Accident-Detection-And-Alerting-System RUSHI
Accident-Detection-And-Alerting-System RUSHI
Abstract
The usage of auto mobiles has improved linearly over the past decade, which increased in the risk of
human life. This is because due to the insufficient emergency facilities .In this paper we are using an
alarm system which helps in improving the emergency system of the accident system. This system
detects the accident occurrence and the coordinated of the accident are messaged to the rescue team .A
switching system is used switch off in case there are no causality. The Accident is detected with the help
of MEMS Sensor and Vibration Sensor. The Angle in which the car has rolled off is indicated through a
message. This Application helps in providing feasible solution to the poor emergency facilitates.
CHAPTER 1 : INTRODUCTION
Every Embedded system consists of a custom-built hardware built around a central processing
unit. This hardware also contains memory chips onto which the software is loaded.
The operating system runs above the hardware and the application software runs above the
operating system. The same architecture is applicable to any computer including desktop computer.
However these are significant differences. It is not compulsory to have an operating system in every
embedded system. For small applications such as remote control units, air conditioners, toys etc.
Some of the most common embedded systems used in everyday life are
(e.g., thermostats)
Embedded networks
Signal processing: Often use DSP chips for vision, audio, or other signal
Embedded PCs: Palmtop and small form factor PCs embedded into Equipment
ACCIDENT DETECTION AND ALERTING SYSTEM
Command and control: Often huge military systems and “systems of systems”
(e.g., a fleet of warships with interconnected
Computers)
ACCIDENT DETECTION AND ALERTING SYSTEM
CHAPTER 2
The usage of automobiles has improved linearly over the past decade, which increased in the risk
of human life. This is because due to the insufficient emergency facilities .In this paper we are using a
alarmsystemwhichhelpsinimprovingtheemergencysystemoftheaccidentsystem.This system detects the
accident to ccurrence and the co-ordinatedoftheaccidentaremessagedtotherescueteam.Aswitching system
is used switch off in case there are no causality. The Accident is detected with the help of MEMS Sensor
and Vibration Sensor. The Angle in which the car has rolled off is indicated through a message. This
Application helps in providing feasible solution to the poor emergency facilitates.
In present days the rate of accidents can be increased rapidly. Due to employment the usage of
vehicles like cars, bikes can be increased, because of this reason the accidents can be happened due to
over speed. People are going under risk because of their over speed, due to unavailability of advanced
techniques, the rate of accidents can‟t be decreased. To reduce the accident rate in the country this paper
introduces a optimum solution. Automatic alert system for vehicle accidents is introduced; the main
objective is to control the accidents by sending a message to the registered mobile using wireless
communications techniques. When an accident occurs at a city, the message is sent to the registered
mobile through GSM module in less time. Arduino is the heart of the system which helps in transferring
the message to different devices in the system. Vibration sensor will be activated when the accident
occurs and the information is transferred to the registered number through GSM module. GPS system
will help in finding the location of the accident spot. The proposed system will check whether an
accident has occurred and notifies to nearest medical centres and registered mobile numbers about the
place of accident using GSM and GPS modules. The location can be sent through tracking system to
cover the geographical coordinates over the area. The accident can be detected by a vibration sensor
which is used as major module in the system.
The high demand of vehicles has also increased the traffic hazards and the road accidents. Life of
the people is under high risk. This is because of the lack of best emergency facilities available in our
country.Anautomaticalertsystemforvehicleaccidentsisintroducedinthispaper.Theproposedsystem which
can detect accidents in significantly less time and sends the basic information to first aid centre.
ACCIDENT DETECTION AND ALERTING SYSTEM
within a few seconds covering geographical coordinates, the time and angle in which a vehicle accident
had occurred. This alert message is sent to the central emergency dispatch server in a short time so that the
emergency dispatch server will inform to the ambulances which are near to that location, which will
helpinsavingthevaluablelives.ASwitchisalsoprovidedinordertoterminatethesendingofamessage
inrarecasewherethereisnocasualty,thiscansavetheprecioustimeoftheambulance.Whentheaccident occurs the
alert message is sent automatically to the central emergency dispatch server. The message is
sentthroughtheGSMmoduleandthelocationoftheaccidentisdetectedwiththehelpoftheGPSmodule. The
accident can be detected precisely with the help of vibration sensor. This application provides the
optimum solution to poor emergency facilities provided to the roads accidents in the most feasibleway.
Statistics show that the leading cause of death by injury is road traffic accidents. A survey report
by World Health Organization highlights that every year more than 30,000 people in Pakistan are died
due to road traffic accidents [1]. There are number of causes for which an accident can occur, some of
them are; lack of training institutes, use of mobile phone while driving, unskilled drivers, driving while
intoxicated, bad road condition, overloading, and poor traffic management[2].However, most of the time
ithasbeenobservedthatthedeathsoccuredintheroadaccidentareduetothelatearrivaloftheambulance to the
accident spot. Although in most cases the injury is not severe and we could save the affected lives,
however, due to late arrival of the rescue team, the injuries turn fatal. In this survey paper, we briefly
review selected road accident detection techniques and propose a solution. In these techniques, a system
is used that can automatically detect an accident in appreciably less amount of time and sends the basic
informationabouttheaccidenttotheemergencycentre.Thesetechniquesusesmartphone,GSM and GPS,
VANET and mobile applications. In smart phone-based accident detection, the Internet services
provided byacellularnetworkoperatorareusedtosendtheinformationincaseofroadaccident.Thegeographical
location of the accident spot is identified by the GPS system. In GSM and GPS based accident detection
system; GSM cellular technology is used to send the data in case of road accident. The location of the
accident spot is identified by the GPS system. In VANET-based accident detection system, in case of an
accident, information to the emergency department is sent using the VANET-an ad-hoc network
between moving vehicles. The location of the accident spot is identified by the GPS system. In mobile
ACCIDENT DETECTION AND ALERTING SYSTEM
based accident detection system, when an accident occurs, a mobile application, e CALL for example,
detects the accident automatically and makes a call to the emergency services using mobile network
operator. Table I shows the features and limitations of above described accident detection methods. We
propose a solution to road accident detection problem with two ultrasonic sensors attached to embedded
system. One sensor is placed at the front side of the car and another is at the back. When an accident
happens, respective ultrasonic sensor detects it and sends this information to emergency service.
