ARD Administrator's Guide
ARD Administrator's Guide
Desktop
Administrator Guide
Version 3.4
% Apple Inc. Apple, the Apple logo, AirPort, AirPort Extreme,
© 2011 Apple Inc. All rights reserved. AppleScript, AppleTalk, AppleWorks, Bonjour, FireWire,
The owner or authorized user of a valid copy of K%CNK5KIJV-G[EJCKP.GQRCTF/CE/CEKPVQUJ/CE15
Apple Remote Desktop software may reproduce this QuickTime, Safari, Tiger, and Xserve are trademarks of
publication for the purpose of learning to use such Apple, Inc., registered in the U.S. and other countries.
software. No part of this publication may be reproduced
Apple Remote Desktop and Finder are trademarks of
or transmitted for commercial purposes, such as selling
Apple, Inc.
copies of this publication or for providing paid for
support services. Adobe and Acrobat are trademarks or registered
trademarks of Adobe Systems Incorporated in the U.S.
'XGT[GÒQTVJCUDGGPOCFGVQGPUWTGVJCVVJG
and/or other countries.
information in this manual is accurate. Apple Inc. is not
responsible for printing or clerical errors. Java and all Java-based trademarks and logos
are trademarks or registered trademarks of Sun
Apple
/KETQU[UVGOU+PEKPVJG75CPFQVJGTEQWPVTKGU
+P°PKVG.QQR
Cupertino, CA 95014 UNIX® is a registered trademark of the Open Group.
408-996-1010
www.apple.com 019-2004/2011-01
3
43 Network Requirements
43 Installing the Remote Desktop Administrator Software
44 Setting Up an Apple Remote Desktop Client Computer for the First Time
45 Upgrading the Remote Desktop Administrator Software
45 Upgrading the Client Software
45 Remote Upgrade Installation
46 /CPWCN+PUVCNNCVKQn
47 Upgrading Apple Remote Desktop Clients Using SSH
47 Creating a Custom Client Installer
49 'PCDNKPI4GOQVG/CPCIGOGPt
50 %QPUKFGTCVKQPUHQT/CPCIGF%NKGPVs
50 Removing or Disabling Apple Remote Desktop
50 Uninstalling the Administrator Software
51 Disabling the Client Software
52 Uninstalling the Client Software from Client Computers
4 Contents
68 Setting Apple Remote Desktop Administrator Access Authorization and Privileges
7UKPI.QECN#EEQWPVUKP/CE15:X5
69 Setting Apple Remote Desktop Administrator Access Authorization and Privileges
7UKPI.QECN#EEQWPVUKP/CE15:X4
70 Apple Remote Desktop Administrator Access Using Directory Services
70 Creating Administrator Access Groups
73 Enabling Directory Services Group Authorization
74 Apple Remote Desktop Guest Access
74 Apple Remote Desktop Nonadministrator Access
75 .KOKVKPI(GCVWTGUKPVJG#FOKPKUVTCVQT#RRNKECVKQn
76 Virtual Network Computing Access
77 %QOOCPF.KPG55*#EEGUs
77 /CPCIKPI%NKGPV#FOKPKUVTCVKQP5GVVKPIUCPF2TKXKNGIGs
77 Getting an Administration Settings Report
78 Changing Client Administrator Privileges
Contents 5
94 %QP°IWTKPICP#RRNG4GOQVG&GUMVQR%NKGPVVQDG%QPVTQNNGFD[C80%8KGYGr
94 Observing
97 Changing Screen Titles While Observing
97 Viewing a User’s Account Picture While Observing
98 Viewing a Computer’s System Status While at the Observe Window
99 5JQTVEWVUKPVJG/WNVKRNG5ETGGP1DUGTXG9KPFQw
99 Observing a Single Computer
100 1DUGTXKPI/WNVKRNG%QORWVGTs
100 Observing a Computer in Dashboard
101 5GPFKPI/GUUCIGs
101 5GPFKPI1PG9C[/GUUCIGs
101 Interactive Chat
102 Viewing Attention Requests
102 Sharing Screens
102 Sharing a Screen with Client Computers
102 /QPKVQTKPIC5JCTG5ETGGP5GUUKQn
103 Interacting with Your Apple Remote Desktop Administrator
103 Requesting Administrator Attention
103 Canceling an Attention Request
6 Contents
121 Using a Task Server for Report Data Collection
122 Report Database Recommendations and Bandwidth Usage
123 Auditing Client Usage Information
123 Generating a User History Report
124 Generating an Application Usage Report
125 Finding Files, Folders, and Applications
125 Using Spotlight to Find Items
126 Generating a File Search Report
127 Comparing Software
127 Generating a Software Version Report
127 )GPGTCVKPIC5QHVYCTG&KÒGTGPEG4GRQTt
128 Auditing Hardware
129 Getting Computer Information
129 Getting Serial Numbers
129 Getting Storage Information
130 Getting FireWire Device Information
131 Getting USB Device Information
131 Getting Network Interface Information
132 )GVVKPI/GOQT[+PHQTOCVKQn
132 Getting Expansion Card Information
133 Testing Network Responsiveness
134 Evaluating the Network Test Report
134 Exporting Report Information
135 Using Report Windows to Work with Computers
136 /CKPVCKPKPI5[UVGOs
136 Deleting Items
136 Emptying the Trash
137 Setting the Startup Disk
137 Renaming Computers
138 Synchronizing Computer Time
139 Setting Computer Audio Volume
140 Repairing File Permissions
140 Adding Items to the Dock
141 Changing Energy Saver Preferences
142 %JCPIKPI5JCTKPI2TGHGTGPEGUHQT4GOQVG.QIKn
142 Setting Printer Preferences
144 /CPCIKPI%QORWVGTs
144 Opening Files and Folders
145 Opening Applications
145 3WKVVKPI#RRNKECVKQPU9KVJQWV.QIIKPI1WVVJG7UGr
146 Putting a Computer to Sleep
146 Waking Up a Computer
147 .QEMKPIC%QORWVGT5ETGGn
Contents 7
147 &KURNC[KPIC%WUVQO2KEVWTGQPC.QEMGF5ETGGn
148 Unlocking a Computer Screen
148 Disabling a Computer Screen
149 .QIIKPI+PC7UGTCVVJG.QIKP9KPFQw
149 .QIIKPI1WVVJG%WTTGPV7UGr
150 Restarting a Computer
150 Shutting Down a Computer
151 Starting Up a Computer
152 UNIX Shell Commands
152 Send UNIX Command Templates
154 Executing a Single UNIX Command
154 Executing Scripts Using Send UNIX Command
155 Executing Shell Scripts with Remote Desktop
155 Executing AppleScript Scripts with Remote Desktop
156 $WKNVKP%QOOCPF.KPG6QQNs
8 Contents
178 #RRGPFKZ$4GRQTV(KGNF&G°PKVKQPU4GHGTGPEe
178 System Overview Report
182 Storage Report
184 USB Devices Report
184 FireWire Devices Report
184 /GOQT[4GRQTt
185 Expansion Cards Report
185 Network Interfaces Report
187 Network Test Report
188 Administration Settings Report
189 Application Usage Report
189 User History Report
Contents 9
About This Guide
Preface
What Is Apple Remote Desktop?
Apple Remote Desktop is easy-to-use, powerful, desktop management software for
CNN[QWTPGVYQTMGF/CEU5[UVGOCFOKPKUVTCVQTUECPTGOQVGN[EQPVTQNCPFEQP°IWTG
U[UVGOUKPUVCNNUQHVYCTGQÒGTKPVGTCEVKXGQPUETGGPJGNRVQGPFWUGTUCPFCUUGODNG
UQHVYCTGCPFJCTFYCTGTGRQTVUHQTCPGPVKTG/CEPGVYQTM
#RRNG4GOQVG&GUMVQRKUCPKFGCNVQQNHQTOCPCIKPI/CEUKPDWUKPGUUCPF
education. It reduces costs and improves productivity by letting you perform routine
OCPCIGOGPVVCUMUQPCNN[QWT/CEUUKOWNVCPGQWUN[+VECPGXGPUGTXGCUCXKTVWCN
-G[DQCTF8KFGQ/QWUG
-8/UQNWVKQPD[NGVVKPI[QWTGOQVGN[EQPVTQNCP[/CEQPVJG
network or observe all of them simultaneously.
11
Using This Guide
The Apple Remote Desktop Administrator Guide contains chapters to help you use
Remote Desktop. It contains overviews and explanations about Apple Remote Desktop
HGCVWTGUCPFEQOOCPFU+VCNUQGZRNCKPUJQYVQKPUVCNNCPFEQP°IWTG#RRNG4GOQVG
Desktop on client computers, how to administer client computers, and how to use
Remote Desktop to interact with computer users.
This guide is provided on the Apple Remote Desktop installation disc and on the
#RRNG4GOQVG&GUMVQRUWRRQTVYGDUKVGCUCHWNN[UGCTEJCDNGDQQMOCTMGF2&(°NG
You can use Apple’s Preview application or Adobe (Acrobat) Reader to browse the
EQPVGPVUQHVJKUIWKFGCUYGNNCUUGCTEJHQTURGEK°EVGTOUHGCVWTGUQTVCUMU
The Remote Desktop Help also contains new information, corrections, and late-
breaking information about Apple Remote Desktop. The most up-to-date information
is available through Remote Desktop Help before it’s available on the web as an
WRFCVGF2&(°NG
Notation Conventions
This guide and Remote Desktop Help contain step-by-step procedures to help you use
4GOQVG&GUMVQREQOOCPFUGÒGEVKXGN[+POCP[VCUMUUJQYPKPVJKUOCPWCNCPFKP
Remote Desktop Help, you need to choose menu commands, which look like this:
6JG°TUVVGTOCHVGT%JQQUGKUVJGPCOGQHCOGPWKPVJG4GOQVG&GUMVQROGPWDCT
The next term (or terms) are the items you choose from that menu.
Commands or command parameters that you might type, along with other text that
normally appears in a Terminal window, are shown in this font. For example:
To use this command, type “doit” without the dollar sign at the command prompt in
a Terminal window, then press the Return key.
This chapter describes the main aspects of Apple Remote Desktop administration
CPFWUGTKPVGTCEVKQPECRCDKNKVKGUCPFVGNNU[QWYJGTGVQ°PFEQORNGVGKPUVTWEVKQPU
for using them.
