#!/usr/bin/perl
use strict;
print "Running IDBA assembly\n";
`#-- By default, SqueezeMeta will pass the following arguments to your script:`
17
SqueezeMeta v1.6
my $projectdir=$ARGV[0]; # First argument: Directory of the project
my $sample=$ARGV[1]; # Second argument: Name of the sample (in sequential mode) or project (in the
rest)
my $par1name=$ARGV[2]; # Third argument: Name of the pair1 file
my $par2name=$ARGV[3]; # Fourth argument: Name of the pair2 file
my $numthreads=12; #-- In addition, we can define other parameters, for instance number of threads
`#-- IDBA wants data as an interlaced fasta file`
`#-- Fortunately, they provide a fq2fa script converting our fastq files to that format`
`#-- But, our fastq files are gzipped. Therefore first thing is to gunzip them`
`#-- We define $g1 and $g2 as variables containing the name of the gunzipped files`
`#-- Simply remove the ".gz" extension to get the gunzipped name`
Take into account that when SqueezeMeta will call your script, it will pass four
arguments: The project directory, the project name, and the read files (two paired-end,
gunzipped fastq or fasta files). This is probably all you need to know to call the
assembler:
As you see in the script, I just run a formatting script fq2fa provided by IDBA-UD, to put
the runs in the format it wants them. Then I run the assembler, and finally I move the
resulting contig file to the results directory in the SqueezeMeta project. This is very
18
SqueezeMeta v1.6
important because the rest of the pipeline will look for the contig file there. Also, take
into account that the name of the contig file must be 01.project.fasta (where project is
your project name).
To plug this into SqueezeMeta, the first thing to do is to move your script to the place
where all other assembly scripts are, which is the installpath/lib/SqueezeMeta directory
(where installpath is the installation directory of SqueezeMeta. You will see there other
scripts for running assemblers, like assembly_megahit.pl, assembly_spades.pl, etc).
Then, edit the SqueezeMeta_conf.pl file in the scripts directory of the SqueezeMeta
installation. You will see a line like this:
%assemblers = ("megahit","assembly_megahit.pl","spades",
"assembly_spades.pl","canu","assembly_canu.pl","flye", "assembly_flye.pl");
This line is a hash (equivalent to a dict in python), telling SqueezeMeta the names of the
available assemblers and the associated scripts for running them. Just add yours.
Remember that the name you specify will be the one to run the assembler:
%assemblers = ("megahit","assembly_megahit.pl","spades",
"assembly_spades.pl","canu","assembly_canu.pl","flye",
"assembly_flye.pl",”idba”,”assembly_idba.pl”);
Save it, and you are done. Now you can run a SqueezeMeta project using your new
“idba” assembler:
● trimmomatic
● Megahit
● Spades
● canu
● prinseq
● kmer-db
● CD-HIT
● amos
19
SqueezeMeta v1.6
● mummer
● hmmer
● aragorn
● DIAMOND
● bwa
● minimap2
● bowtie2
● barrnap
● MaxBin
● MetaBAT
● CONCOCT
● DAS tool
● checkm
● comparem
● MinPath
● RDP classifier
● pullseq
● Short-Pair
● SAMtools
17. About
20
SqueezeMeta v1.6
Scripts, output files and file format
Files marked in blue are placed in the "results" directory; in green, files in
"intermediate" directory; orange, in "ext_tables" directory:
Step 1: Assembly
Files produced:
● 01.<project>.fasta: Fasta file containing the contigs resulting from the assembly
(Merged mode will also produce a .fasta and a .lon file for each sample)
Script: 02.run_barrnap.pl
Files produced:
● 02.<project>.16S: Assignment (RDP classifier) for the 16S rRNAs sequences found.
21
SqueezeMeta v1.6
● 02.<project>.maskedrna.fasta: Fasta file containing the contigs resulting from the
assembly, masking the positions where a RNA was found.
Script: 03.run_prodigal.pl
Files produced:
● 03.<project>.gff: Features and position in contigs for each of the predicted genes
(moves to intermediate if the -D option is selected)
Step 4: Homology searching against taxonomic (nr) and functional (COG, KEGG)
databases
Script: 04.rundiamond.pl
Files produced:
(the nr is updated regularly. You can check the date nr was downloaded by looking at the
DB_BUILD_DATE file in the database directory. The KEGG database requires licensing,
therefore we use the last publicly available version. For the COG/eggNOG database we
currently use version 4.5)
Script: 05.run_hmmer.pl
Files produced:
22
SqueezeMeta v1.6
Step 6: Taxonomic assignment
Script: 06.lca.pl
Files produced:
Script: 07.fun3assign.pl
Files produced:
Step 8: Blastx on parts of the contigs without gene prediction or without hits
Script: 08.blastx.pl
Files produced:
23
SqueezeMeta v1.6
● 08.<project>.gff: features and position in contigs for each of the prodigal and
Blastx ORFs.
The format of these last three files is the same as above (step 7)
Script: 09.summarycontigs3.pl
Files produced:
For detailed information on the algorithm, please refer to algorithm’s section at the end
of this manual.
Script: 10.mapsamples.pl
Files produced:
24
SqueezeMeta v1.6
● 10.<project>.mapcount: several measures regarding mapping of reads to ORFs
▪ Column 6: coverage value for the ORF (Bases mapped / ORF length)
Script: 11.mcount.pl
Files produced:
● 11.<project>.mcount
25
SqueezeMeta v1.6
▪ Column 2: taxon
▪ Column 3: accumulated contig size: Sum of the length of all contigs for that
taxon
▪ Column 4 (and all even columns from this one): number of reads mapping
to the taxon in the corresponding sample
▪ Column 5 (and all odd columns from this one): number of bases mapping to
the taxon in the corresponding sample
Script: 12.funcover.pl
Files produced:
▪ Column 3 and above: abundance of reads for that COG in the corresponding
sample
▪ Column 1: COG ID
26
SqueezeMeta v1.6
▪ Column 4: sum of the length of all ORFs of this function in the
corresponding sample (Total length)
▪ Column 5: sum of the bases mapped to all ORFs of this function in the
corresponding sample (Total bases)
▪ Column 9: number of the different taxa per rank (k: kingdom, p: phylum; c:
class; o: order; f: family; g: genus; s: species) in which this COG has been
found
Format of the file: Same format than previous one but replacing COGs by KEGGs.