Every year in India around 1214 road accidents occur and about 377 casualties happen every day
[8]. Maximum of the accidents result in deaths as ambulance is not called immediately and as people do
not inform the ambulance to avoid police interrogation. The accident might occur at an isolated location
wherepeoplearenotpresenttoreporttheaccident.Recenttechnologiesinvehicleshaveinbuilthardware
modulestospotandreportaccidents.Suchsystemsareexpensiveandnon-portable.Notallcarshavesuch
systems, only luxury cars have such facility. Hence we introduce Accident Detection and Alert System
(ADAS) which will identify the accident with the help of sensors in the Smartphone. Since many
Smartphonehavethebasicrequiredsensorsandgoodcomputingpower,theycouldbeemployedtodetect
accidents and request response. As compared to hardware add-ons, Smartphone are portable - we could
carry them in any vehicle we are driving or even travelling in. The way we would use their sensors will
make this system inexpensive and lifesaving. The processes to detect accidents could be updated easily
and has more scope for forthcoming enhancements. As we are using Smartphone for communication we
could
use multiple ways of communicating with server, i.e. if the internet connectivity is not available
the SMScouldbeusedtoconversewiththeserverforhelp.TheprincipalobjectiveofADASistosuccessfully
detect accidents and communicate the same to ensure that the medical assistance can reach the accident
locationontime.Thedatafromthissystemcouldbeusedtoanalyzeandstudytheaccelerationwaveforms
generated during the accidents.
Quick development in populace has expanded the interest of vehicles, in this occupied and quick
movinglifemishapsmayhappenanytimeoftime.Numerousindividualslosetheirlifeinmishapsbecause of the
absence of medical aid or crisis administrations. In India, mishaps are the significant wellspring of death
ACCIDENT DETECTION AND ALERTING SYSTEM
streets,railroadsandraillinecrossing-relatedcarcrashesin2015[2].ReportsfromAutocarproexpress, that on
regular routine street mishaps have taken 405 lives and harmed 1020 individuals in 2017 [3]. On yearly
premise, 1.5 lakh individuals are seen to have passed on in mishaps by a study directed by WHO
[4].Therehavebeencircumstanceswheredelayincrisisadministrationshaveadditionallycausedpassing [5].
Since anticipation of mishaps is not in our grasp, we expect to give crisis benefits as quickly as time
permitsthroughourtask.Inthistaskweintendtofollowthevehicle,soatanyplacethemishaphappens,
sincethevehicleisunderfollowing,promptlythespotofmishapcanbefollowedandsenttocrisiscontacts in a
couple of moments seconds so that the closest medical clinic can arrive at the spot as quickly astime
permits and spare the life of the individual. On the off chance that the mishap is not extreme, we give a
key which lets the driver end the framework, with the goal that the message has not been sent
consequently helping in sparing the hour of rescue vehicle. The message is sent through GSM
MODULE and the area is followed by GPS module. The mishap is recognized with the assistance of
accelerometer sensor. The accelerometer is utilized as an accident or rollover identifier of the vehicle
during and after an accident. With signals from an accelerometer, a seriousness of the mishap can be
perceived. This venture gives answer for some serious issues. Vehicle following framework furnishes
security to vehicles and furthermore with the assistance of GPS an individual can follow his vehicle and
discover the vehicle development and its past exercises. Mishap ready framework primarily means to
spare the valuable existence to the individuals. The gear is little and can be fit into any vehicle
effectively. Taken vehicle recuperation will be simpler since we are following the vehicle. A basic
framework can be utilized for different purposes.
The Accident Detection and Alert System using Arduino is very sufficient and worthy to be
implementedinthevehiclespeciallyindevelopingcountrylikeNepal,India,Bangladeshetc.Accidentis
increasing due to increase in number of vehicles as a result every year the number of death is increasing.
The Accident Detection and Alert System using Arduino prevent the uncertain death after accident
because this system send the message alert to the hospital or police station. The message alert include
longitude, latitude (location of accident), in the form of google maplink.
In our previous tutorials, we have learned about How to interface GPS module with Computer,
how to build a Arduino GPS Clock and how to Track vehicle using GSM and GPS. Here in this project,
ACCIDENT DETECTION AND ALERTING SYSTEM
we are going to build a Arduino based vehicle accident alert system using GPS, GSM and
accelerometer. Accelerometer detects the sudden change in the axes of vehicle and GSM modules end
the alert message on your Mobile Phone with the location of the accident. Location of accident is sent in
the form of Google Map link, derived from the latitude and longitude from GPS module. The Message
also contains the speed of vehicle in knots. See the Demo Video at the end. This Vehicle Accident alert
project can also be used as a Tracking System and much more, by just making few changes in hardware
and software.