Administering Computers
Apple Remote Desktop lets you perform a wide range of client hardware and software
administrative activities remotely, from an administrator computer (a computer on
which administrator software resides):
Keep users’ software up to date by using Apple Remote Desktop to deploy
UQHVYCTGCPFTGNCVGF°NGUVQENKGPVEQORWVGTU
Create reports that inventory the characteristics of client computer software
and hardware.
Use Apple Remote Desktop remote administration capabilities to perform
housekeeping tasks for client computers.
15
You can administer client computers individually, but most Apple Remote Desktop
features can be used to manage multiple computers at the same time. For example,
you may want to install or update the same applications on all the computers
in a particular department. Or you may want to share your computer screen to
demonstrate a task to a group of users, such as students in a training room.
Acomputer list is a group of computers. You can easily administer the computers
similarly, observe them as a group, or perform other management tasks. When you
perform management tasks on a computer list, the tasks are run on every computer
in the list.
#RCTVKEWNCTEQORWVGTECPDGNQPIVQOQTGVJCPQPGNKUVIKXKPI[QWCNQVQH±GZKDKNKV[
for multicomputer management. A computer can be categorized by its type (laptop,
FGUMVQRKVURJ[UKECNNQECVKQP
DWKNFKPIVJ±QQTKVUWUG
OCTMGVKPIGPIKPGGTKPI
computing), and so forth.
Once you’ve set up computer lists, you can perform most of the computer
administration activities described next for groups of client computers.
Deploy Deploy
configuration files Mac OS X Server
drag-and-drop
application folders
Set
startup
disk
For example, you can use Apple Software Update to download an iCal update or an
operating system update to a test computer. If the update works as expected and
introduces no compatibility issues, copy the installer package to the administrator
computer to distribute to computers that need upgrading. This approach conserves
Internet bandwidth, because only one copy of the package needs to be downloaded.
;QWECPWUGVJG2CEMCIG/CMGTVQQN
KPENWFGFQPVJG#RRNG4GOQVG&GUMVQR
installation CD and with the Apple developer tools) to create your own installer
packages, such as when you want to:
Distribute school project materials or business forms and templates
Automate the installation of multiple installer packages
Deploy custom applications
Before performing remote installations, you can send an Apple Remote Desktop text
message to notify users, perhaps letting them know that you’ll be using Apple Remote
Desktop to lock their screens at a particular time before you start the installation.
1P/CE15:5GTXGTWUGVJG0GVYQTM+OCIG7VKNKV[VQETGCVGC0GV+PUVCNNKOCIG
You can create the image by cloning a system that’s already installed and set up, or
by using an installation disc or an image downloaded using Apple Software Update.
If you choose to auto-install, you won’t have to interact with each computer. On
the Apple Remote Desktop administrator computer, set the startup disk of remote
client systems to point to the NetInstall image, and then remotely reboot the clients
to start installation.
Client computers that boot from a NetBoot image get a fresh system environment
every time they start up. For this reason, using NetBoot images is useful when
CRCTVKEWNCTEQORWVGTKUUJCTGFD[UGXGTCNWUGTUYJQTGSWKTGFKÒGTGPVYQTM
environments or refreshed work environments, or when you want to start a new
GZRGTKOGPVQTWUGCFKÒGTGPVEQORWVKPIGPXKTQPOGPVKPCENWUVGTPQFG
You can use Apple Remote Desktop to set the startup disks of client systems to point
to the NetBoot image, and then restart the systems remotely using Apple Remote
Desktop. Users can also choose a NetBoot image for startup by using the Startup
&KUMRCPGQH5[UVGO2TGHGTGPEGU9KVJLWUVCHGYENKEMU[QWECPTGEQP°IWTGCNNVJG
EQORWVGTUKPCNCDQTENWUVGTYKVJQWVJCXKPIVQOCPWCNN[TGUVCTVCPFEQP°IWTGGCEJ
computer individually.
For example, a script can mount an AFP server volume, from which it downloads a disk
image to client computers. The script might also download an installer package and
then perform a command-line installation.
On an Xserve in a cluster node, you could also run a script that mounts a RAID volume
designed for high throughput and then downloads large data sets for processing.
;QWECPCNUQWUG#RRNG4GOQVG&GUMVQRVQFKUVTKDWVG#RRNG5ETKRV°NGUVJCVCWVQOCVG
2&(YQTM±QYUQTLQDKPUVTWEVKQPUHQTEQORWVCVKQPCNENWUVGTU
Taking Inventory
Apple Remote Desktop lets you capture data describing the attributes of client
computers, then generate reports based on the data.
You specify how often you want to capture data, the data you want to capture, and the
EQORWVGTU[QWYCPVVQRTQ°NG;QWECPEQNNGEVFCVCLWUVDGHQTGIGPGTCVKPICTGRQTVKH
you need up-to-the-minute information. Or you can schedule data to be collected by
#RRNG4GOQVG&GUMVQRCVTGIWNCTKPVGTXCNUCPFUVQTGFKPKVUDWKNVKP53.
5VTWEVWTGF
3WGT[.CPIWCIGFCVCDCUGHQTWUGQPCPCUPGGFGFDCUKU
You can also specify where you want the database to reside—on the local
administrator computer, or on a server where the Apple Remote Desktop administrator
software is installed, so data can be captured on an ongoing basis.
Administrator
Mac OS X Server
computer
6JKUTGRQTVECPJGNR[QW°PFQWVJQYOCP[EQRKGUQHCRCTVKEWNCTCRRNKECVKQPCTGKP
use so you don’t violate license agreements.
5QHVYCTG&KÒGTGPEG4GRQTV
7UGVJG5QHVYCTG&KÒGTGPEGTGRQTVVQFGVGEVCRRNKECVKQPXGTUKQPUVJCVCTGQWVQHFCVG
nonstandard, or unacceptable. You can also learn whether a user has installed an
application that shouldn’t be installed.
There are numerous uses for this report, such as identifying problems or verifying
U[UVGOEQP°IWTCVKQPUDGHQTGKPUVCNNKPIPGYUQHVYCTGQTFGVGTOKPKPIJQYOCP[
devices of a particular type (such as scanners) are in a particular lab.
Hardware Reports
Several reports provide details about particular hardware used by client computers—
storage, FireWire devices, USB devices, network interfaces, memory, and expansion
cards.
Use these reports to determine, for example, which computers need more memory,
which computer has the fastest processor speed, and how much free space is left on a
particular disk.
Use this report to help identify reasons for network communication problems that
EQWNFCÒGEV#RRNG4GOQVG&GUMVQR(QTGZCORNGKH[QW¨TGWPCDNGVQEQR[KVGOUVQ
RCTVKEWNCTENKGPVEQORWVGTUHTQOVJGCFOKPKUVTCVQTEQORWVGT[QWOC[°PF[QWJCXG
a bad connection to the computers. Using this information can help you isolate the
problem to a particular cable or hub.
Administrator
computer
Set
Remote screen Execute UNIX startup
control shell script disk
Send text
notification
NetBoot
images
You can display custom pictures or text messages on locked computer screens to let
users know when the computers are available again.
Controlling Screens
Use Apple Remote Desktop remote screen control to perform activities on the desktop
of Xserve computers, or use graphical applications on them. Apple Remote Desktop
TGRNCEGUVJGPGGFHQT-8/
MG[DQCTFXKFGQOQWUGUYKVEJGUHQTCEEGUUKPI:UGTXG
computers without a monitor attached.
You can also remotely control a user’s computer to help determine reasons for slow
performance or other problems.
For example, start up a computer using a server-based NetBoot image that’s been set
WRHQTVTQWDNGUJQQVKPI9JGP[QW¨TG°PKUJGFTGUGVVJGUVCTVWRFKUMVQVJGQTKIKPCNDQQV
volume.
Users initiate requests using the Apple Remote Desktop icon in the menu bar.
#PQVK°ECVKQPQPVJGCFOKPKUVTCVQTEQORWVGTCNGTVU[QWVQVJGOGUUCIGCPF[QWECP
obtain more information and troubleshoot the problem.
Screen Monitoring
Use Apple Remote Desktop to observe the user’s screen if you need more details to
understand the problem.
Screen Controlling
7UG#RRNG4GOQVG&GUMVQRVQEQPVTQNVJGWUGT¨UUETGGPKPQTFGTVQFKCIPQUGCPF°Z
the problem. You may have unlimited control, or a user can grant you temporary guest
access so you can control the computer only during troubleshooting.
There are two levels of control available. You can take complete control of the user’s
computer, or you can share control of the keyboard and mouse with the user.
Screen Sharing
If the problem is caused by incorrect actions by the user, share your screen with the
user as you demonstrate the correct way to perform the action.
Using Reports
Use hardware and software reports as diagnostic tools to determine whether the client
computer setup is part of the problem. For example, if a user can’t save his or her work,
the storage report can help you determine whether it’s a disk space issue.
Classroom
Sharing Screens
Display your screen or a student’s screen on other student computers for training and
demonstration purposes.
Locking Screens
.QEMUVWFGPVUETGGPUVQRTGXGPVUVWFGPVUHTQOWUKPIVJGKTEQORWVGTYJGP[QW
want them to focus on other activities.
/QTGKPHQTOCVKQPKUCXCKNCDNGCVVJGUGNQECVKQPU
For information about NetBoot and NetInstall, download the System Imaging and
Software Update Administration guide at:
www.apple.com/server/macosx/resources/
;QWECP°PFVJGSoftware Delivery Guide on the Apple Developer Connection
website at:
developer.apple.com/referencelibrary/
30
K L
D
E
G
H
I
A All Computers list: The All Computers list is a list of all client computers that you plan
to administer. Computers need to be in the All Computers list before you can command
or administer them. If you have a 10-client license, the All Computers list can contain only
10 computers.
B Apple Remote Desktop computer lists: A list of computers you create to group computers
in ways that are convenient for you. Any list is a subset of the client computers in the All
Computers list. If you add a computer directly to a computer list, it is added automatically to
the All Computers list as well.
C Smart computer lists: A smart computer list contains that subset of the client computers
in the All Computers list which meets predetermined criteria. Smart Computer lists update
themselves based on your criteria compared to the contents of the All Computers list.
D Group folders: Groups are tools to help you organize all your possible lists, tasks, and
scanners. Groups look like folders, and can be collapsed to hide the group contents.
E Saved tasks: Saved tasks are listed in the left portion of the main window. They have the
icon of the type of task and have a user-changeable name.