Additionally, the function of the KEGG will be present in column 11, while column
10 will contain the name of the KEGG.
In addition, .funcover and .stamp files will be created for the user-provided databases
specified via the --extdb argument.
Script: 13.mergeannot2.pl
File produced:
● 13.<project>.orftable
27
SqueezeMeta v1.6
▪ Column 8: Gene name
▪ Column 10: KEGG ID for the ORF (If a * sign is shown here, it means that the
functional assignment was done by both best hit and best average scores,
therefore is more reliable. Otherwise, the assignment was done using just
the best hit, but there is evidence of a conflicting annotation)
▪ Column 13: COG ID for the ORF (If a * sign is shown here, it means that the
functional assignment was done by both best hit and best average scores,
therefore is more reliable. Otherwise, the assignment was done using just
the best hit, but there is evidence of a conflicting annotation)
▪ (If there is more than one external databases, all of them will be shown
here)
▪ Column 19 and beyond: TPM, coverage, read count and base count for the
ORF in the different samples
Script: 14.runbinning.pl
Results produced:
28
SqueezeMeta v1.6
Step 15: Merging bins with DAS Tool
Script: 15.dastool.pl
Results produced:
Script: 16.addtax2.pl
Files produced:
● tax files for each fasta in the directory DAS (or the binning directory)
● 16.<project>.bintax:
For detailed information on the algorithm, please refer to algorithm’s section at the end
of this manual.
Script: 17.checkM_batch.pl
File produced:
● 17.<project>.checkM
29
SqueezeMeta v1.6
Step 18: Creation of the bin table
Script: 18.getbins.pl
Files produced:
▪ Column 4: TPM for the bin in the corresponding sample (Sum of reads from
the corresponding sample mapping to contigs in the bin x 10^6 / Sum of
length of contigs in the bin x Total number of reads)
▪ Column 4: taxonomy for the 16S rRNAs if the bin (if any)
▪ Column 12 and beyond: coverage and TPM values for the bin in each
sample.
30
SqueezeMeta v1.6
Step 19: Creation of the contig table
Script: 19.getcontigs.pl
Files produced:
▪ Column 2: taxonomic annotation for the contig (from the annotations of the
ORFs)
Files produced:
▪ Column 4 and beyond: NF indicates that the pathway was not predicted. A
number shows that the pathway was predicted to be present, and
correspond to the number of enzymes of that pathway that were found.
31
SqueezeMeta v1.6
● 20.<project>.metacyc.pathways: prediction of Metacyc pathways in bins
Format of the file: same as for KEGG, but using MetaCyc pathways
Script: 21.stats.pl
File produced:
32
SqueezeMeta v1.6
Utilities: alternative analysis modes (Working with reads)
SQM_reads.pl
This procedure performs taxonomic and functional assignments directly on the reads.
This is useful when the assembly is not good, usually because of low sequencing depth,
high diversity of the microbiome, or both. One indication that this is happening can be
found in the mappingstat file. Should you find there low mapping percentages (below
50%), it means that most of your reads are not represented in the assembly and can we
can try to classify the reads instead of the genes/contigs. It will probably provide an
increment in the number of annotations. But on the other hand, the annotations could
be less precise (we are working with a smaller sequence) and you lose the capacity to
map reads onto an assembly and thus comparing metagenomes using a common
reference. Use this for Illumina reads. This method is less suited to analyze long MinION
reads where more than one gene can be represented (See SQM_longreads.pl in that
case). This script can be found in the /path/to/SqueezeMeta/utils/ directory.
Arguments
Mandatory parameters
Options
● --nodiamond: Assumes that Diamond output files are already in place (for
instance, if you are redoing the analysis) and skips all Diamond runs.
33
SqueezeMeta v1.6
● -b|-block-size: block size for DIAMOND against the nr database. Lower values
reduce RAM memory usage. Set it to 3 or below for running in a desktop computer
(default: 8)
● -e|-evalue: max e-value for discarding hits in the DIAMOND run (default:
1e-03)
● -miniden: identity percentage for discarding hits in DIAMOND run (default: 50)
The method will do a DIAMOND Blastx alignment of reads with nr, COG and KEGG
databases, and will assign taxa as functions using the lca and fun3 methods, as
SqueezeMeta does.
Output
▪ Column 2: taxon
▪ Column 3: accumulated read number (number of reads for that taxon in all
samples)
▪ Column 4 and beyond: number of reads for the taxon in the corresponding
sample
34
SqueezeMeta v1.6
● <project>.out.funcog: abundance of all COG functions
▪ Column 1: COG ID
▪ Column 2: accumulated read number: Number of reads for that COG in all
samples
▪ Column 3 and beyond: number of reads for the COG in the corresponding
sample
▪ Column 1: KEGG ID
▪ Column 2: accumulated read number (number of reads for that KEGG in all
samples)
▪ Column 3 and beyond (number of reads for the KEGG in the corresponding
sample)
SQM_longreads.pl
This script works in the same way as SQM_reads.pl, that is, it attempts to produce
taxonomic and functional assignments directly on the raw reads, not using an assembly.
The difference is that this script assumes that more than one ORF can be found in the
read. It performs Diamond Blastx searches against taxonomic and functional databases,
and then identifies ORFs by collapsing the hits in the same region of the read. The
--range-culling option of Diamond makes this possible, since it limits the number of hits
to the same region of the sequence, making it possible to recover hits for all parts of the
read.
35
SqueezeMeta v1.6
The method assigns taxa as functions to each ORF using the lca and fun3 methods, as
SqueezeMeta does. In addition, it calculates the consensus of the taxonomic assignment
for the read (see Explanation of SqueezeMeta algorithms). The taxon provided for the
read is that consensus annotation.