ACCIDENT DETECTION AND ALERTING SYSTEM
CHAPTER 3
LITERATURE SURVEY
From the past event and the existing approach the below Drawback are been noted:
4. Life loss and Property loss were not stopped in large scale.
Considering all the drawbacks into account we have formulated a proposed system which covers all
the above mentioned drawbacks.
2. This system gives the Latitude and Longitude of the system accident occurred area without any delay.
To protect the vehicle and tracking so many advanced technologies are available now a days. In olden
days the information of accident can be transferred, but the place of accident spot cannot be identified.
In any vehicle airbags are designed, air bags are used for security and safety travels [2]. The air bag
system was introduced in the year of1968.
• TPMS is system designed to control the pressure inside the pneumatic tires on vehicles that
provides different operating conditions such as a lower tire pressure is desired in order to maximize
traction, maneuvering through challenging terrain, pulling a heavy load out of an incline at slow speeds,
crawling out of soft dirt. The pressure ranges from 15 to 45PSI.
ACCIDENT DETECTION AND ALERTING SYSTEM
• Many other systems have been proposed to deduce the accident. The existing system deals with
two sensors where MEMS sensor is used to detect the angle and vibration sensor is used for detection
the change in the vehicle.
• The other existing system uses IOT and cloud computing system. Where the vehicle detection id
done through SVM (support vehicle machine) that is developed by Ant Colony Algorithm (ACA). Here
IOT will monitor the vehicles using magneto resistive sensors. The main aim of this project is to
differentiate the accidents which took place in traffic and at no traffic place.
• Existing system also provides the location of the accident using at mega 328 Micro controller
and RF transmitter and receiver. The information is sent to the saved mobile numbers [3].
This vehicle tracking system takes input from GPS and sends it through the GSM module to
desired mobile/laptop using mobile communication. Vehicle Tracking System is one of the biggest
technological advancements to track the activities of the vehicle. The security system uses Global
Positioning System GPS, to find the location of the monitored or tracked vehicle and then uses satellite
or radio systems to send to send the coordinates and the location data to the monitoring centre. At
monitoring centre various software‟s are used to plot the Vehicle on a map. In this way the Vehicle
owners are able to track their vehicle on a real-time basis. Due to real-time tracking facility, vehicle
tracking systems are becoming increasingly popular among owners of expensive vehicles.
ACCIDENT DETECTION AND ALERTING SYSTEM
CHAPTER 4
Presently a lot of methodologies are available in vehicles that allow vehicle protection and
tracking. Airbags are one of the most mandatory elements in vehicles. Front airbags have been standard
on all new cars since 1998 and light trucks since 1999. Seat belts are also available in four wheelers.tire-
pressure monitoring system (TPMS) is an electronic system designed to monitor the air pressure inside
the pneumatic tires on various types of vehicles. TPMS report real time tire-pressure information to the
driver of the vehicle, either via a gauge, a pictogram display, or a simple low pressure warning light. An
anti-lock braking system or anti-skid braking system (ABS) is an automobile safety system that allows
the wheels on a motor vehicle to maintain tractive contact with the road surface according to driver
inputs while braking, preventing the wheels from locking up (ceasing rotation) and avoiding
uncontrolled skidding. Traction control and electronic stability control go hand in hand and is designed
to prevent loss of traction of driven road wheels. The latest implementation techniques move along the
lines of providing help to the driver even if he is trapped in a remote location unable torespond.
Proposed system:
This system is very efficient and hence worthy to be implemented. Accident detection and
messaging system can be fitted in vehicle (Ambulance, Police or to the communication device of the
near and dear) and they are informed about any such untoward incident at the go. Accident detection and
messaging system is executions impalas the system makes use of GSM & GPS technologies. GPS is
used for taking the coordinate of the site of the accident while GSM is used for sending the message to
phone. To make this process all the control is made using Arduino whereas LCD is used to display the
accident.
ACCIDENT DETECTION AND ALERTING SYSTEM
CHAPTER 5
IMPLEMENTATION
Power supply
LCD
MEM‟s sensor
GSM Arduino
GPS
Hardware requirements:
Arduino
Power supply
MEM‟s sensor
GSM
GPS
LCD Arduino
ACCIDENT DETECTION AND ALERTING SYSTEM
The Arduino is a family of microcontroller boards to simplify electronic design, prototyping and
experimenting for artists, hackers, hobbyists, butal so many professionals. People use it as brains for
their robots, to build new digital music instruments, or to build a system that lets your house plants tweet
you when they‟re dry. Arduinos (we use the standard Arduino Uno) are built around an AT mega
microcontroller essentially a complete computer with CPU, RAM, Flash memory, and input/output pins,
all on a single chip.
Unlike, say, a Raspberry Pi, it‟s designed to attach all kinds of sensors, LEDs, small motors and
speakers,servos,etc.directlytothesepins,whichcanreadinoroutputdigitaloranalogvoltagesbetween
0and5volts.TheArduinoconnectstoyourcomputerviaUSB,whereyouprogramitinasimplelanguage
(C/C++,similartoJava)frominsidethefreeArduinoIDEbyuploadingyourcompiledcodetotheboard. Once
programmed, the Arduino can run with the USB link back to your computer, or stand-alone without it no
keyboard or screen needed, justpower.
ACCIDENT DETECTION AND ALERTING SYSTEM
Looking at the board from the top down, this is an outline of what you will see (parts of the board
you might interact with in the course of normal use are highlighted).