F Scanner: 5ECPPGTU°PFENKGPVUVQCFFVQVJG#NN%QORWVGTUNKUV;QWECPOCMGPGYUECPPGTU
and customize them for your needs. “/CMKPIC0GY5ECPPGT” on page 58
G Task server list: This lists tasks delegated to the Task Server, rather than run those run
directly from the application. When all the target computers have come online and
participated in the task, the task is labeled as complete.
J Task status icon: These icons represent the current state of a task. See “Task Status Icons”
on page 175.
K Client status icon: Icon representing the current state of a client computer. See “Client Status
Icons” on page 174.
L Customizable toolbar: The toolbar can be fully customized with icons of your most-used
Apple Remote Desktop features.
Task Dialogs
9JGP[QWENKEMCVCUMCFKCNQICRRGCTUVQNGV[QWUGVVCUMRCTCOGVGTUQTEQP°TOVJGVCUM
A B G
A Task type header: This header area shows you the kind of task represented.
B Saved task name: When you save a task, you name it for your own use.
C 6CUMEQP°IWTCVKQPCTGC6JKUCTGCKUFKÒGTGPVHQTGXGT[VCUM+V¨UYJGTG[QWUGVQRGTCVKPI
parameters for the task to be performed.
E Schedule task button: When you click this button in a task dialog, you can set a time
to perform the task as well as repeat the task. For more information, see “Working with
Scheduled Tasks” on page 167.
F Save task button: When you click this button in a task dialog, you can name and save the
VCUMCUEQP°IWTGF5CXGFVCUMUCRRGCTKPVJGNGHVUKFGQHVJG4GOQVG&GUMVQROCKPYKPFQY
A B C D E F G H I
B Share mouse control: When this button is selected, you share mouse control with the user.
C Fit screen in window: When this button is selected, the remote client is scaled to the
Control window size.
D Lock computer screen for control: When this button is selected, the remote client screen
shows a lock, but you can view the client desktop normally.
F Fit screen to full display: When this button is selected, your display doesn’t show your
computer desktop, only that of the remote computer, at full possible resolution.
G Get clipboard from client: When this button is clicked, the contents of the remote client
Clipboard are transferred to the local Clipboard.
H Send clipboard to the client: When clicked, the remote client Clipboard receives the
contents of the local Clipboard.
I Image Quality: Adjusts the screen color depth from black and white to millions of colors.
J Desktop of Controlled Computer: Resize this window from the lower right corner.
H A B C I
D
E
A Page Delay: Adjusts the number of seconds before automatically advancing to the next
page of screens.
B Computers Per Page: Adjusts the number of client screens visible on each page.
C Image Quality: Adjusts the screen color depth from black and white to millions of colors.
D Display Computer Information: Shows the computer information area, which contains
desktop titles, account pictures, and status icons.
E Computer title selector: Changes the titles displayed underneath the client screens (you can
choose the computer name, IP address, or hostname).
F Account picture: Shows the login icon of the currently logged in user.
G Computer status: Shows basic computer status beneath each client screen.
J Observed computers: Contains the scaled desktops of the observed client computers.
C B A
C B D E F
B 5CXGTGRQTVVQ°NG5CXGUVJGTGRQTVVQCRNCKPVGZV°NG
D Open selected: Opens the item selected in the report. The item opens on the client computer.
E Delete selected: Deletes the item selected in the report from the remote computer.
You can resize or rearrange the columns of a report, as well as sort the rows by column.
6QEJCPIGYJCVKPHQTOCVKQPKUFKURNC[GFHQT°NGUGCTEJGU
1 Choose Report > File Search.
2 In the File Search report window, select or deselect each report column as desired.
Treating all windows as possible computer selection lists for tasks may save you lots
of time switching between the Remote Desktop window and other windows as you
accomplish your work.
&TCICPFFTQRYQTMUQPEQP°IWTCVKQPCPFKPVGTCEVKQPFKCNQIU
+HCEQP°IWTCVKQPQTKPVGTCEVKQPFKCNQIJCUCNKUVQHEQORWVGTU[QWECPFTCIEQORWVGTU
QPVQVJGNKUVVQCFFEQORWVGTU&TCIIKPICPFFTQRRKPICNUQYQTMUHQT°NGUQTQVJGT
KVGOU(QTGZCORNGVJG%QR[+VGOUFKCNQICEEGRVUFTCIIGF°NGUVQEQR[YKVJQWV
JCXKPIVQDTQYUGVJG°NGU[UVGOHQTVJGO5CXG[QWTUGNHVKOGCPFGÒQTVD[FTCIIKPI
available items to dialogs rather than browsing for them.
This chapter describes how to install Apple Remote Desktop for system administration
and user interaction and gives complete setup instructions. You can learn about:
42
Network Requirements
Ethernet (recommended), AirPort, FireWire, or other network connection
For more information, see “Setting Up the Network” on page 80.
If a client computer uses an older version of the Apple Remote Desktop client,
you must perform an upgrade installation, even if you’re setting up the client for
VJG°TUVVKOG
If the Apple Remote Desktop client software was removed from the computer, you
can install a fresh copy of the most recent client software by installing Apple Remote
Desktop manually.
+H[QW¨TGUGVVKPIWR/CE15:5GTXGTHQTVJG°TUVVKOGWUKPI5GTXGT5GVWR#UUKUVCPV
you can enable Apple Remote Desktop as one of the initial services. This allows you to
administer a server immediately after server software installation by providing Remote
Desktop with the user name and password of the default system administrator.
After installing the client, enable remote management in the Sharing pane of
System Preferences.
Be sure to transfer your lists from older versions of Apple Remote Desktop to the
new computer before upgrading to Apple Remote Desktop 3. If you upgrade from
version 2.2 to version 3.4 on the same administrator computer, this list migration is
done for you.
You can upgrade Apple Remote Desktop v2.x computers only if they meet the
minimum system requirements (see “System Requirements for Apple Remote
Desktop” on page 42). There’s no supported “downgrade” to any previous version, and
if you upgrade the client computers to version 3.4, you won’t be able to administer
them with earlier versions of Remote Desktop.
The two methods for upgrading the client computer’s software are described below.
Manual Installation
This method works best if you have never enabled Apple Remote Desktop on your
clients and have an existing software distribution infrastructure. This method also
RTQXKFGUVJGITGCVGUVRQYGTCPFEQP°IWTCVKQP±GZKDKNKV[+H[QWFQP¨VYCPV#RRNG
Remote Desktop to upgrade your clients using the Upgrade Client Software feature,
you can perform a manual upgrade.
The custom installer not only installs the needed software but also prepares and
EQP°IWTGUVJGENKGPVEQORWVGTHQTCFOKPKUVTCVKQPCPFECPDGEQP°IWTGFVQCFFQT
edit user names and passwords for Apple Remote Desktop authentication.
WARNING: Custom installation packages that create user names contain sensitive
password data. Take care to store such custom installers securely.
You still need to use Remote Desktop to create a custom installer package. You also
need the user name and password of a user with system administrator privileges on
the client computer.
While creating a custom installer, you can create new Apple Remote Desktop
administrator user names with passwords, and automatically set Apple Remote
Desktop access privileges and preferences.
6JGHQNNQYKPIKPUVTWEVKQPUCRRN[VQ/CE15:XGTUKQPQTNCVGT+H[QW¨TGGPCDNKPI
TGOQVGOCPCIGOGPVQPGCTNKGTXGTUKQPUQH/CE15:UGG5[UVGO2TGHGTGPEGU*GNRHQT
more information.
;QWOWUVCFF4GOQVG&GUMVQRVQ9QTMITQWR/CPCIGT¨U¥#NYC[UCNNQYVJGUG
applications” list, and make sure that all of its helper applications are allowed.
6JGHQNNQYKPIQRVKQPUOWUVDGGPCDNGFKPVJG9QTMITQWR/CPCIGTNGICE[CRRNKECVKQP
preference settings:
“Allow approved applications to launch non-approved applications”
“Allow UNIX tools to run”
www.apple.com/server/macosx/resources/
WARNING: $GECWUG#RRNG4GOQVG&GUMVQRKURCTVQHVJGFGHCWNV/CE15:
installation, do not remove the Apple Remote Desktop client components.
WARNING: Do not uninstall the client software. Disabling the client software is
UWÓEKGPVVQUVQR#RRNG4GOQVG&GUMVQRU[UVGOCEVKXKV[5GG¥Disabling the Client
Software” on page 51.
53
.KUVKPICNNENKGPVUMPQYPD[VJGVCUMUGTXGTCPFQTICPK\GFKPEQORWVGTITQWRUKPVJG
directory server
Once you have found a potential client, you see the following default information:
If you want to change the default display columns for the scanner, you can choose
View > View Options and select any of the available options (which include Computer
+PHQ(KGNFU'VJGTPGV+&.CDGNCPFQVJGTU
6QCFFCEQORWVGTVQCEQORWVGTNKUV[QW°TUVCWVJGPVKECVGVQVJGEQORWVGT
Authenticated computers are found in the All Computers list in the Remote Desktop
window. You can add a computer to the All Computers list without authenticating, but
can’t administer the client until you provide a valid user name and password.
#NVGTPCVKXGN[[QWECPWUGCVGZV°NGVJCVEQPVCKPU+2CFFTGUUTCPIGU
KPVJKUHQTOCV
¥¦CPFWUGVGZV°NGKORQTVVQ°PFENKGPVU5GG¥Finding Clients
by File Import” on page 56.
6QCFFCURGEK°ECFFTGUUKOOGFKCVGN[VQVJG#NN%QORWVGTUNKUV
1 Select the All Computers list.
2 Choose File > Add by Address.
3 'PVGTVJG+2CFFTGUUQTHWNN[SWCNK°GFFQOCKPPCOG
4 Enter the user name and password.
5 Click the Advanced Options disclosure triangle.
6 If the client computer uses Network Address Translation (NAT), enter the public ports
VJCVCTGOCRRGFVQVJGENKGPVKPVJG4GOQVG/CPCIGOGPV2QTVCPFVJG5ETGGP5JCTKPI
2QTV°GNFU
7 Choose whether to verify the name and password before adding it to the All
Computers list.
8 Click Add.
Alternatively, use the scanner to try an address or domain name and check availability
before attempting to add it to the All Computers list.
6QUGCTEJHQTCURGEK°ECFFTGUU
1 Select a scanner at the left of the Remote Desktop window.
2 Select Network Address.
3 'PVGTVJG+2CFFTGUUQTHWNN[SWCNK°GFFQOCKPPCOGKPVJG#FFTGUU°GNF
4 Click the Refresh button.
If the client responds successfully, it is listed in the Remote Desktop window.