Arguments
Mandatory parameters
Options
● --nodiamond: Assumes that Diamond output files are already in place (for
instance, if you are redoing the analysis) and skips all Diamond runs.
● -b|-block-size: block size for DIAMOND against the nr database. Lower values
reduce RAM memory usage. Set it to 3 or below for running in a desktop computer
(default: 8)
● -e|-evalue: max e-value for discarding hits in the DIAMOND run (default:
1e-03)
36
SqueezeMeta v1.6
● --force_overwrite:Overwrite previous results
Output
The output is the same than for sqm_reads.pl, please refer to it. In addition,
sqm_longreads.pl provides information about the consensus in the readconsensus.txt
files in each of the samples directory.
A truncated hit (one missing to find one, or both, extremes) often happens in the extremes of
the long read (because the read is ending and so is the hit), but it is unexpected to find it in the
middle of a long read. There you would expect to see a complete hit. Whatever the reasons for
this, the hit is suspicious and can be excluded using the -n option. But beware, this probably will
decrease significantly the number of resulting ORFs.
sqm_hmm_reads.pl
This script does functional assignment of the raw reads, using an ultra-sensitive Hidden
Markov Model (HMM) search implemented in the third-party software Short-Pair
(https://sourceforge.net/projects/short-pair). By using an approximate Bayesian
approach employing distribution of fragment lengths and alignment scores, Short-Pair
can retrieve the missing end and determine true domains for short paired-end reads
(Techa-Angkoon et al., BMC Bioinformatics 18, 414, 2017). This is intended to give an
answer to the question "Is my function of interest present in the metagenome?", avoiding
assembly biases where low-abundance genes may be not assembled and therefore will
not be represented in the metagenome. This is also expected to be more sensitive than
Diamond assignment of reads done by SQM_reads.pl above.
As HMM searches are slower than short-read alignment, it is not practical to do this for
all functions. Instead, the user must specify one or several Pfam ID and the search will
be done just for these. The script will connect to Pfam database
(https://pfam.xfam.org) to download the corresponding hmm and seed files. This script
can be found in the /path/to/SqueezeMeta/utils/ directory.
Usage
37
SqueezeMeta v1.6
Arguments
Mandatory parameters
Options
Output
● First column: read name (.1 for first pair, .2 for second pair)
38
SqueezeMeta v1.6
Utilities: Read Mapping
sqm_mapper.pl
This script maps reads to a given reference using one of the included sequence aligners
(Bowtie2, BWA), and provides estimation of the abundance of the contigs and ORFs in
the reference. In addition to the reads and reference files, it also needs a gff file
specifying the positions of the genes in the contigs. It works in the same way than the
mapping step of the main pipeline, and provides values for the coverage, TPM and RPKM
of genes and contigs.
A file including functional annotations for the genes can also be given. If so, the script
will provide abundance estimations for functions as well.
Usage
Arguments
Mandatory parameters
● -r: Reference sequence, the one reads will be mapped to. This can be a fasta file
containing contigs, or even a single sequence coming from a complete genome
(REQUIRED)
● -s: Samples file (refer to Section 4 in this manual for format specification.
(REQUIRED)
● -f: Directory in which read files (the ones specified in the samples file) are
located (REQUIRED)
● -g: GFF file specifying the genomic features in the reference. This can be
downloaded for genomes, or created using a gene predictor (REQUIRED unless
--filter). See below to know about the proper definition of this file
Options
39
SqueezeMeta v1.6
● -m: Aligner to use (Bowtie, BWA) (Default: Bowtie)
● -fun: File containing functional annotations for the genes in the reference
This is a two-column file. First column indicate the name of the gene, Second
column corresponds to the function (or gene name). For instance:
gene1 COG0735
gene2 recA
Output
● A contigcov file, with the abundance measures for each of the contigs in the
reference
● A mapcount file, with the abundance measures for each ORF in the gff file
corresponding to the reference.
● If a functional file was specified with the -fun option, it will also produce a
mapcount.fun file, with the abundance measures for each of the functions.
The gff file (tab separated), should contain a tag “ID” in its ninth field, with the id being
the contigname and, separated by “_”, the initial and final positions of the gene
(separated by “-”), and a final semicolon. Something like:
“ID=contig1_1-580;”
40
SqueezeMeta v1.6
Utilities: Functional & Taxonomic annotation of genes and genomes
sqm_annot.pl
This script performs functional and taxonomic annotation for a set of genes or genomes.
Genomes must be nucleotide sequences, while gene sequences can be either nucleotides
or amino acids. All sequence files must be in fasta format.
For a genome, the script will call SqueezeMeta to predict RNAs and CDS, and then
proceeds to run Diamond searches against the usual taxonomic (GenBank nr) and
functional (COGs and KEGG) databases and annotate the genes according the same
procedures used in the main SqueezeMeta pipeline (LCA for taxa, best hit/best average
for functions. Please refer to the “Explanation of SqueezeMeta Algorithms'' section for
details). For gene sequences, it is assumed that each sequence corresponds to an
already identified ORF, and then RNA and CDS prediction is skipped.
Diamond searches are automatically set to “blastp” for amino acids, and “blastx” for
nucleotides.
The first field corresponds to the project name. The script will create a project
directory with that name, where all results will be placed. The second field is the name
of the genome, amino acid or nucleotide fasta file containing the sequences. And the
third field specifies the type of data: genome, aa or nt. As explained above, genome will
trigger gene prediction and run Diamond blastp on the predicted peptides, aa will run
Diamond blastp for the provided sequences, and nt will run Diamond blastx for the
provided sequences.
Usage
Arguments
Mandatory parameters
● -f: Directory in which the sequence files specified in the samples file are located
(REQUIRED). The sequence files MUST be in FASTA format.