Digital Pins 0-1/Serial In/Out - TX/RX (dark green) - These pins cannot be used for digital i/o
(Digital Read and Digital Write) if you are also using serial communication (e.g. Serial.Begin)
Reset Button - S1 (darkblue)
In-circuit Serial Programmer(blue-green)
Analog In Pins 0-5 (lightblue)
Power and Ground Pins (power: orange, grounds: light orange)
External Power Supply In (9-12VDC) - X1(pink)
Toggles External Power and USB Power (place jumper on two pins closest to desired supply) -
SV1(purple)
USB (used for uploading sketches to the board and for serial communication between theboard
and the computer; can be used to power the board)(yellow)
Digital Pins
In addition to the specific functions listed below, the digital pins on an Arduino board can be used
for general purpose input and output via the pin Mode(),Digital Read(),and Digital Write()commands.
Each pin has an internal pull-up resistor which can be turned on and off using digital Write() (w/ a
value of HIGH or LOW, respectively) when the pin is configured as an input. The maximum current
per pin is 40mA.
Serial: 0 (RX) and 1 (TX). Used to receive (RX) and transmit (TX) TTL serial data. On the
Arduino Diecimila, these pins are connected to the corresponding pins of the FTDI USB-to-TTL
Serial chip. On the Arduino BT, they are connected to the corresponding pins of the
WT11Bluetooth module. On the Arduino Mini and Lily Pad Arduino, they are intended for use
with an external TTL serial module (e.g. the Mini-USBAdapter).
ExternalInterrupts:2and3. These pins can be configured to trigger an interruptional value,
arising or falling edge, or a change in value. See the attach Interrupt()function fordetails.
PWM: 3, 5, 6, 9, 10, and 11 Provide 8-bit PWM output with the analog Write()function. On
boards with an ATmega8, PWM output is available only on pins 9, 10, and11.
BT Reset: 7.(Arduino BT-only) Connected to the reset line of the Bluetooth module.
SPI:10(SS),11(MOSI),12(MISO),13(SCK).ThesepinssupportSPIcommunication,which,
although provided by the underlying hardware, is not currently included in the Arduinolanguage.
LED: 13. On the Diecimila and Lily Pad, there is a built-in LED connected to digitalpin
13. When the pin is HIGH value, the LED is on, when the pin is LOW, it's off.
ACCIDENT DETECTION AND ALERTING SYSTEM
Analog Pins
In addition to the specific functions listed below, the analog input pins support 10-bit analog-
to-digital conversion (ADC) using the Analog Read()function. Most of the analog inputs can also be
used as digital pins: analog input 0 as digital pin 14 through analog input 5 as digital pin 19. Analog
inputs 6 and 7 (present on the Mini and BT) cannot be used as digital pins.
Power Pins:
VIN (sometimes labeled "9V"): The input voltage to the Arduino board when it's using an
external power source (as opposed to 5 volts from the USB connection or other regulated
power source). You can supply voltage through this pin, or, if supplying voltage via thepower
jack, access it through this pin. Also note that the Lily Pad has no VIN pin and accepts only a
regulated input.5V: The regulated power supply used to power the microcontroller and other
components on the board. This can come either from VIN via an on-board regulator, or be
supplied by USB or another regulated 5Vsupply.
3V3 (Diecimila -only) :A 3.3 volt supply generated by the on-board FTDIchip.
GND: Groundpins.
Other Pins
AREF: Reference voltage for the analog inputs. Used with analog reference().
Reset: (Diecimila-only) Bring this line LOW to reset the microcontroller. Typically used to add are set
button to shields which block the one on the board.
Power supply:
In mains-supplied electronic systems the AC input voltage must be converted into a DC voltage
with the right value and degree of stabilization. In these basic configurations the peak voltage across
the load is equal to the peak value of the AC voltage supplied by the transformer‟s secondary
winding. For most applications the output ripple produced by these circuits is too high. However, for
some applications - driving small motors or lamps, for example - they are satisfactory. If a filter
capacitor is added after the rectifier diodes the output voltage waveform is improved considerably.
The section b- c is a straight line. During this time it is the filter capacitor that supplies the
loadcurrent.
ACCIDENT DETECTION AND ALERTING SYSTEM
The slope of this line increases as the current increases, bringing point c lower. Consequently the
diode conduction time (c-d) increases, increasing ripple. With zero load current the DC outputvoltage
isequaltothepeakvalueoftherectifiedACvoltage.Figureshowshowtoobtainpositiveandnegative outputs
referred to a common ground. In particular they are helpful in determining the voltage ripple for a
given load current and filter capacitor value. The value of the voltage ripple obtained is directly
proportionaltotheloadcurrentandinverselyproportionaltothefiltercapacitorvalue.Theperformance of a
supply commonly used in consumer applications – in audio amplifiers.
Oftenthedegreeofstabilityprovidedbythecircuitsdescribedaboveisinsufficientandastabilizer circuit
is needed. This circuit is often used as a reference voltage to apply to the base of a transistor of to the
input of an op amp to obtain higher output current. The simplest example of a series regulator is
shown in Figure. In this circuit the transistor is connected as a voltage follower and the output voltage
is about 600 - 700mV lower than the zener voltage.
The resistor R must be dimensioned so that the zener is correctly biased and that sufficient base
current is supplied to the base of Q1. For high load currents the base current of Q1 is no longer
negligible. To avoid that the current in the zener drops to the point where effective regulation is not
possible a Darlington may be used in place of the transistor. When better performance is required the
op amp circuit shown in Figure is recommended. In this circuit the output voltage is equal to the
reference voltage applied to the input of the op amp. With a suitable output buffer higher currents can
be obtained. The output voltage of the Figure 14 circuit can be varied by adding a variable divider in
parallel with the zener diode and with its wiper connected to the op amp‟s input.