5 Select the desired computers.
6 Drag the selected computers to the All Computers list.
7 Authenticate by providing a user name and password for an Apple Remote Desktop
administrator.
The computer is now in your All Computers list.
6QKORQTVCNKUVQHEQORWVGTUHTQOC°NG
1 Select a scanner at the left of the Remote Desktop window.
2 Select File Import.
3 $TQYUGHQTVJG°NGD[ENKEMKPIVJG1RGP(KNGDWVVQPQTFTCIC°NGKPVQVJGYKPFQY
#NVGTPCVKXGN[[QWECPGPVGTVJG°NG¨URCVJPCOGKPVJG(KNG°GNF
All responding clients are listed in the Remote Desktop window.
4 Select the desired computers.
5 Drag the selected computers to the All Computers list.
6 Authenticate by providing a user name and password for an Apple Remote Desktop
administrator.
The computer is now in your All Computers list.
If you edit attributes for several clients simultaneously, you can edit the login name
and password Apple Remote Desktop uses to authenticate.
To delete a list:
B Select the list and press the Delete key.
In order to use a smart list which populates from any list except the All Computers list,
[QWPGGFVQCFFVJG¥%QORWVGTKUKP.KUV¦ETKVGTKQPCPFURGEKH[VJGUQWTEGNKUV
These instructions only apply when moving Apple Remote Desktop 1.2 computer lists
to a new computer.
Throughout these instructions, the computer with the original lists is the source
computer. The computer that will have Apple Remote Desktop 3 installed is the
target computer.
The recommended access privileges for a client computer depend on how it’s used.
If the computer is used in a public area, such as a computer lab, you may want to
allow administrators full access privileges.
66
If the computer is used by one person, you may not want to give administrators
full access privileges. Also, you may want a user who administers his or her own
computer to take responsibility for creating passwords and setting the access
privileges for the computer.
6JGHQNNQYKPIVCDNGUJQYUVJG4GOQVG/CPCIGOGPVQRVKQPUKPVJG5JCTKPI2TGHGTGPEG
pane and the features of Remote Desktop that they correspond to. For example, if you
YCPVCEGTVCKPCFOKPKUVTCVQTVQDGCDNGVQTGPCOGEQORWVGT°NGUJCTKPIPCOGU[QW
need to grant that administrator the privilege by selecting “Change settings.”
If you allow access to the computer using Apple Remote Desktop, the administrator
can see the client computer in the Computer Status window and include it in Network
Test reports, even if no other options are selected.
Note: You can skip this task if you create a custom installer that automatically enables
your desired client settings.
To make changes on a client computer, you must have the name and password of a
user with administrator privileges on the computer.
(QTKPHQTOCVKQPCDQWVRTGRCTKPICENKGPVTWPPKPI/CE15:XUGG¥Setting Apple
4GOQVG&GUMVQR#FOKPKUVTCVQT#EEGUU#WVJQTK\CVKQPCPF2TKXKNGIGU7UKPI.QECN
#EEQWPVUKP/CE15:X” on page 69.
Note: You can skip this task if you create a custom installer that automatically enables
your desired client settings.
To make changes on a client computer, you must have the name and password of
a user with administrator privileges on the computer.
(QTKPHQTOCVKQPCDQWVRTGRCTKPICENKGPVTWPPKPI/CE15:XQTNCVGTUGG¥Setting
#RRNG4GOQVG&GUMVQR#FOKPKUVTCVQT#EEGUU#WVJQTK\CVKQPCPF2TKXKNGIGU7UKPI.QECN
#EEQWPVUKP/CE15:X” on page 68.
When Directory Services authorization is enabled on a client, the user name and
password you supply when you authenticate to the computer are checked in the
directory. If the name belongs to one of the Apple Remote Desktop access groups,
you’re granted the access privileges assigned to the group.
+PVJG:/.[QWPCOGCRTKXKNGIGMG[CPFOCMGVJGXCNWGVJGPCOGQHVJGITQWRQT
groups you want to possess the privilege.
7UGVJGUCORNG:/.DGNQYVQOCMG[QWTOCPCIGOGPVMG[FGUKIPCVKQP:/.
4 +P9QTMITQWR/CPCIGTGPCDNGVJG+PURGEVQTD[EJQQUKPI9QTMITQWR/CPCIGT
Preferences, and then selecting “Show ‘All Records’ tab and inspector.”
5 Click Accounts, select the computer or computer group records you want to manage,
and then click Inspector.
6JGHQNNQYKPIKUCUCORNGQHVJG:/.[QWPGGFVQWUGKPQTFGTVQCUUKIPOCPCIGOGPV
RTKXKNGIGUWUKPI/%:MG[U+VCUUKIPUVJGCDQXG¥CTFAKPVGTCEV¦RTKXKNGIGUVQVJGITQWRU
PCOGF¥UQOGAITQWR¦CPF¥UVCÒ¦+VCNUQCUUKIPUVJG¥CTFAOCPCIG¦RTKXKNGIGUVQVJG
ITQWRPCOGF¥UVCÒ¦VJG¥CTFACFOKP¦RTKXKNGIGUVQVJGITQWR¥O[ACFOKPAITQWR¦CPF
NGCXGUPQITQWRYKVJVJG¥CTFATGRQTVU¦RTKXKNGIGUGV*GTG¨UVJG:/.
<?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE plist PUBLIC "-//
Apple Computer//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/
PropertyList-1.0.dtd"> <plist version="1.0"> <dict>
<key>mcx_application_data</key>
<dict>
<key>com.apple.remotedesktop</key>
<dict>
<key>Forced</key>
<array>
<dict>
<key>mcx_preference_settings</key>
<dict>
<key>ard_interact</key>
<array>
<string>some_group</string>
<string>staff</string>
</array>
<key>ard_manage</key>
<array>
6JKUGZCORNGCVVTKDWVGFG°PGUHQWTRTKXKNGIGUCNVJQWIJCP[QHVJGOOC[DGNGHVQWV
(QTOQTGKPHQTOCVKQPCDQWVWUKPI9QTMITQWR/CPCIGTCPF1RGP&KTGEVQT[UGG
9QTMITQWR/CPCIGT*GNRCPF5GTXGT#FOKP*GNR
Method #2 ;QWECPWUGRTGFG°PGFNQECNITQWRUYKVJPCOGUVJCVEQTTGURQPFVQVJG
privilege keys above: com.apple.local.ard_admin, com.apple.local.ard_interact, com.
apple.local.ard_manage, and com.apple.local.ard_reports. The corresponding privileges
are automatically assigned to these specially named groups.
To complete this task, you need to be the Directory Services administrator and have
access to your organization’s users and groups server.
WARNING: Granting access to control a screen is the most powerful feature in Apple
Remote Desktop, and can be equivalent to unrestricted access.
Changing Remote Desktop admin settings is no substitute for enabling proper access
privileges in the Sharing pane of System Preferences on the client computer. For more
information, see “Apple Remote Desktop Administrator Access” on page 66.
This password doesn’t necessarily correspond to any other password on the system,
CPFKUFGVGTOKPGFD[VJG80%EQP°IWTCVKQP
VNC access is similar to the Control command in Apple Remote Desktop. It lets you use
your keyboard and mouse to control a VNC server across a network. It doesn’t give any
other Apple Remote Desktop administrator privileges, except those of the currently
logged-in user.
Non-Apple VNC viewers can control Apple Remote Desktop clients if the clients allow
it. Allowing a non-Apple VNC viewer access to an Apple Remote Desktop client is
less secure than using Apple Remote Desktop to control the client. The VNC protocol
implemented in third-party VNC viewers may not encrypt keystrokes sent over the
network, so sensitive information can be intercepted.
WARNING: Granting VNC access to control a screen is the most powerful feature in
Apple Remote Desktop, and can be equivalent to unrestricted access.
WARNING: Do not use the same password as any local user or Apple Remote
Desktop login.
You can use SSH to access a client using a user account created for Apple Remote
Desktop, but you’re limited to performing whatever tasks were allowed to that user
YJGPVJGCEEQWPVYCUETGCVGF%QPXGTUGN[QPN[VJGWUGTUURGEK°GFKPVJG#RRNG
Remote Desktop access privileges can access a computer using Apple Remote
Desktop. Apple Remote Desktop privileges are completely separate and distinct from
local computer administrator UNIX privileges.
The report is a list of the Apple Remote Desktop administrator access types each with
CP¥1P¦QT¥1Ò¦VQKPFKECVGYJGVJGTVJCVCEEGUUV[RGKUCXCKNCDNGVQ[QW
To make changes on a client, you must have the name and password of a user with
administrator privileges on the computer. You must also have the Control privilege.
Note: You don’t have to make a selection on every page of the assistant. You can click
Continue to move to the next set of settings.
80
Networks with switches have fewer collisions and packet errors than networks
with hubs. This means greater reliability and speed. Consider using switches
instead of hubs.
Organize computers you’re administering using Apple Remote Desktop into small
groups, and close the Remote Desktop administrator application when not in use.
6JKUJGNRUTGFWEGVJGPWODGTQHUVCVWUSWGTKGUVJWUTGFWEKPIPGVYQTMVTCÓE
If a client has a slow network type, consider running it in a list separate from the
faster clients. A single slow client can slow down network operations.
+HPGVYQTMVTCÓERCUUGUVJTQWIJ°TGYCNNUOCMGUWTG[QWJCXGCNCTIG/CZKOWO
6TCPUOKUUKQP7PKV
/67UGVVKPI
QTITGCVGT6QQUOCNNCP/67UGVVKPIECP
result in black screens when sharing or sending screens.
+H[QW¨TGWUKPICYKFGCTGCPGVYQTM
9#0QTOGVTQRQNKVCPCTGCPGVYQTM
/#0
OCMGUWTGVJCVVJGFGHTCIDKVKUVWTPGFQÒKP[QWTTQWVGTUQRCEMGVUFQP¨VIGV
chunked up. This can result in black screens when sharing or sending screens.
0GVYQTM#FFTGUU6TCPUNCVKQP
0#6PGVYQTMU
UWEJCUVJQUGVJCVWUGVJG/CE15:
+PVGTPGV5JCTKPIHGCVWTGTGSWKTGURGEKCNEQP°IWTCVKQP
If you want to use Remote Desktop to access a task server behind the NAT router, set
TCP and UDP port forwarding for ports 3283 and 5900 for your task server. On your
NAT router, forward unique TCP and UDP ports to all computers behind the NAT router
that you’ll access using Remote Desktop. In the example below, TCP and UDP ports
3284 and 5901 are forwarded to the client computer at 192.168.0.1.