41
SqueezeMeta v1.6
● -s: Samples file (REQUIRED)
Options
● -b <block size>: block size for DIAMOND against the nr database. Lower
values reduce RAM memory usage. Set it to 3 or below for running in a desktop
computer (default: 8)
Output
This scripts takes advantage of the standard SqueezeMeta machinery, therefore the
output files are these obtained in the steps 6 and 7 of the pipeline:
▪ Column 1: COG/KEGG ID
42
SqueezeMeta v1.6
▪ Column 5: Functional class or pathway
cover.pl
To answer these questions, COVER allows the estimation of the amount of sequencing
needed to achieve a particular objective, being this the coverage attained for the most
abundant N members of the microbiome. For instance, how much sequence is needed to
reach 5x coverage for the four most abundant members (from now on, OTUs). COVER
was first published in 2012 (Tamames et al 2012, Environ Microbiol Rep. 4:335-41), but
we are using a different version of the algorithm described there.
Arguments
Mandatory parameters
Options
(Default values imply looking for 5 x coverage for the 4 th most abundant OTU)
43
SqueezeMeta v1.6
● -h|-help: This help
COVER needs information on the composition of the microbiome, and that must be
provided as a file containing 16S rRNA sequences obtained by amplicon sequencing of
the target microbiome. If you don’t have that, you can look for a similar sample already
sequenced (for instance, in NCBI’s SRA, see below).
The first step is clustering the sequences at the desired identity level (default: 98%) to
produce OTUs. COVER uses cd-hit (Schmieder et al 2011, Bioinformatics 27:863-4) for
doing this. The abundance of each OTU is also obtained in this step (the number of
sequences in each OTU). Then, a taxonomic annotation step must be done for inferring
genomic size and 16S rRNA copy number for each of the OTUs. This annotation can be
done using the RDP classifier (Wang et al 2007, Appl Environ Microbiol 73, 5261-7), or
Mothur (Schloss et al, Appl Environ Microbiol, 2009. 75:7537-41) alignment against the
SILVA database. The latter is the default option. It is slower but provides more accurate
results.
The taxonomic annotation allows to infer the approximate genomic size by comparison
with the size of already sequenced genomes from the same taxon (we’ve got this
information from NCBI’s genome database). In the same way, we inferred the expected
copy number by comparison to the rrnDB database (Stoddard et al 2014, Nucleic Acids
Research doi: 10.1093/nar/gku1201; https://rrndb.umms.med.umich.edu). Obviously,
the most accurate the annotation, the most precise this estimation will be. In case that
the OTU could not be annotated, COVER uses default values of 4 Mb genomic size and 1
for copy number. These values can be greatly inaccurate and affect the results.
Therefore, it is strongly advised that the taxonomic annotation is as good as possible.
In the next step, COVER calculates the probability of sequencing a base for each of the
OTUs. First, the abundance of each OTU is divided by its copy number:
Then, all abundances are summed, and individual abundances are normalized by this
total abundance.
44
SqueezeMeta v1.6
The fraction of the microbiome occupied by each OTU, f, is the product of its abundance
by its genomic size
and the total size of the microbiome is the sum of all individual fractions.
F = Σ n fn
Then, the probability of sequencing one base of a particular OTU is the ratio between its
fraction and the total size:
pn = fn / F
And the amount of sequence needed (S) to attain coverage C for genome n is then:
S = C * Size n / pn
COVER calculates this value of S for the n-th OTU, as specified by the user. Then,
coverages for all other OTUs are also calculated using the last equation and this value of
S:
Cn = S * pn / Size n
In the previous calculation, we have assumed that we can calculate abundances for all
members of the microbiome. Obviously this is not true, because there will be a fraction
of unobserved (rare) OTUs that were not sequenced in our 16S. The size of that fraction
will depend on the completeness of our 16S sequencing, which is influenced by the
diversity of the microbiome and by the sequencing depth. This unobserved fraction can
45
SqueezeMeta v1.6
bias greatly the results. Luckily, there is a way to estimate it by means of the Good’s
estimator of sample coverage (Chao & Shen 2003 Environ Ecol Stat 10: 429–443), that
supposses that the fraction of sequence reads corresponding to unobserved OTUs is
approximately equal to the fraction of observed singletons (OTUs with just one
sequence):
U= f1 / N OTUs
Both f1 and N OTUs are obtained in the OTU clustering step. Then, we just need to correct
the value of S by this value:
S corrected = S / (1-U)
The output is a table that first lists the amount of sequencing needed, both uncorrected
and corrected by the Good’s estimator:
And then lists the information and coverages for each OTU, with the following format:
46
SqueezeMeta v1.6
● Size: Inferred genomic size of the OTU
● Raw abundance: Number of sequences in the OTU
● Copy number: Inferred 16S rRNA copy number
● Corrected abundance: Abundance n / Σn Abundance
● Pi : Probability of sequencing a base of this OTU
● %Genome sequenced: Percentage of the genome that will be sequenced for that
OTU
● Coverage: Coverage that will be obtained for that OTU
● Taxon: Deepest taxonomic annotation for the OTU
We are aware that often you will not have a 16S amplicon sequencing of the
microbiome. In that case, you can use the fabulous collection of 16S sampling stored in
the NCBI’s SRA archive (https://www.ncbi.nlm.nih.gov/sra). You can, for instance,
locate BioProjects involving 16S sequencing
(https://www.ncbi.nlm.nih.gov/bioproject/?term=16S), then restrict to
“environmental”, and look for similar microbiomes. The sequencing estimate that you
will get in this way would be just approximate, but you could find it useful to have an
initial idea on the range of sequencing that you need.
sqm2itol.pl
This script generates the files for creating a radial plot of abundances using iTOL
(https://itol.embl.de/), such as the ones below, taken from the SqueezeMeta paper.
This script can be found in the /path/to/SqueezeMeta/utils/ directory.