The design of stabilized supplies has been simplified dramatically by the introduction of voltage
regulator ICs such as the L78xx and L79xx - three-terminal series regulators which provide a very
stable output and include current limiter and thermal protection functions. Regulated power supply is
mainlyusedtoprovidingpowertothisprojectbecauseitisprovidingregulateddcpoweranditconverts 220v
ac supply into regulated dc power of 5v, 9v, 12v, 15v etc. Regulated power supply consists of step
down transformer, bridge rectifier which is combination of 4 diodes connected in bridge shape.
Bridge rectifier has the maximum efficiency and it is best than other rectifiers that‟s why we preferit.
ACCIDENT DETECTION AND ALERTING SYSTEM
This rectifier converts ac into pulsating dc. After rectifier filter circuit is employed, usually capacitor
in parallel is used as filter or we can use number of capacitors in parallel and number of inductors in
series. All these filters are low pass filters as we required dc at the o/p. Then after capacitor voltage
regulator is used for observing the pure dc o/p. We can use various voltage regulators for obtaining
pure dc o/p but we prefer 78xx series voltage regulators as they are simpler, cheaper and easier than
others.
(1) AC Input: This is the input supply from the public utility where the device will be energized. It
is also supplied directly to the relay contacts in the device which connects the load to thesupply
when the supply is within 200V – 240Vrange.
(2) Step down transformer: It steps down the AC supply into 5v on the secondary side. It is
therefore a 230/5 v transformer. Any change in the primary reflects in the secondary of the
transformer. So any fluctuations in the input are also reflected as a fluctuation in theoutput.
(3) Rectifier: A centre tapped transformer, with four diodes for full wave rectification is used to
convert the ac voltage to a pulsating dc voltage followed by a filter, comprising of a capacitorto
filter out (smooth) the pulsation. After the rectification and smoothening, a sample of the output
voltage is fed to the micro controller. This voltage is unregulated and therefore varies as the
input mains voltage varies. Since the system is to prevent against over voltage, the transformer
was designed and the windings were so selected for the device to be able to sense and withstand
input mains voltage up to600Vac.
ACCIDENT DETECTION AND ALERTING SYSTEM
Mems sensor:
It is evident that the number of microscale sensors in our environment is set to increase. In some
markets they are well established such as pressure sensors, gyroscopes and ink jet nozzles, which
currently account for two thirds of the MEMS sensors market (Nexus, 2005). One of the reasons for
the success of MEMS technology is that the largest enabling technology, the integrated circuit
industry,
isalreadymature.IntelfounderGordonMoore‟sprediction,popularlyknownasMoore‟slaw(Moore,
1965),whichpredictsthatthenumberoftransistorsonachipdoubleseveryeighteenmonthsisrelevant
toMEMSsensorsinthat,notonlydoesmanufacturingcapabilityincrease,butalsothecostpersensor will
reduce significantly making MEMS sensors an increasingly attractive option. MEMS are able to
reduce the size, weight, power consumption, whilst increasing reliability and performance of existing
macroscopic devices. Through MEMS it is also possible to make devices previously not possible at a
macroscopicscale.
As with other MEMS technologies MEMS packaging is primarily derived from the IC industry.
However, the requirements on MEMS packaging are more stringent than for microelectronics. This is
because hermeticity, and stresses and strains are tolerable within microelectronics, providing they do
not affect the device reliability. However, these parameters will directly affect the performance of a
MEMS sensor. Therefore, MEMS packaging needs to be specific to its application, encompassing
design, material selection and processes (Beeby et. al., 2004, Reichl and Grosser, 2001), as this will
directly dictate the functional performance and reliability requirements of the packaged device.
Common technical challenges faced when packaging include: cost, size, package stresses, electrical
shielding, tolerance to foreign particles and hermeticity. MEMS packaging costs account for 70% to
90% of the device compared to 30% to 95% for an IC device (Evans, 2004). The primary drivers for
increased cost in MEMS packaging include: package stress, particle protection during manufacturing,
hermeticity requirements and lower production volumes. Design modelling of packaging will help
designers remove redundant features in MEMS component packages and help drive cost down.
However, accurately modeling total system performance is challenging when combining the package,
ACCIDENT DETECTION AND ALERTING SYSTEM
Components, adhesives, interconnections and possible effects on the package from board mounting,
thermal conditions, etc.
GSM
Definition:
Global system for mobile communication (GSM) is a globally accepted standard for digital
cellular communication. GSM is the name of a standardization group established in 1982 to create a
common European mobile telephone standard that would formulate specifications for a pan-European
mobile cellular radio system operating at 900 MHz
AGSMmodemisawirelessmodemthatworkswithaGSMwirelessnetwork.Awirelessmodem
behaves like a dial-up modem. The main difference between them is that a dial-up modem sends and
receives data through a fixed telephone line while a wireless modem sends and receives data through
radiowaves.
A GSM modem can be an external device or a PC Card / PCMCIA Card. Typically, an external
GSM modem is connected to a computer through a serial cable or a USB cable. A GSM modem inthe
form of a PC Card / PCMCIA Card is designed for use with a laptop computer. It should be inserted
into one of the PC Card / PCMCIA Card slots of a laptopcomputer.
ACCIDENT DETECTION AND ALERTING SYSTEM
Like a GSM mobile phone, a GSM modem requires a SIM card from a wireless carrier in order
to operate. As mentioned in earlier sections of this SMS tutorial, computers use AT commands to
control modems. Both GSM modems and dial-up modems support a common set of standard AT
commands. You can use a GSM modem just like a dial-up modem.