NAT router
222.123.123.1
Client computer
192.168.0.1
Requested ports: Translates to:
3283 / 5900
222.123.123.1 192.168.0.1
3284 / 5901 3283 / 5900
222.123.123.1 192.168.0.2
3285 / 5902 3283 / 5900
Task server
192.168.0.3
3283 / 5900
To get the best performance from Apple Remote Desktop with computers in an
AirPort wireless network:
/CMGUWTGVJCVCNN#KT2QTV$CUG5VCVKQPUCPFCNN#RRNG4GOQVG&GUMVQRENKGPV
computers have the latest versions of Apple Remote Desktop software, AirPort
UQHVYCTGCPF/CE15:UQHVYCTGKPUVCNNGF
.KOKVVJGPWODGTQHENKGPVUVJCVEQPPGEVVQCP#KT2QTV$CUG5VCVKQP#KT2QTVENKGPVU
on a base station receive all network communication packets sent to any one client
on that base station. Although clients ignore packets that aren’t addressed to them,
CPU resources are used to identify and discard the packet.
Scale the Control and Observe window. Apple Remote Desktop has server-side
UECNKPIVJCVFGETGCUGUVTCÓECETQUUVJGPGVYQTMCU[QWUECNGVJGYKPFQYVQ
smaller sizes.
Maintaining Security
Remote Desktop can be a powerful tool for teaching, demonstrating, and performing
maintenance tasks. For convenience, the administrator name and password used
to access Remote Desktop can be stored in a keychain or can be required to be
typed each time you open the application. However, the administrator name and
password for each client computer are stored in the administrator’s preferences and
are strongly encrypted.
With Remote Desktop 3, keystrokes and mouse events are encrypted when you control
/CE15:ENKGPVEQORWVGTU#NNVCUMU¤GZEGRV%QPVTQNCPF1DUGTXGUETGGPFCVCCPF
°NGUEQRKGFWUKPI%QR[+VGOUCPF+PUVCNN2CEMCIGU¤CTGGPET[RVGFHQTVTCPUKV
[QWECP
encrypt these as well, by changing your application preferences). This information is
encrypted using the Advanced Encryption Standard (AES) with the 128-bit shared key
that was derived during authentication.
WARNING: If you’re using Apple Remote Desktop to manage computers over public
networks, consider using a virtual private network (VPN) solution to protect your
information.
If you’re trying to control a VNC server that isn’t Remote Desktop, it won’t support
Remote Desktop keystroke encryption. If you try to control that VNC server, you’ll get a
warning that the keystrokes aren’t encrypted, which you’ll have to acknowledge before
you can control the VNC server. If you chose to encrypt all network data, then you
won’t able to control the VNC server because Remote Desktop isn’t able to open the
necessary SSH tunnel to the VNC server.
6QGPET[RVKPFKXKFWCN°NGEQR[KPICPFRCEMCIGKPUVCNNCVKQPVCUMU
B +PVJG%QR[+VGOUVCUMQT+PUVCNN2CEMCIGUVCUMEQP°IWTCVKQPYKPFQYUGNGEV¥'PET[RV
network data.”
6QUGVCFGHCWNVGPET[RVKQPRTGHGTGPEGHQT°NGEQRKGU
1 In the Remote Desktop Preferences window, select the Security pane.
2 Check “Encrypt network data when using Copy Items” or “Encrypt network data when
using Install Packages,” as desired.
#NVGTPCVKXGN[[QWEQWNFGPET[RVC°NGCTEJKXGDGHQTGEQR[KPIKV6JGGPET[RVGFCTEJKXG
could be intercepted, but it would be unreadable.
Controlling
With Apple Remote Desktop you control remote computers as if you were sitting
in front of them. There are two kinds of remote computers that Apple Remote
Desktop can control: Apple Remote Desktop clients and Virtual Network Computing
(VNC) servers.
87
You can control the keyboard and mouse of only one computer at a time.
#NUQURGEKCNMG[UKPENWFKPIVJGUQWPFXQNWOGUETGGPDTKIJVPGUUCPF/GFKC'LGEVMG[U
FQP¨VCÒGEVVJGENKGPVEQORWVGT
These instructions assume that the observed computer has Apple Remote Desktop
KPUVCNNGFCPFEQP°IWTGFRTQRGTN[CPFVJCVVJGEQORWVGTJCUDGGPCFFGFVQCP#RRNG
Remote Desktop computer list. For information, see “Setting Up an Apple Remote
Desktop Client Computer for the First Time” on page 44 and “Finding and Adding
%NKGPVUVQ#RRNG4GOQVG&GUMVQR%QORWVGT.KUVU” on page 53.
6QUYKVEJKPCYKPFQYEQPVTQNDGVYGGPHWNNUK\GCPF°VVQYKPFQYOQFGU
1 Control a client computer.
2 Click the Fit Screen to Full Display button in the control window toolbar.
6JKUDWVVQPJCUPQGÒGEVYJKNGEQPVTQNNKPI80%UGTXGTU(QTOQTGKPHQTOCVKQP
see “Controlling VNC Servers” on page 91.
+PHWNNUETGGPOQFGVJGENKGPVEQORWVGTUETGGPKUUECNGFWRVQEQORNGVGN[°NNVJG
administrator screen. In addition to the client screen, there are a number of Apple
Remote Desktop controls still visible overlaying the client screen.
+PKPCYKPFQYOQFG[QWECPUYKVEJDGVYGGP°VVKPIVJGENKGPVUETGGPKPVJGYKPFQY
or showing it actual size, possibly scrolling around the window to see the entire client
screen. For more information, see “Switching the Control Window Between Full Size
And Fit-To-Window” on page 89.
The keyboard shortcuts for Copy, Cut, and Paste are always passed through to the
client computer.
If you try to control a VNC server that isn’t Remote Desktop, it won’t support Remote
Desktop keystroke encryption. If you try to control that VNC server, you’ll get a warning
that the keystrokes aren’t encrypted, which you’ll to acknowledge before you can
control the VNC server. If you chose to encrypt all network data, then you won’t able to
control the VNC server because Remote Desktop isn’t able to open the necessary SSH
tunnel to the VNC server. For more information, see “Encrypting Observe and Control
Network Data” on page 85.
These instructions assume the observed computer has been added to an Apple
Remote Desktop computer list (see “Finding and Adding Clients to Apple Remote
&GUMVQR%QORWVGT.KUVU” on page 53). When adding a VNC server to an Apple
Remote Desktop computer list, you only need to provide the VNC password, with
no user name.
%QP°IWTKPICP#RRNG4GOQVG&GUMVQR%NKGPVVQDG%QPVTQNNGFD[C
VNC Viewer
;QWECPEQP°IWTGCP#RRNG4GOQVG&GUMVQRENKGPVVQDGEQPVTQNNGFYKVJCPQP£#RRNG
VNC viewer.
Allowing a non–Apple VNC viewer access to an Apple Remote Desktop client is less
secure than using Remote Desktop to control the client. The non–Apple VNC software
expects the password to be stored in a cryptographically unsecured form and location.
6QEQP°IWTGCENKGPVVQCEEGRV80%EQPPGEVKQPU
1 On the client computer, open System Preferences.
2 %NKEM5JCTKPIUGNGEV4GOQVG/CPCIGOGPVCPFVJGPENKEM%QORWVGT5GVVKPIU
+HVJGENKGPVEQORWVGTKUTWPPKPI/CE15:XGTUKQPQTGCTNKGTEQP°IWTG80%D[
selecting Apple Remote Desktop in the Sharing pane and clicking Access Privileges.
3 Select “VNC viewers may control screen with the password.”
4 Enter a VNC password.
5 Click OK.
WARNING: Do not use the same password as any user or Apple Remote Desktop
administrator. The password may not be secure.
Observing
You may not want to control a computer, but merely monitor what is on its screen.
Observing a remote computer is similar to controlling one, except your mouse
movements and keyboard input aren’t sent to the remote computer. Apple Remote
Desktop client computers can be observed on any administrator computer that has
the “Observe” permission set. For more information about Apple Remote Desktop
permissions, see “Apple Remote Desktop Administrator Access” on page 66.
+H[QW¨TGQDUGTXKPIOQTGENKGPVUVJCP[QW¨XGEJQUGPVQ°VQPQPGUETGGP[QWECPE[ENG
through multiple pages by clicking the Previous or Next button.
Cycle Pages: Use these buttons to manually switch to the previous or next page
of screens.
The computer information area is reenabled when the sizes are returned to more than
the image size threshhold.
These settings become visible when you click View Options in the toolbar.
Setting 'ÒGEV
Page Delay Drag the slider to adjust the number of seconds
before automatically advancing to the next page
of screens.
Computers Per Page Drag the slider to adjust the number of client
screens visible on each page.
Image Quality Drag the slider to adjust the screen color depth
from black and white to millions of colors.
If you’re observing a computer with Apple
Remote Desktop client version 3.2 or later
installed, drag the slider to the second notch
from the right to use the Adaptive Quality Codec.
This codec improves screen sharing performance
QXGTUNQYGTPGVYQTMEQPPGEVKQPUNKMG&5.
Display Computer Information Select this to display computer information
below every observed desktop. To use any of the
following settings, this setting must be selected.
Title Choose the titles of the displayed screens in the
computer information area. You can choose from:
Name (computer name)
IP Address
Hostname
The user’s account picture is their system login icon, so it might be either a picture
taken from an iSight camera, or a custom image selected in the Accounts pane of
System Preferences.
There are two levels of detail for system statistics. The top level is a single icon (a red,
yellow, or green icon).
Icon Indicates
or One or more service statistics is red. This takes precedence over
any yellow or green indicator.
or One or more service statistics is yellow. This takes precedence over
any green indicator.
Service is operating within established parameters.
No service information available.
You show the second level of detail by placing the mouse pointer over the high-level
status icon. The icon changes to an “i” and you can click the “i” to get more information.
Clicking the icon exposes per-service status icons:
No status information is
available
DIsk Usage Usage is at 90% or less
No status information is
available
If a client has a screen saver running when you start observing, the screen saver
TGOCKPUKPGÒGEV
The screens cycles through the entire list of selected computers, a few at a time,
switching every 30 seconds, altered by the speed setting.