47
SqueezeMeta v1.6
Figure 1: Taxonomic plot. Abundance of bins in the diverse samples. Bins were compared with the
CompareM software (https://github.com/dparks1134/CompareM) to estimate their reciprocal
similarities. The distances calculated between the bins were used to create a phylogenetic tree
illustrating their relationships. The tree is shown in the inner part of the Figure. Branches in the tree
corresponding to the four more abundant phyla in the tree (Firmicutes, Bacteriodetes, Proteobacteria
and Spirochaetes) were colored. Bins were named with their ID number and original genera, and labels
for the most abundant genera were also colored. Outer circles correspond to: the completeness of the
bins (green-colored, most internal circle), and the abundance of each bin in each sample (red-colored).
Each circle corresponds to a different sample, and the red color intensities correspond to the bin’s
abundance in the sample.
48
SqueezeMeta v1.6
Figure 2: Functional plot. Presence of several carbohydrate degradation pathways in bins.
The outer circles indicate the percentage of genes from a pathway present in each of the bins. According
to that gene profile, MinPath estimates whether or not the pathway is present. Only pathways inferred to
be present are colored. As in Figure 1, the bins tree is performed from a distance matrix of the
orthologous genes’ amino acid identity, using the compareM software. The four most abundant phyla are
colored (branches in the tree), as well as the most abundant genera (bin labels). The picture was
elaborated using the iTOL software.
Usage:
Arguments
Mandatory parameters
49
SqueezeMeta v1.6
Options
arabinose degradation
galactose degradation
glucose degradation
Output
The program will generate several datafiles that you must upload to iTOL to produce the
figure.
sqm2ipath.pl
This script creates data on the existence of enzymatic reactions that can be plotted in the
interactive pathway mapper iPath (http://pathways.embl.de)
Usage:
Arguments
Mandatory parameters
Options
50
SqueezeMeta v1.6
● -functions [file]: file containing the COG/KEGG identifiers of the functions to
be considered. For example:
K00036
K00038
K00040
K00052 #ff0000
K00053
The plotting colors can be specified by the -color option, or by associating values to
each of the IDs in the functions file. In that case, several colors can be used in the same
plot. If no color is specified, default is red.
The results in the output file must be copied in the iPath interface. Several output files
can be combined, for instance using different colors for different taxa.
51
SqueezeMeta v1.6
Utilities: integration with pavian
sqm2pavian.pl
This script produces output files containing abundance of taxa that can be plotted using
the Pavian tool (https://github.com/fbreitwieser/pavian).It translates the results in the
SqueezeMeta mapcount file to the kraken report format wanted by Pavian. This script
can be found in the /path/to/SqueezeMeta/utils/ directory.
Figure 3: SqueezeMeta analysis of a thermal microbial mat and plotted by Pavian. Numbers correspond to
the amount of reads belonging to each of the phylogenetic nodes.
This script produces output files containing abundance of taxa that can be plotted using
the Pavian tool (https://github.com/fbreitwieser/pavian).It translates the results in the
SqueezeMeta mapcount file to the kraken report format wanted by Pavian.
52
SqueezeMeta v1.6
Usage
The abundances can be counted either in reads or in bases, as specified when calling the
script. By default, reads are used. The script will produce a file named
<project>.pavian that can be uploaded in the pavian app
(https://fbreitwieser.shinyapps.io/pavian) or in the pavian R package.
53
SqueezeMeta v1.6
Utilities: adding new databases to an existing project
add_database.pl
The databases to add must also be formatted in Diamond format. See section 6 for
details. If the external database file already exists (because you already used some
external databases when running SqueezeMeta), DO NOT create a new one. Instead add
the new entries to the existing database file.
Usage
The script will run Diamond searches for the new databases, and then will re-run several
SqueezeMeta scripts to include the new database(s) to the existing results. The following
scripts will be invoked:
13.mergeannot2.pl. For redoing the ORF table, including the new annotations
21.stats.pl: For including the number of hits to new database(s) in the final stats.
Outpust of these programs will be regenerated (but all files corresponding to other
databases will remain untouched).
For convenience, we also provide the SQMtools R package. This package provides an easy
way to expose the different results of SqueezeMeta (orfs, contigs, bins, taxonomy,
functions…) into R, as well as a set of utility functions to filter and display SqueezeMeta
results.
54
SqueezeMeta v1.6
sqm2tables.py
This script generates tabular outputs from a SqueezeMeta run. It will aggregate the
abundances of the ORFs assigned to the same feature (be it a given taxon or a given
function) and produce tables with features in rows and samples in columns. This script
can be found in the /path/to/SqueezeMeta/utils/ directory. Note that if you want
to create tables coming from a sqm_reads.pl or sqm_longreads.pl run you will
need to use the sqmreads2tables.py script.
Usage
sqm2tables.py [options] <project_path> <output_dir>
Arguments
Mandatory parameters
Options
● --trusted-functions: include only ORFs with highly trusted KEGG and COG
assignments in aggregated functional tables
● --ignore-unclassified: ignore reads with no functional classification when
aggregating abundances for functional categories (KO, COG, PFAM)
Output
● For each functional classification system (KO, COG, PFAM, and any external
database provided by the user) the script will produce the following files:
55
SqueezeMeta v1.6
Copy numbers are obtained by dividing the aggregate coverage of each
function in each sample by the coverage of RecA (COG0468) in each sample.
● For each taxonomic rank (superkingdom, phylum, class, order, family, genus,
species) the script will produce the following files:
56
SqueezeMeta v1.6
Details
● SqueezeMeta uses NCBI’s nr database for taxonomic annotation, and reports the
superkingdom, phylum, class, order, family, genus and species ranks. In some
cases, the NCBI taxonomy is missing some intermediate ranks. For example, the
NCBI taxonomy for the order Trichomonadida is:
◦ superkingdom: Eukaryota
◦ no rank: Parabasalia
◦ order: Trichomonadida
NCBI does not assign Trichomonadida to any taxa in the class and phylum ranks. For
clarity, the sqm2tables.py will indicate this by recycling the highest available
taxonomy and adding the “(no <rank> in NCBI)” string after it. For example, ORFs
that can be classified down to the Trichomonadida order (but are unclassified at the
family level) will be reported as:
◦ superkingdom: Eukaryota
◦ order: Trichomonadida
● The “Unclassified” category represents features that were classifiable with our
method (i.e. contained a protein-coding sequence). In addition to the normal
taxon names and the “Unclassified” category, the results will contain 2 extra
categories.