• Sending SMSmessages.
The number of SMS messages that can be processed by a GSM modem per minute is very low --
only about six to ten SMS messages per minute.
GSM AT COMMANDS
AT
AT&D0
AT+IFC=00
AT+CMGF=1
AT+CNMI=22000
ACCIDENT DETECTION AND ALERTING SYSTEM
AT commands features
Most GSM modems come with simple manual and necessary drivers. To setup your T-
Modem USB, download the USB GSM Modem Quick Start ( Windows ) guide (460kB PDF). You
would be able to send SMS from the Windows application and also setup GPRS connectivity. The
GSM modem will map itself as a COM serial port on your computer.
Windows based control panel to setup GSM modem, GPRS and send SMS
2. Using theHyperTerminal
- Bits per second:: 230400 ( or slower ) -Data Bits : 8 - Parity : None- Stop Bits Flow Control:
Hardware You are now ready to start working with AT commands. Type in "AT" and you should get
a "OK", else you have not setup your Hyper Terminal correctly. Check your port settings and also
make sure your GSM modem is properly connected and the drivers installed.
ACCIDENT DETECTION AND ALERTING SYSTEM
We are ready now to start working with AT commands to setup and check the status of the
GSM modem.
AT+CREG? A "0,1" reply confirms your modem is connected to GSM network AT+CSQ
We suggest try sending a few SMS using the Control Tool above to make sure your GSM
modem can send SMS before proceeding. Let's look at the AT commands involved.
AT+CSCA="+ xxxxx" Set your SMS center's number. Check with your provider.
The GSM modem can be configured to response in different ways when it receives a SMS.
a) Immediate-whenaSMSisreceived,theSMS'sdetailsareimmediatelysenttothehostcomputer (DTE)
via the +CMTcommand
AT+CMGF=1 to format SMS as a TEXT message
AT+CNMI=1, 2,0,0,0 Set how the modem will response when a SMS received
ACCIDENT DETECTION AND ALERTING SYSTEM
When a new SMS is received by the GSM modem, the DTE will receive the following +CMT :
"+61xxxxxxxx" , , "04/08/30,23:20:00+40"
This the text SMS message sent to the modem
Your computer (DTE) will have to continuously monitor the COM serial port, read and parse the message.
b) Notification-when a SMS is received, the host computer (DTE) will be notified of the new message. The
computer will then have to read the message from the indicated memory location and clear the memory
location.
AT+CNMI=1,1,0,0,0 Set how the modem will response when a SMS is received
When a new SMS is received by the GSM modem, the DTE will receive the following..
AT+CMGR=3 <Enter> AT command to send read the received SMS from modem
ThemodemwillthensendtothecomputerdetailsofthereceivedSMSfromthespecifiedmemory location
( eg.3 ) +CMGR: "RECREAD","+61xxxxxx","04/08/28,22:26:29+40"
In this project GSM Modem is interfaced with the microcontroller through rs232 interface. Since the
voltage levels of the microcontroller are different with that of the GSM modem we use a voltage converter or
the line driver such as MAX232 to make them rs232 compatible.
GSM and GPS both communicate through UART. Since microcontroller has only one inbuilt UART a
multiplexer is used to interface GSM and GPS to the microcontroller.
RS232
The most popular serial communication standard for asynchronous communications is RS-232
(Recommended Standard – 232. This specifies the rule of how different connected devices communicate. The
connected devices can either be terminals or communication equipment commonly referred as DTE & DCE.
ACCIDENT DETECTION AND ALERTING SYSTEM
According to RS232 interface, it requires only 3 lines i.e. Rx, TX & Ground when compared to the
bunch of connectors required for parallel communication. Even though parallel communication is easier to
establish, serial communication is preferred based on the costs for the communicationlines.
The EIA (Electronics Industry Association) RS232C Standard specifies & suggests a
maximum baud rate of 20,000bps, and RS232D is an advanced version of the same, which allows 1.5
Mbps. The connectors specified are D-TYPE 25 pin connector and D-TYPE 9 pin connector.
There are many GSM modems available in the market and most of them are on TTL logic but
someofthemuseRS232standardsandagainitbecomesaproblemtocommunicatewiltGSMmodem by using
Micro controller, Arduino or any other TTL platform.MAX232 is used to solve thisproblem.
Types of MAX232:
1) “MAX232N” where “N” Represent PDIP package Style this package is easy to sold and mostwidely
used.
2) MAX232D where “D” indicates the SOIC package which is difficult to sold and required a trained
professional to be used correctly.
Common mistakes:
• Capacitor voltage rating is less than16.
GPS:
What is GPS?
ACCIDENT DETECTION AND ALERTING SYSTEM
GPS or Global Positioning System is a satellite navigation system that furnishes location and
time information in all climate conditions to the user. GPS is used for navigation in planes, ships, cars
and trucks also. The system gives critical abilities to military and civilian users around the globe.GPS
provide continuous real time, 3-dimensional positioning, navigation and timingworldwide.
Fig.5.8:GPS
3) The user segment, which includes both military and civilian users and their GPSequipment.
Space Segment:
The space segment is the number of satellites in the constellation. It comprises of 29 satellites
circling the earth every 12 hours at 12,000 miles in altitude. The function of the space segment is
ACCIDENT DETECTION AND ALERTING SYSTEM
Utilized to route / navigation signals and to store and retransmit he route/navigation message sent by
the control segment. These transmissions are controlled by highly stable atomic clocks on the
satellites. The GPS Space Segment is formed by a satellite constellation with enough satellites to
ensure that the users will have, at least, 4 simultaneous satellites in view from any point at the Earth
surface at any time.