Interactive Chat
You can start an interactive text chat with the user of an Apple Remote Desktop
client computer. This allows instant feedback from users, so you can collaborate
or troubleshoot.
Sharing Screens
Apple Remote Desktop lets you show your screen (or the screen of a client computer
in your list) to any or all Apple Remote Desktop client computers in the same
computer list. You can, for example, show a presentation to a classroom of computers
from a single computer.
You can select a task in the History list to see some information about it, and double-
click it to view a more detailed description of the task, as well as the computers
involved with it. Tasks in progress appear in the Active Tasks list, where you can stop
and restart them.
104
Remote Desktop keeps track of active and completed tasks. Active tasks may run
locally or be delegated to run on your task server. Active tasks are those which are
currently being processed by the client computers, and the client computers haven’t
all reported back to the administrator console. Some tasks are so short that they only
DTKG±[CRRGCTKPVJGNKUVQHEWTTGPVVCUMUQVJGTVCUMUOC[VCMGCNQPIVKOGCPFTGOCKP
there long enough to return to the task and view the progress as it happens. The
Active Tasks list, which shows only locally run active tasks, is located in the left side of
the Remote Desktop window, and has a disclosure triangle to expand or hide the list.
Task Server tasks are those which have been assigned to the task server (either the
one running on the administrator’s computer, or a remote one) which haven’t yet
completed for all the task participants.
Completed tasks are those that have received a task status for all participating client
computers. Upon completion, the task entry list then moves to the History list. The
History list is located in the left side of the Remote Desktop window, and has a
disclosure triangle for expanding or hiding the list.
+PCFFKVKQPVQVJGVCUMUVCVWUCPFPQVK°ECVKQPHGCVWTGUQH4GOQVG&GUMVQR[QWECPUGV
CVCUMPQVK°ECVKQPUJGNNUETKRVVQTWPYJGPCP[VCUMJCUEQORNGVGF6JKUUETKRVKUHQTCNN
tasks, but it can be as complex as your needs require.
'PCDNKPIC6CUM0QVK°ECVKQP5ETKRV
When a task completes, Remote Desktop can run a script that you create. This script
KUHQTCNNEQORNGVGFVCUMUCPFKVOWUVDGCUJGNNUETKRV6JGTGKUCFGHCWNVPQVK°ECVKQP
script provided, which you can customize for your needs. The script must be a shell
script, but you can use various other scripting environment like AppleScript with the
osascript command.
6QGPCDNGCVCUMPQVK°ECVKQPUETKRV
1 /CMGUWTG[QW¨TGNQIIGFKPCUCPCFOKPKUVTCVQTWUGT
2 Open Remote Desktop.
3 Choose Remote Desktop > Preferences.
4 Click the Tasks button.
5 5GNGEV¥'PCDNGVCUMPQVK°ECVKQPUETKRV¦
6 Choose the location of the script.
6JGFGHCWNVPQVK°ECVKQPUETKRVKUNQECVGFCV.KDTCT[#RRNKECVKQP5WRRQTV#RRNG4GOQVG
Desktop/Notify.
7 Close the Preferences window.
Tasks in progress appear in the Active Tasks list, where you can stop them, or run
them again.
Saved tasks appear in a list on the left side of the Remote Desktop main window.
You’re free to make as many templates as you want either from existing templates
or from scratch. Once saved, a template can be made the task’s default, with all new
instances of the task opening with the default template settings. You can also edit
the task template list from the Template pop-up list, removing a template, or making
it the task default. There are existing, built-in templates for the Send UNIX Command
task, which can not be removed. For more information, see “Send UNIX Command
Templates” on page 152.
Note: Templates are only stored for their own task type. For example, Copy Items
saved templates aren’t available for use with Rename Computer tasks, etc.
You can delegate the handling of an installation package task to your Task Server
rather than from your local Remote Desktop application. This lets you install packages
QPEQORWVGTUVJCVCTGP¨VEQPPGEVGFVQVJGPGVYQTM
YKVJCEWTTGPVUVCVWUQH¥1ÔKPG¦
when you run the task. The Task Server monitors the network for the next time the
QÔKPGENKGPVEQOGUQPNKPGCICKP6JGPVJG6CUM5GTXGTRGTHQTOUVJGKPUVCNNCVKQP
For more information about designating a Task Server, see “Using a Task Server for
Report Data Collection” on page 121 and “Setting Up the Task Server” on page 163.
For information about installing with the Task Server, see “+PUVCNNKPI5QHVYCTGQP1ÔKPG
Computers” on page 111.
It isn’t possible to stop the installation of a package. Once the installation starts, it will
complete (assuming no errors occur on the client). However, you can click the Stop
button to stop remaining packages from being copied over, and thereby halt the
installation.
#NVGTPCVKXGN[CPCFOKPKUVTCVQTECPWUGVJG2CEMCIG/CMGTCRRNKECVKQP
CXCKNCDNG
on the Apple Remote Desktop CD or with the Apple Developer Tools) to create
a metapackage that contains several installers to be run in sequence. In addition
VQETGCVKPIOGVCRCEMCIGU[QWECPCNUQWUG2CEMCIG/CMGTVQETGCVGRCEMCIGUHQT
EWUVQOUQHVYCTGVJCV[QWTQTICPK\CVKQPOC[JCXGFGXGNQRGF/QTGKPHQTOCVKQPCDQWV
making and using packages and metapackages is available on the Apple Developer
Connection website at:
developer.apple.com
6QEQR[CPFKPUVCNNUQHVYCTGWUKPICRMI°NG
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 %JQQUG+PVGTCEV .QEM5ETGGPCPFVJGPENKEM.QEM5ETGGP
By locking the screen, you prevent the package installation interface from appearing
on the controlled computer’s screen during installation.
4 %JQQUG/CPCIG +PUVCNN2CEMCIGU
5 5GNGEVCRMIQTORMI°NGVQKPUVCNN
Alternatively, you can drag an installer package on to the package list window.
6 Select whether to restart the target computers after installation.
If you select “Attempt restart, allow users to save documents,” users can allow or cancel
restart after installation.
7 Select the option to run the task from “This application.”
During installation, a progress bar appears in the task header in the main window. No
progress bars appear on the client computer. The copied package is deleted from the
client computer if an error occurs during installation. However, a failed installation may
NGCXGDGJKPFQVJGT°NGUETGCVGFD[VJGKPUVCNNGT
+PUVCNNKPI5QHVYCTGQP1ÔKPG%QORWVGTU
Using Apple Remote Desktop, you can install software on a computer that isn’t
EWTTGPVN[EQPPGEVGFVQVJGPGVYQTM
YKVJCUVCVWUQH¥1ÔKPG¦6JKUKUTGHGTTGFVQCU
#WVQ+PUVCNN6JGKPUVCNNCVKQPFQGUP¨VQEEWTYJGPKPKVKCNN[QTFGTGFDWVYJGPVJGQÔKPG
computer next becomes available. The installation itself is handled by a designated
6CUM5GTXGT6JGKPUVCNNCVKQPWUGUWPKECUVPGVYQTMVTCÓE
KPENKGPVITQWRUQHKPUVGCF
QHVJGOWNVKECUVVTCÓEWUGFYJGPVJG4GOQVG&GUMVQRCRRNKECVKQPRGTHQTOUVJG
installation.
4GOQVG&GUMVQR°TUVEQRKGUVJGKPUVCNNCVKQPRCEMCIGVQVJG6CUM5GTXGTCPFIKXGU
the Task Server the necessary instructions to install the package to all the selected
EQORWVGTUGXGPKHUQOGQHVJGOCTGQÔKPG6JG6CUM5GTXGTOQPKVQTUVJGPGVYQTMHQT
VJGPGZVVKOGVJGQÔKPGENKGPVEQOGUQPNKPGCICKP9JGPVJGENKGPVEQOGUQPNKPGKV
EQPVCEVUVJG6CUM5GTXGTCPFPQVK°GUKVQHKVUPGVYQTMUVCVGCPFCP[UGVVKPIEJCPIGU
(like a DHCP-assigned IP address change). The Task Server then begins the installation.
+HCENKGPVIQGUQÔKPGFWTKPI#WVQ+PUVCNNVJGKPUVCNNCVKQPHCKNUCPFTGUVCTVUHTQOVJG
beginning when the client comes back online.
For information about setting up and using a Task Server, see “Working with the Task
Server” on page 162.
6QKPUVCNNUQHVYCTGQPQÔKPGENKGPVU
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
#P[QTCNNOC[DGQÔKPG
3 %JQQUG/CPCIG +PUVCNN2CEMCIGU
4 5GNGEVCRMIQTORMI°NGVQKPUVCNN
Alternatively, you can drag an installer package into the Packages list.
5 Choose whether to run the task from the Task Server designated by Remote Desktop
preferences.
6 Select other installation parameters, as desired.
For information about the available options, see “Copy Options” on page 115 and
“Installing Using the Install Packages Command” on page 109.
7 Click Install.
%QR[KPI°NGUYQTMUHCUVGUVYKVJCUOCNNPWODGTQH°NGU(QTGZCORNGVGP°NGUVJCVCTG
-$GCEJIGPGTCNN[VCMGNQPIGTVJCPQPG°NGVJCVKU-$%QPUKFGTEQR[KPICUKPING
°NGCTEJKXG
NKMGC\KRQTUKV°NGVQTGOQVGEQORWVGTUHQTHCUVGTEQR[KPI4GOGODGT
VJCV/CE15:CRRNKECVKQPUCTGDWPFNGUQHOCP[UOCNNGT°NGU#NVJQWIJVJGCRRNKECVKQP
[QWYCPVVQEQR[NQQMUNKMGCUKPING°NGKPVJG(KPFGTKVOC[EQPVCKPJWPFTGFUQTGXGP
VJQWUCPFUQHUOCNNGT°NGU
If a client computer is asleep when you attempt to copy items, Remote Desktop tries
to wake the client. If it can’t wake the client and the copy doesn’t proceed, you should
use Remote Desktop to wake the target computer, and then attempt the copy again.
If you choose to copy out to many client computers simultaneously, Remote Desktop
WUGUPGVYQTMOWNVKECUVUVQUGPFVJG°NGU+HVJGTGKUCUKIPK°ECPVPWODGTQHOWNVKECUV
networking errors, Remote Desktop tries to copy individually to each client computer.