57
SqueezeMeta v1.6
◦ “Unmapped”: reads not mapping to any contigs.
sqmreads2tables.py
Usage
sqmreads2tables.py [options] <project_path> <output_dir>
Arguments
Mandatory parameters
Options
● --trusted-functions: include only ORFs with highly trusted KEGG and COG
assignments in aggregated functional tables
● --force-overwrite: write results even if the output directory already exists
● -q/—query: Filter the results based on the provided query. Query syntax is the
same as in the anvi-filter-sqm.py script.
Output
● For each functional classification system (KO, COG, PFAM, and any external
database provided by the user) the script will produce the following files:
● For each taxonomic rank (superkingdom, phylum, class, order, family, genus,
species) the script will produce the following files:
58
SqueezeMeta v1.6
◦ <project_name>.<rank>.allfilter.abund.tsv: raw abundances of
each taxon for that taxonomic rank in the different samples, applying the
identity filters for taxonomic assignment (see explanation of the LCA algorithm
below).
combine-sqm-tables.py
Usage
combine-sqm-tables.py [options] <project_paths>
Arguments
Positional arguments
Options
Examples
● Combine projects /path/to/proj1 and /path/to/proj2 and store output in a
directory named outputDir
59
SqueezeMeta v1.6
○ combine-sqm-tables.py /path/to/proj1 /path/to/proj2 -o
output_dir
● Combine a list of projects contained in a file, use default output dir
○ combine-sqm-tables.py -f project_list.txt
Output
● Tables containing aggregated counts and feature names for the different
functional hierarchies and taxonomic levels for each sample contained in the
different projects that were combined. Tables with the TPM and copy number of
functions will also be generated for SqueezeMeta runs, but not for SQM reads
runs.
This package provides an easy way to expose the different results of SqueezeMeta (orfs,
contigs, bins, taxonomy, functions…) into R, as well as a set of utility functions to filter
and display SqueezeMeta results.
Once SqueezeMeta has finished running, just go into R and load the project.
library(SQMtools)
project = loadSQM(“<project_directory>”)
The resulting SQM object contains all the relevant information, distributed in an R list
(see Figure 5). For example, a matrix with the taxonomic composition of the different
samples at the phylum level in percentages can be obtained with
project$taxa$phylum$percent
while a matrix with the average copy number per genome of the different PFAMs across
samples can be obtained with
project$functions$PFAM$copy_number
The SQMtools package also provides functions for selecting subsets of your data and
plotting/exporting results. The basic workflow is illustrated in Figure 6. For example, we
can make a plot with the taxonomic distribution of all the genes related to vitamin
metabolism.
plotTaxonomy(vit)
As an alternative to running a full SqueezeMeta project, you can just load the taxonomic
and functional aggregate tables. This will work with the output of sqm2tables.py,
sqmreads2tables.py and combine-sqm-tables.py, so you can analyze the ouput of
60
SqueezeMeta v1.6
sqm_reads.pl, or the combined results of several SqueezeMeta or sqm_reads projects. To
do so, you can use the loadSQMlite function from SQMtools.
project = loadSQMlite(“<tables_directory>”)
SQMtools can also be used in Mac or Windows, meaning that you can run SqueezeMeta in
your Linux server and then move the results to your own computer and analyze them
there. In order to install it in Mac or Windows (including RStudio) you should do the
following:
1. Download and uncompress the source code for the latest version of SqueezeMeta
from https://github.com/jtamames/SqueezeMeta/releases/latest
61
SqueezeMeta v1.6
Figure 5: Structure of the SQM R object. If external databases for functional classification were provided
to SqueezeMeta via the -extdb argument, the corresponding abundance (reads and bases), tpm and copy
number profiles will be present in SQM$functions (e.g. results for the CAZy database would be present
in SQM$functions$CAZy. Additionally, the extended names of the features present in the external
database will be present in SQM$misc (e.g. SQM$misc$CAZy_names). The SQMlite object will have a
similar structure, but will lack the SQM$orfs, SQM$contigs and SQM$bins section. Additionally, if the
results come from a sqm_reads.pl run, the SQMlite object will also be missing TPM, bases and copy
numbers for the different functional classification methods.
62
SqueezeMeta v1.6
Figure 6: Basic workflow of the SQMtools package. The basic unit used in the package is the SQM object.
This object can contain a full SqueezeMeta project or a subset of genes, contigs or bins. The data in the
SQM object can be accessed directly (e.g. for using it with other R packages such as vegan for ordination
analyses or DESeq2 for differential abundance analysis) but we also provide some utility functions for
exploring the most abundant functions or taxa in a SQM object. Alternatively, aggregate tables can be
loaded into a SQMlite objects, which supports plot and export functionality. SQMlite objects can not be
subsetted, but can be combined.
63
SqueezeMeta v1.6
Figure 4: Analysis of the Hadza hunter-gatherer test dataset included with SqueezeMeta. After running
the test analysis as described in Section 7, the sqm2anvio.pl and anvi-load-SQM.py scripts were
applied sequentially in order to generate an anvi’o database. Finally, the anvi-filter-SQM.py was used
to select all the contigs containing genes related to iron metabolism and visualize them in the anvi’o
platform. This platform allow further visual exploration of the results: in this example genes related to
the enterobactin iron transporter were searched for and marked (red ticks at the left, outside the
taxonomy circle) using the anvi’o interface. We can see that the use of enterobactin for iron acquisition
occurs on sample SRR1929485, but not in sample SRR1927149 (abundance bars below the taxonomy circle).
sqm2anvio.pl
This script generates the files required for loading SqueezeMeta results into anvi'o. It
can be found in the /path/to/SqueezeMeta/utils/anvio_utils directory. The
direct use of this script has been deprecated in v1.1.0. Instead, anvi-load-sqm.py
will make an anvi’o database from a SqueezeMeta project in a single step.