Control Segment:
The control segment comprises of a master control station and five monitor stations outfitted
withatomicclocksthatarespreadaroundtheglobe.ThefivemonitorstationsmonitortheGPSsatellite signals
and then send that qualified information to the master control station where abnormalities are revised
and sent back to the GPS satellites through groundantennas.
Control segment also referred as monitor station.
User Segment:
The user segment comprises of the GPS receiver, which receives the signals from the GPS
satellites and determine how far away it is from each satellite. Mainly this segment is used for the U.S
military, missile guidance systems, civilian applications for GPS in almost every field. Most of the
civilian uses this from survey to transportation to natural resources and from there to agriculture
purpose and mapping too.
Theworking/operationofGlobalpositioningsystemisbasedonthe„trilateration‟mathematical
principle.Thepositionisdeterminedfromthedistancemeasurementstosatellites.Fromthefigure,the four
satellites are used to determine the position of the receiver on the earth. The target location is
confirmedbythe4thsatellite.Andthreesatellitesareusedtotracethelocationplace.Afourthsatellite
isusedtoconfirmthetargetlocationofeachofthosespacevehicles.Globalpositioningsystemconsists of
satellite, control station and monitor station and receiver. The GPS receiver takes the information
from the satellite and uses the method of triangulation to determine a user‟s exactposition.
ACCIDENT DETECTION AND ALERTING SYSTEM
1. To determine position locations; for example, you need to radio a helicopter pilot the coordinates of
your position location so the pilot can pick youup.
2. To navigate from one location to another; for example, you need to travel from a lookout to the fire
perimeter.
3. To create digitized maps; for example, you are assigned to plot the fire perimeter and hotspots.
4. To determine distance between two differentpoints.
3 Advantages of GPS:
• GPS satellite based navigation system is an important tool for military, civil and commercialusers
• Vehicle tracking systems GPS-based navigation systems can provide us with turn by turndirections
• Very highspeed
2 Disadvantages of GPS:
• GPS satellite signals are too weak when compared to phone signals, so it doesn‟t work as well
indoors, underwater, under trees, etc.
• The highest accuracy requires line-of-sight from the receiver to the satellite; this is why GPS doesn‟t
work very well in an urbanenvironment.
ACCIDENT DETECTION AND ALERTING SYSTEM
ThereareseveraldifferentmodelsandtypesofGPSreceivers.WhileworkingwithaGPSreceiver it is
important to have:
GPS Error
There are many sources of possible errors that will degrade the accuracy of positions
computed by a GPS receiver. The travel time taken by the GPS satellite signals can be changed by
atmospheric effects; when a GPS signal passes through the ionosphere and troposphere it is refracted,
causing the speed of the signal to be different from the speed of a GPS signal in space. Another
source of error is noise, or distortion of the signal which causes electrical interference or errors
inherent in the GPS receiveritself.
The information about satellite orbits will also cause errors in determining the positions,
because the satellites are not really where the GPS receiver “thought” based on the information it
received when it determine the positions. Small variations in the atomic clocks on board the satellites
can translate to large position errors; a clock error of 1 nano second translates to 1 foot or 3 meters
user error on the ground. A multipath effect occurs when signals transmitted from the satellites
bounce off a reflective surface before getting to the receiver antenna. During this process, the receiver
gets the signal in straight line path as well as delayed path (multiplepaths).
The effect is similar to a ghost or double image on a TV set.
ACCIDENT DETECTION AND ALERTING SYSTEM
Satellite geometry can also affect the accuracy of GPS positioning. This effect is refers as
Geometric Dilution of Precision (GDOP). Which is refers to where the satellites are in related to one
another, and is a measure of the quality of the satellite configuration. It can be able to modify other
GPSerrors.MostGPSreceiversselectthesatelliteconstellationthatwillgivetheleastuncertainty,the best
satellitegeometry.
GPS receivers usually report the quality of satellite geometry in terms of Position Dilution of
Precision, or PDOP. PDOP are of two types, horizontal (HDOP) and vertical (VDOP) measurements
(latitude, longitude and altitude). We can check the quality of the satellite positioning the receiver is
currently available by the PDOP value. A low DOP indicates a higher probability of accuracy, and a
high DOP indicates a lower probability of accuracy. Another term of PDOP is TDOP (Time Dilution
of Precision). TDOP refers to satellite clock offset. On a GPS receiver can set a parameter known as
thePDOPmask.ThiswillcausethereceivertoignoresatelliteconfigurationsthathaveaPDOPhigher than the
limitspecified.
Lcd:
This is an example for the Parallel Port. This doesn't use the Bi-directional feature found on
newer ports, thus it should work with most, if no all Parallel Ports. It however doesn't show the use of
the Status Port as an input. These modules are preferred over seven segments and other multi segment
ACCIDENT DETECTION AND ALERTING SYSTEM
LEDs. There as on being: LCDs are economical; easily programmable; have no limitation of
displaying special & even custom characters (unlike in seven segments), animations and soon.
The command register stores the command instructions given to the LCD. A command is an
instruction even to LCD to do a predefined task like initializing it, clearing its screen, setting the
cursor position, controlling display etc. The data register stores the data to be displayed on the LCD.
The data is the ASCII value of the character to be displayed on theLCD.
LCD BACKGROUND:
The 44780 standard requires 3 control lines as well as either 4 or 8 I/O lines for the data bus.