Copy Options
Each time you copy an item to a remote computer, you have the chance to customize
VJGQRGTCVKQPVQCNNQY°PGITCKPGFEQPVTQNQHVJGNQECVKQPCPF°NGQYPGTQHVJGEQRKGF
°NGVJGPGVYQTMDCPFYKFVJWUGFCPFYJCVVQFQKPECUGQHHCKNWTGQTFWRNKECVG°NGU
Encryption
You can encrypt the copy transport stream to protect the data sent across the
network. By selecting the “Encrypt network data” option, you exchange performance
for security. This option is also available in the Install Packages dialog.
;QWECPWUGVJKUHGCVWTGVQEQNNGEVPGGFGF°NGUHTQOTGOQVGEQORWVGTUQTFKUVTKDWVG
°NGUDGVYGGPTGOQVGEQORWVGTU
Alternatively, you can drag items from a control window to the administrator
computer’s desktop.
;QWOC[YCPVVQUVCTVD[ETGCVKPICFKUMKOCIGVJCVEQPVCKPUVJG/CE15:
CRRNKECVKQPUCPFKVGOU[QWYCPVVQEQR[#NVGTPCVKXGN[[QWECPEQR[°NGUHTQOCP[
local disk, such as a hard disk, CD, disk partition, or other disk.
The Copy Items command doesn’t copy system software that is hidden (that is, not
XKUKDNGKPVJG(KPFGT+VECPEQR[VJG#RRNKECVKQPUHQNFGT.KDTCT[HQNFGTCPF7UGTU
folder, as well as any folders at the root of the hard disk that were created by the
computer’s administrator user.
Important: ;QWECPPQVWUGVJG%QR[+VGOUHGCVWTGVQEQR[/CE15:U[UVGOUQHVYCTG
to client computers
6QTGUVQTG°NGUWUKPIVJG%QR[+VGOUEQOOCPF
1 /CMGCOCUVGTEQR[QHVJGXQNWOGVJCVJCUVJG°NGUVQDGTGUVQTGF
You can use any volume, such as a spare hard disk, a CD, or a mounted disk image
FOI°NG
2 /QWPVVJGOCUVGTEQR[XQNWOGQPVJGCFOKPKUVTCVQTEQORWVGT
/CUVGTEQR[XQNWOGUOWUVDGNQECNXQNWOGUPQVOQWPVGFHTQOQXGTCPGVYQTM
3 Open Remote Desktop.
4 Select a computer list in the Remote Desktop window.
5 Select one or more computers in the selected computer list.
6 %JQQUG/CPCIG %QR[+VGOU
7 Add the master copy volume to the Copy Items list.
8 Select your copy options.
For information about available options for copy tasks, see “Copy Options” on page 115.
9 If you want to schedule this event for another time or set it to repeat, click the
Schedule button.
For information about scheduling events, see “Working with Scheduled Tasks”
on page 167.
10 Click Copy.
To collect new, up-to-date, information for a report, the Remote Desktop application
queries a client directly, and waits for the client computer to respond with the desired
information. A new data search gets the most recent information, but takes longer
because the client computer has to gather all the data and send it over the network
to the waiting administrator computer. New data reports are also generated by clients
whose reporting policy is set to send data only in response to a report query.
Remote Desktop can also generate a report using information it has previously cached.
When using cached information, the application queries the Remote Desktop internal
database of collected system information (such as hardware information and system
UGVVKPIU°NGKPHQTOCVKQP
KPENWFKPIKPUVCNNGFCRRNKECVKQPUCPFXGTUKQPUCPFUQHVYCTG
names), or both. You determine what type of report cache data to store and how often
to rebuild this information.
6JGFCVCDCUGYJKEJKUC53.KVGFCVCDCUGNQECVGFCVXCTFD4GOQVG/CPCIGOGPV
4/&$ECPDGCEEGUUGFWUKPIQVJGTVQQNUDGUKFGU4GOQVG&GUMVQR6Q°PFQWVOQTG
about the database schema, see Appendix D, “53.KVG5EJGOC5CORNG,” on page 198.
The third kind of data search is a Spotlight search. This isn’t a static report on saved
data in a database, but it’s an interactive search of the client computers. A Spotlight
UGCTEJECPQPN[DGFQPGQPENKGPVEQORWVGTUTWPPKPI/CE15:QTNCVGT5RQVNKIJV
searches a comprehensive, constantly updated index that sees all the metadata inside
UWRRQTVGF°NGU¤VJG¥YJCVYJGPCPFYJQ¦QHGXGT[RKGEGQHKPHQTOCVKQPUCXGFQP
[QWT/CE¤KPENWFKPIVJGMKPFQHEQPVGPVVJGCWVJQTGFKVJKUVQT[HQTOCVUK\GCPF
OCP[OQTGFGVCKNU5RQVNKIJVUGCTEJGUCTG¥NKXG¦OGCPKPIVJCVVJGYKPFQYTG±GEVU
EJCPIGUKPVJGHQWPF°NGUGXGPCHVGTVJGEQOOCPFKUGZGEWVGF
If you use a single database for a large number of clients, you should stagger the
generation of report caches over the time between which you want to run reports.
For example, if you normally run a report every week, then set 1/7th of your clients
to rebuild caches on day one, another 1/7th for the next day, and so on. Stagger the
cache rebuild over the course of the day as well.
You should keep in a given list the minimum number of computers necessary for
your purposes. When a list is selected, the clients in the list send status updates at a
minimum of every 20 seconds. A large number of clients in a list (for example, 1000)
would result in about 50 updates a second.
Creating more lists doesn’t create more resource overhead for Remote Desktop, and
it lets you quickly and easily administer the clients you want with a minimum wait.
&GRGPFKPIQP[QWTPGVYQTMCPFNKUVUK\GU[QWOC[°PFVJCVUOCNNGTNKUVUTGUWNVKPOQTG
productive and reliable administration.
What Bandwidth Does the Default System Overview Report Use on a LAN?
The average System Overview Report cache is about 20 KB. While reporting, the
administrator and client computers will always try to use all available bandwidth (most
+2DCUGFENKGPVUGTXGTCRRNKECVKQPUYQTMVJKUYC[6JGTGHQTGQPC/DKVUGEPGVYQTM
the report data collection for a single client may use 100% of the bandwidth for 0.016
seconds. Assuming a list of 1000 computers, all trying to report at the same time, this
may use 100% of the bandwidth for 16 seconds. Naturally, faster networks perform
DGVVGTCPFPGVYQTMUYKVJCUNQYDQVVNGPGEMNKMGC&5.QTOQFGONKPGRGTHQTOYQTUG
/WNVKRNGWUGTUNQIIGFKPYKVJ(CUV7UGT5YKVEJKPIECPNGCFVQEQPHWUKPIQTEQP±KEVKPI
reports. When a second or third user logs in to a computer, there is no way of knowing
YJKEJWUGTKUVJGCEVKXGWUGT5GUUKQPNGPIVJOC[PQVTG±GEVCEVWCNWUCIGCPFNQIKP
and logout times overlap.
The Spotlight Search window is similar to the Spotlight Search window found locally
QPCEQORWVGTYKVJ/CE15:XQTNCVGT+VUWRRQTVUOCP[QHVJGUCOGHGCVWTGUCPF
queries as Spotlight on a local computer. For more information about Spotlight search,
see Spotlight Help.
6JGUGCTEJRCTCOGVGTUHQT#RRNG4GOQVG&GUMVQRCTGUNKIJVN[FKÒGTGPVHTQOVJQUG
used by the Finder’s Find command. For example, Apple Remote Desktop doesn’t
search by visibility or by label. The report display can be customized as well. For more
information, see “%JCPIKPI4GRQTV.C[QWV” on page 37.
Comparing Software
Apple Remote Desktop has several specialized reports for comparing software on
client computers with software on the administrator computer. These reports can’t be
run comparing two client computers. One computer in the comparison must be the
administrator computer.
)GPGTCVKPIC5QHVYCTG&KÒGTGPEG4GRQTV
6JG5QHVYCTG&KÒGTGPEGTGRQTVEQORCTGUVJGCRRNKECVKQPUHQPVUCPFKPUVCNNGF
packages of the selected client computers with those on the administrator computer.
The resulting report lists the items compared, their version, location, and whether or
not they were found on the selected client computers.
;QWECPWUGVJKUTGRQTVVQ°PFQWVKH[QWTENKGPVUJCXGVJGCRRNKECVKQPUQTHQPVUVJG[
PGGF%QORCTKPIFKÒGTGPEGUKPKPUVCNNGFRCEMCIGUECPJGNR[QWVTQWDNGUJQQVUQHVYCTG
EQP±KEVUCPFMGGR[QWTENKGPVEQORWVGTUWRVQFCVG
6QIGPGTCVGC5QHVYCTG&KÒGTGPEGTGRQTV
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 %JQQUG4GRQTV 5QHVYCTG&KÒGTGPEG
4 Select the software type you want to compare.
Selecting Applications compares all executable applications. You can limit which folder
on the administrator computer Remote Desktop uses to look for applications.
5GNGEVKPI(QPVUEQORCTGUCNNHQPVUKP.KDTCT[(QPVU5[UVGO.KDTCT[(QPVUCPF
user font directories.
5GNGEVKPI+PUVCNNGF2CEMCIGUEQORCTGUCNNRCEMCIGTGEGKRVUKP.KDTCT[4GEGKRVU
5 To search using new data, select Rebuild data for report.
6 Click Generate Report.
The newly generated report window appears.
Auditing Hardware
You can get a report about the hardware of any client computer. Hardware information
ECPDGCEEGUUGFWUKPICPWODGTQHFKÒGTGPVTGRQTVU#NVJQWIJUQOGDCUKEJCTFYCTG
information can be found in the System Overview report, several more focused
hardware reports provide more detailed information.
To make changes on a client computer, you must have the name and password of a
user with administrator privileges on the computer.
Basic information about hard disk volumes and size can also be found in the storage
section of the System Overview report.
For more information about FireWire Devices report options, see Appendix B, “Report
(KGNF&G°PKVKQPU4GHGTGPEG,” on page 178.
The number of attached FireWire devices can also be found in the Devices section of
System Overview report.
For more information about the USB Devices report options, see Appendix B, “Report
(KGNF&G°PKVKQPU4GHGTGPEG,” on page 178.
Basic information about attached USB devices can also be found in the Devices section
of the System Overview report.
6JG0GVYQTM+PVGTHCEGUTGRQTVECPDGWUGFVQ°PFPGVYQTMGTTQTUQTHCWNV[PGVYQTM
equipment, troubleshoot network performance, and query the network settings of
the client computers.