Usage
64
SqueezeMeta v1.6
Output
The script will produce a directory named “output directory“ with all the required
files.
Notes
Currently we support anvio versions 6 and 7. Support is only for released versions, the
master/develop branches of anvi’o might (and will likely) not work.
anvi-load-sqm.py
This script creates an anvi'o database from a SqueezeMeta project. The database can
then be filtered and visually explored using the anvi-filter-sqm.py script. This
script can be found in the /path/to/ SqueezeMeta/utils/anvio_utils directory.
For this script to work, anvi’o must be installed and present in your PATH.
Usage
Arguments
Mandatory parameters
Options
65
SqueezeMeta v1.6
● --doc: print the documentation
Output
anvi-filter-sqm.py
This script filters the results of a SqueezeMeta project (previously loaded into to an
anvi’o database by the sqm2anvio.pl and anvi-load-sqm.py scripts) and opens an
anvi’o interactive interface to examine them. Filtering criteria can be specified by using
a simple query syntax. This script can be found in the /path/to/
SqueezeMeta/utils/anvio_utils directory. For this script to work, anvi’o must be
installed and present in your PATH.
Mandatory parameters
● -q/--query: query
Options
66
SqueezeMeta v1.6
● --enforce-clustering: make anvi'o perform an additional clustering based on
abundances across samples and sequence composition
● By default, the script uses an in-house method to subset the anvi'o databases. It's
~5x quicker than using anvi-split in anvio5, and works well for us. However, the
night is dark and full of bugs, so if you feel that your anvi'o view is missing some
information, you can call the script with "-s safe" parameter. This will call
anvi-split which should be much safer than our hacky solution.
Query syntax
● The "AND" and "OR" logical operators can't appear together in the same
expression. Parentheses must be used to separate them into different
expressions. e.g:
67
SqueezeMeta v1.6
○ "(PHYLUM == Bacteroidetes OR CLASS IN
[Alphaproteobacteria, Gammaproteobacteria]) AND FUN
CONTAINS iron AND Sample1 > 1"
○ This would select all the anvi'o splits assigned to either the Bacteroidetes
phylum or the Alphaproteobacteria or Gammaproteobacteria classes, that
also contain the substring "iron" in the functional annotations of any of
their ORFs, and whose anvi'o abundance (mean coverage of a split divided
by the overall sample mean coverage) in Sample1 is higher than 1.
○ FUN: search within all the combined databases used for functional
annotation.
○ FUNH: search within the KEGG BRITE and COG functional hierarchies (e.g.
"FUNH CONTAINS Carbohydrate metabolism" will select all the splits
containing a gene associated with the broad "Carbohydrate
metabolism" category)
● Posible relational operators are "==", "!=", ">=", "<=", ">", "<", "IN", "NOT IN",
"CONTAINS", "DOES NOT CONTAIN"
68
SqueezeMeta v1.6
Utilities: binning refinement
Directory utils contains some tools for binning refinement, intended to work on the
binning results provided by SqueezeMeta. They rely on checkM analysis to add or remove
contigs from the bins.
remove_duplicate_markers.pl
Usage
If no bin name is provided, the script will run the analysis for ALL bins in the project.
Output
The scripts produces a new fasta file for the bin with the name "refined" in the binning
directory (usually in <project>/results/DAS/<project>_DASTool_bins). It also runs checkM
again to redo the statistics for the bin(s). The result of that checkM run is stored in
<project>/temp/checkm_nodupl.txt
find_missing_markers.pl
This script intends to improve the completeness of the bin, using the checkM analysis to
find contigs from the same taxa of the bin that contain missing markers (those that were
not found in any contig of the bin). The user can then decide whether or not including
these contigs in the bin.
69
SqueezeMeta v1.6
Usage
If no bin name is provided, the script will run the analysis for ALL bins in the project.
The script also sets the variable $mode that affects the selection of contigs. Mode
"relaxed" will consider contigs from all taxa not contradicting the taxonomy of the bin,
including these that belong to higher-rank taxa (for instance, if the bin is annotated as
"Escherichia" (genus), the script will consider also contigs classified as
"Enterobacteriaceae" (family), "gamma-Proteobacteria" (class), or even "Bacteria"
(superkingdom), since these assignments are not incompatible with the one of the bin).
Mode "strict" will only consider contigs belonging to the same taxa of the bin (in the
example above, only these classified as genus Escherichia).
Output
The script produces a list of contigs containing missing markers for the bin, sorted by the
abundance of markers.
70
SqueezeMeta v1.6
Explanation of SqueezeMeta algorithms
For the amino acid sequence of each gene, DIAMOND (blastp) homology searches are
done against the GenBank nr database. A e-value cutoff of 1e-03 is set by default. The
best hit is obtained, and then we select a range of hits (valid hits) having at least 80% of
the bitscore of the best hit and differing in less than 10% identity also with the best hit
(these values can be set). The LCA of all these hits is obtained, that is, the taxon
common to all hits. This LCA can be found at diverse taxonomic ranks (from phylum to
species). We allow some flexibility in the definition of LCA: a small number of hits
belonging to other taxa than the LCA can be allowed. In this way we deal with putative
transfer events, or incorrect annotations in the database. This value is by default 10% of
the total number of valid hits, but can be set by the user. Also, the minimum number of
hits to the LCA taxa can be set.
Genus:Polaribacter
Order:Flavobacteriales
Genus:Polaribacter
Order:Flavobacteriales
Family: Flavobacteriaceae
Gen1 Hit3 70.4 2e-87
Order:Flavobacteriales
Genus:Algibacter
Order:Flavobacteriales
71
SqueezeMeta v1.6
Genus:Rhodospirillum
Order:Rhodospirillales
In this case, the four first hits are the valid ones. Hit 5 does not make the identity and
e-value thresholds. The LCA for the four valid hits is Family: Flavobacteriaceae, that
would be the reported result.