The user may select whether the LCD is to operate with a 4-bit data bus or an 8-bit data bus. If a 4-bit
data bus is used the LCD will require a total of 7 data lines (3 control lines plus the 4 lines for thedata
bus). If an 8-bit data bus is used the LCD will require a total of 11 data lines (3 control lines plus the8
lines for the data bus). The three control lines are referred as EN, RW and RS
EN: The EN line is called "Enable." This control line is used to tell the LCD that you are sending it
data. To send data to the LCD, your program should make sure this line is low (0) and then set the
other two control lines and/or put data on the data bus. When the other lines are completely ready,
bring EN high (1) and wait for the minimum amount of time required by the LCD datasheet (this
varies from LCD to LCD), and end by bringing it low (0) again.
RS: The RS line is the "Register Select" line. When RS is low (0), the data is to be treated as a
command or special instruction (such as clear screen, position cursor, etc.). When RS is high (1), the
data being sent is text data which should be displayed on the screen. For example, to display the letter
"T" on the screen you would set RShigh.
RW: TheRW line is the "Read/Write" control line. When RW is low (0), the information on the data
bus is being written to the LCD. When RW is high (1), the program is effectively querying (orreading)
ACCIDENT DETECTION AND ALERTING SYSTEM
the LCD. Only one instruction ("Get LCD status") is a read command. All others are write commands-
-so RW will almost always be low.
Finally, the data bus consists of 4 or 8 lines (dependingonthemodeofoperationselectedbytheuser). In
the case of an 8-bit data bus, the lines are referred to as DB0, DB1, DB2, DB3, DB4, DB5, DB6, and
DB7.
ACCIDENT DETECTION AND ALERTING SYSTEM
Fig.5.10: Pindiagram
Software requirements:
You‟ll need to download the Arduino Software package for your operating system from the
Arduino download page.
When you‟ve downloaded and opened the application you should see something like this:
ACCIDENT DETECTION AND ALERTING SYSTEM
This is where you type the code you want to compile and send to the Arduino board.
Arduino Uno
The Code
The code you write for your Arduino are known as sketches. They are written in C++.
Every sketch needs two void type functions, setup()and loop(). A void type function doesn‟t return
any value.
The setup()method is ran once at the just after the Arduino is powered up and the loop()method is
ran continuously afterwards. The setup()is where you want to do any initialization steps, and in
loop()you want to run the code you want to run over and over again.
ACCIDENT DETECTION AND ALERTING SYSTEM
1
2
void setup()
3
{
4
}
5
void loop()
6
{
7
}
8
9
If you notice on the top edge of the board there‟s two black rectangles with several squares
in. These are called headers. Headers make it easy to connect components to the the Arduino.
Where they connect to the board is called pins. Knowing what pin something is connected to is
essential for programming an Arduino.
The pin numbers are listed next to the headers on the board in white.
In our code above the setup() method let‟s create a variable called LedPin . In C++ we
need to state why type our variable is beforehand, in this case it‟s an integer, so it‟s of type .int
1
2
int ledPin = 13;
3
void setup()
4
{
5
pinMode(ledPin, OUTPUT);
6
}
7
void loop()
8
{
9
}
10
11
Next we want to compile to machine code and deploy or upload it to the Arduino.
Compiling the Code
Ifthisisyourfirsttimeyou‟veevercompiledcodetoyourArduinobeforepluggingitintothecomputer go to the
Tools menu, then Serial Port and take note of what appearsthere.
Here‟s what mine looks like before plugging in the Arduino UNO:
Plug your Arduino UNO board in to the USB cable and into your computer. Now go back to the
Tools > Serial Port menu and you should see at least 1 new option. On my Mac 2 new serial ports
appear.
ACCIDENT DETECTION AND ALERTING SYSTEM
They ttyand cu are two ways that computers can talk over a serial port. Both seem to work with the
Arduino software so I selected the tty.* one. On Windows you should see COM followed by a
number. Select the new one that appears.
Once you have selected your serial or COM port you can then press the button with the arrow pointing
to the right.
Once that happens you should see the TX and RX LEDs below the L LED flash. This is the
communication going on between the computer and the Arduino. The L may flicker too.
Once this dance is complete your program should be running. And your LED should be off.
Now let’s try and switch it on using the HIGHconstant.
ACCIDENT DETECTION AND ALERTING SYSTEM
CHAPTER 6
UML DIAGRAMS
Activity Diagram:
ACCIDENT DETECTION AND ALERTING SYSTEM
Sequence Diagram:
ACCIDENT DETECTION AND ALERTING SYSTEM
CHAPTER 7
CONCLUSION
The Expected performance is achieved through implementation of the proposed system. The
sensor and other required components are distributed throughout the car providing more optimal
result to detect accidents. The proposed system can also be used for traffic estimation and system
performance estimation to prevent loss of life to its maximum.
ACCIDENT DETECTION AND ALERTING SYSTEM
References:
1. Vikram Singh Kushwaha, Deepa Yadav, Abuyeed Topinkatti, Amrita Kumari. “Car Accident
Detection System using GPS And GSM”,Volume
3. C.Prabha, R.Sunitha, R.Anitha. “Automatic Vehicle Accident Detection and Messaging System
Using GSM and GPS Modem”, Vol. 3, Issue 7, July2014
4. HoangDatPham,MichealDrieberg,ChiCuongNguyen,“Developmentofvehicletrackingsystem
using GPS and GSM modem “,Conference: 2013 IEEE Conference on Open Systems(ICOS)
5. Lih-JenKau, Member, IEEE, and Chih-Sheng Chen, “A Smart Phone – Based Pockert Fall
Accident Detection, Positioning and Rescue System”, Dec2013.
https://www.engpaper.com