Our LCA algorithm includes strict cut-off identity values for different taxonomic ranks,
according to Luo et al., Nucleic Acids Research 2014, 42, e73. This means that hits must
pass a minimum (aminoacid) identity level in order to be used for assigning particular
taxonomic ranks. These thresholds are 85, 60, 55, 50, 46, 42 and 40% for species, genus,
family, order, class, phylum and superkingdom ranks, respectively. Hits below these
levels cannot be used to make assignments for the corresponding rank. For instance, a
protein will not be assigned to species level if it has no hits above 85% identity. Also, a
protein will remain unclassified if it has no hits above 40% identity. The inclusion of
these thresholds guarantees that no assignments are done based on weak, inconclusive
hits.
Overall, this results in highly conservative, but also very trustworthy taxonomic
annotations. If SqueezeMeta says that something is annotated at the genus or species
level it really means it. However, these filters do not work so well for eukaryotes,
resulting in too few annotations. We believe that the main reasons are the following:
● Those filters were calculated using prokaryotic genomes, and might not be valid
in eukaryotes.
● Eukaryotes are poorly represented in the databases, leading to lower similarities
on average.
Adding the --euk flag when running SqueezeMeta will apply Luo et al.'s cutoffs only to
prokaryotic genes, and use a normal LCA algorithm with no cutoff for the eukaryotes.
This still gives a very robust taxonomy for prokaryotes, while also providing some
information on what kind of eukaryotes might be in the sample.
72
SqueezeMeta v1.6
The fun3 algorithm
Fun3 is the algorithm that produces functional assignments (for COGs, KEGG and
external databases). It reads the DIAMOND Blastx output of the homology search of the
metagenomic genes for these databases. The homology search has been done with the
defined parameters of e-value and identity, so that no hits below above the minimum
e-value or below the minimum identity are found. Also, partial hits (where query and
hits align in less than the percentage given by the user, 30% by default) are discarded.
The hits that pass the filters can correspond to more than one functional ID (for
instance, COG or KEGG ID). Fun3 provides two types of classification: Best hit is just the
functional ID of the highest scoring hit. Best average tries to evaluate also if that
functional ID is significantly better than the rest. For that, it takes the first n hits
corresponding to each functional ID (n set by the user, default is 5) and calculates their
average bitscore. The gene is assigned to the functional ID with the highest average
bitscore that exceeds in a given percentage (given by the user, by default 10%) the
score of the second one. This method reports less assignments but it is also more
precise, avoiding confusions between closely related protein families.
A unique functional assignment, the best hit, is shown in the gene table. There, the
functional ID is shown with a * symbol to indicate that the assignment is supported also
by the best average method.
The -D option activates the doublepass procedure, where regions of the contigs where
no ORFs where predicted, or where these ORFs could not be assigned taxonomically and
functionally, are queried against the databases using blastx. This method allows to
recover putative ORFs missed by Prodigal, or to correct wrongly predicted ORFs. The
following figure illustrates the steps of the doublepass procedure:
73
SqueezeMeta v1.6
Consensus taxonomic annotation for contigs and bins
The consensus algorithm attempts to obtain a consensus taxonomic annotation for the
contigs according to the annotations of each of its genes. The consensus taxon is the one
fulfilling:
-50% of the genes of the contig belong to (are annotated to) this taxon, and
-70% of the annotated genes belong to (are annotated to) this taxon.
Notice that the first criterion refers to all genes in the contig, regardless if they have
been annotated or not, while the second refers exclusively to annotated genes.
As the assignment can be done at different taxonomic ranks, the consensus is the
deepest taxon fulfilling the criteria above.
For instance, consider the following example for a contig with 6 genes:
Gen1:
k_Bacteria;p_Proteobacteria;c_Gamma-Proteobacteria;o_Enterobacteri
ales;f_ Enterobacteriaceae;g_Escherichia;s_Escherichia coli
Gen2:
k_Bacteria;p_Proteobacteria;c_Gamma-Proteobacteria;o_Enterobacteri
ales;f_ Enterobacteriaceae;g_Escherichia
74
SqueezeMeta v1.6
Gen3:
k_Bacteria;p_Proteobacteria;c_Gamma-Proteobacteria;o_Enterobacteri
ales;f_ Enterobacteriaceae;g_Escherichia
Gen4:
k_Bacteria;p_Proteobacteria;c_Gamma-Proteobacteria;o_Enterobacteri
ales;f_ Enterobacteriaceae
Gen5: No hits
Gen6: k_Bacteria;p_Firmicutes
For annotating the consensus of bins, the procedure is the same, but using the
annotations of the corresponding contigs instead.
Disparity calculation
Notice that in the example above, the end part of the contig seems to depart from the
common taxonomic origin of the rest. This can be due to misassembly resulting in
chimerism, or other causes such as a recent LCA transfer or a wrong annotation for the
gene. The disparity index attempts to measure this effect, so that the contigs can be
flagged accordingly (for instance, we could decide not trusting contigs with high
disparity).
Disparity index is calculated for the taxonomic rank assigned by consensus algorithm (in
the previous example, family). We compare the assignments at that level for every pair
of genes in the contig, and count the number of agreements and disagreements. If one
of the taxa has no annotation at that level, is not counted for agreement but it is
counted for disagreements if previous ranks do not coincide (we assume that if higher
ranks do not agree, lower ranks will not either). That is:
Gen1-Gen2: Agree
Gen1-Gen3: Agree
75
SqueezeMeta v1.6
Gen1-Gen4: Agree
Gen1-Gen5: Unknown
Gen2-Gen3: Agree
Gen2-Gen4: Agree
Gen2-Gen5: Unknown
Gen3-Gen4: Agree
Gen3-Gen5: Unknown
Gen4-Gen5: Unknown
Gen5-Gen6: Unknown
Disparity index is the ratio between the number of disagreements and the total number
of comparisons, in this case 4/15=0.26
For calculating the disparity of bins, the procedure is the same, just using the
annotations for the contigs belonging to the bin instead.
76
SqueezeMeta v1.6