All statistics are refreshed when the client restarts, and address information may
change if your client uses DHCP to get a network address.
For a complete listing of Network Interfaces report options, see Appendix B, “Report
(KGNF&G°PKVKQPU4GHGTGPEG,” on page 178.
Basic information about network settings can also be found in the Network and
AirPort section of the System Overview report.
/GOQT[TGRQTVUECPDGWUGFHQTOCPCIKPIEQORWVGTTGUQWTEGUJCTFYCTG
troubleshooting, or deciding which client computer can handle a memory-intensive
application or task.
Basic information about system memory can also be found in the Computer section of
the System Overview report.
For more information about the Expansion Cards report options, see Appendix B,
“4GRQTV(KGNF&G°PKVKQPU4GHGTGPEG,” on page 178.
Basic information about a client’s expansion cards is also in the Computer section
of the System Overview report.
You can choose how many network packets to send, how often they are sent, and how
long the administrator computer waits for a reply before listing a packet as lost.
Here are some suggestions for evaluating your network performance based on
this report:
6JGPWODGTQHTQWVGTUDGVYGGP[QWTEQORWVGTCPFCPQVJGTEQORWVGTECPCÒGEV
the time the packets take to return. When you evaluate the times for a computer,
you should compare them to the times for a computer in the same area of the
network or with the same number of intervening routers.
+HVJGOCZKOWOVKOGHQTCRCEMGVVQTGVWTPHTQOCEQORWVGTKUUKIPK°ECPVN[ITGCVGT
than the time for other computers in the same area of the network, there may be a
problem with the computer.
If a single computer has a large number of lost packets, there may be a problem
with the network connection to that computer.
If several computers in the same area of the network have a large number of
lost packets, there may be a network connection problem or a problem with an
intervening router or bridge.
Exported reports can be put into a database, spreadsheet, or word processor for
further analysis or organization, or be sent to another administrator. You could even
WUGEGTVCKPTGRQTVUCUKPRWV°NGUHQTPGVYQTMUECPPGTUHQT4GOQVG&GUMVQR
#NVGTPCVKXGN[[QWEQWNFCEEGUUVJGTGRQTV¨U53.FCVCDCUGFKTGEVN[YKVJ[QWTQYP53.
SWGT[VQQNUQTCRRNKECVKQPU7UKPIUVCPFCTF53.FCVCDCUGSWGTKGU[QWECPIGVCP[QT
all information out of the report database for use with other applications or databases.
To export a report:
1 Generate any report, and bring the report window to the front.
2 If desired, sort the report rows by selecting a new column to sort by.
3 If you don’t want to export the entire report, select the rows to be exported.
4 Choose File > Export Window.
5 0COGVJG°NGCPFEJQQUGCNQECVKQPVQUCXGVQ
6 Select a text encoding.
Deleting Items
+H[QWFGNGVGC°NGHTQOCENKGPVEQORWVGTKVKUOQXGFVQVJGENKGPV¨U6TCUJ
As a part of routine maintenance for client computers, you can free disk space by
emptying the Trash. Emptying the Trash completely removes any items you’ve
previously deleted on the client. You can use the System Overview report to see how
much disk space you can recover by emptying the Trash.
The startup disk must have a valid operating system installed on it. To set the startup
volume on a local hard disk for multiple computers at once, the local volume name
must be the same for all computers.
Alternatively, you can set the startup disk to be a NetBoot volume provided by
/CE15:5GTXGT;QWECPUVCTVWROWNVKRNGENKGPVUHTQOC0GV$QQVUGTXGT
Renaming Computers
#RRNG4GOQVG&GUMVQRECPUGVVJGPCOGVJCVCENKGPVEQORWVGTWUGUHQT°NGUJCTKPI
You can rename multiple computers with the same name followed by a number (such
CU%QORWVGT%QORWVGTCPFUQQP6JKUKUGURGEKCNN[WUGHWNHQTFKÒGTGPVKCVKPIENKGPV
computers after a clean system installation.
6JG4GPCOG%QORWVGTHGCVWTGFQGUP¨VEJCPIGVJG.QECN*QUVPCOGQTVJG&05PCOG
of a client computer.
#NN/CE15:ENKGPVUECPDGUGVVQCWVQOCVKECNN[U[PEJTQPK\GVJGKTENQEMUYKVJCP062
UGTXGT/CE15:5GTXGTECPDGEQP°IWTGFVQCEVCUCP062UGTXGTCUYGNN+PQTFGTVQ
maintain synchronization across your clients, you should choose a single NTP server to
synchronize to. Apple provides an NTP server at time.apple.com.
Setting computer time requires the use of the Apple Remote Desktop Send UNIX
Command feature and its built-in command-line tool systemsetup. For more
information about the tool, see “$WKNVKP%QOOCPF.KPG6QQNU” on page 156.
Setting computer audio volume requires the use of the Apple Remote Desktop Send
UNIX Command feature, AppleScript, and the command-line tool osascript. For more
information, see “UNIX Shell Commands” on page 152. For information about using this
tool, see the AppleScript StandardAdditions dictionary.
4GRCKTKPI°NGRGTOKUUKQPUTGSWKTGUVJGWUGQHVJG#RRNG4GOQVG&GUMVQR5GPF70+:
Command feature, and the command-line tool diskutil. For more information, see
“UNIX Shell Commands” on page 152. For information about using this tool, see the
diskutil man page.
6QTGRCKTCEQORWVGT¨U°NGRGTOKUUKQPU
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 %JQQUG/CPCIG 5GPF70+:%QOOCPF
4 Type or paste the following UNIX command:
diskutil repairPermissions /
5 Set the user permissions for this command to be sent as the user “root.”
6 Click Send.
Note: &QEMOCPCIGOGPVUJQWNFDGFQPGWUKPI9QTMITQWR/CPCIGT+H[QWWUG
/CE15:5GTXGTVQOCPCIGENKGPVUGVVKPIUCPFRTGHGTGPEGUVJGEQTTGEVRNCEGVQ
EJCPIGVJG&QEMKUYKVJKPVJGOCPCIGOGPVUGVVKPIUQH9QTMITQWR/CPCIGT
Changing the Energy Saver preferences requires the use of the Apple Remote
Desktop Send UNIX Command, and its built-in command-line tool systemsetup. For
more detailed information about the systemsetup tool, see “$WKNVKP%QOOCPF.KPG
Tools” on page 156.
Setting the remote login sharing preference requires the use of the Apple Remote
Desktop built-in command-line tool systemsetup. For more information about the
tool, see “$WKNVKP%QOOCPF.KPG6QQNU” on page 156.
Setting the printer preference with Remote Desktop involves using the Copy Items
task. For more information, see “Copying from Administrator to Clients” on page 117.
$GECWUGVJGUG°NGUCTGJKFFGPKPVJG(KPFGT[QWOC[JCXGVQWUGVJG6GTOKPCNQTVJG
Finder’s “Go to Folder” command to add them to the “Items to copy” list.
3 Choose a “Same relative location” as the copy destination.
4 Choose to replace existing items.
5 Click Copy.
6 Restart the client computers’ printer process by restarting the clients.
If you’re comfortable with the command-line, you can use the Remote Desktop Send
70+:%QOOCPFVQEQP°IWTGCNNVJGENKGPVEQORWVGTRTGHGTGPEGUCVQPEG
Setting printer preferences using Send UNIX Command requires the use of the built-in
lpadmin command-line tool. For more information, see the lpadmin man page.
6JG1RGP+VGOUEQOOCPFQRGPU°NGUKPVJGCRRNKECVKQPWUGFVQETGCVGVJGOKHKV
GZKUVUQPVJGENKGPVEQORWVGTQTKPVJGCRRNKECVKQPCUUKIPGFVQQRGP°NGUYKVJVJCV
°NG¨UGZVGPUKQP(QNFGTUQRGPKPVJG(KPFGT#RRNKECVKQPUCTGQRGPGFQTDTQWIJVVQVJG
front, if already open.
To open an item:
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 %JQQUG/CPCIG 1RGP+VGOU
4 Click the Add (+) button and browse for the item on the administrator computer.
Alternatively, drag the item from the administrator computer’s Finder to the Open
Items dialog.
Opening Applications
Apple Remote Desktop can open applications on client computers. The application
to open must be on the administrator computer, in addition to being on client
computers. If the application is already open, the Open Application command brings it
VQVJGHTQPV;QWECPQRGPDQVJ/CE15:CPF%NCUUKECRRNKECVKQPUYKVJVJKUEQOOCPF
The application on the administrator computer must have the same name as the one
to be opened on the client computer.
To open an application:
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 %JQQUG/CPCIG 1RGP#RRNKECVKQP
The Open Application dialog shows the applications installed and found in the
Applications folder at the top level of the hard disk of the administrator’s computer.
4 5GNGEVVJGCRRNKECVKQPQTENKEMVJG#FF
DWVVQPCPFDTQYUGVQ°PFVJGFGUKTGF
application on the administrator computer.
Alternatively, drag the item from the administrator computer’s Finder to the Open
Application dialog.
The Open Application dialog shows the icon and name of the application to open.
5 Click Open.
For more information about the killall command, see its man page.
Note: Although you can put to sleep computers that are on other network subnets
besides your own, or connected through AirPort, you won’t be able to wake them
using Remote Desktop unless there’s a Bonjour sleep proxy running on the other
network subnets.
Waking Up a Computer
Apple Remote Desktop can wake computers from sleep. To wake a computer using
Remote Desktop, the computer’s networking hardware must support waking by using a
network packet (wakeonlan), and the computer must have “Wake For Ethernet Network
Administrator Access” enabled in the Wake Options of Energy Saver preferences.
To wake a computer:
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers from the list with a current status of “Sleeping,”
QT¥1ÔKPG¦
3 %JQQUG/CPCIG 9CMG
4 Click Wake.
You can continue to work with computers using Remote Desktop after you’ve locked
their screens.
6JKUHGCVWTGYQTMUQPN[QPENKGPVEQORWVGTUYKVJ/CE15:XQTNCVGT
WARNING: Don’t log out a user or use fast user switching while using curtain mode.
These actions prevent further remote access to the computer and require the
computer to be restarted.
To log in a user:
This method uses the osascript command. For information about osascript, see the
osascript man page.
Restarting a Computer
Apple Remote Desktop can restart a client computer. This has the same result as
choosing the Restart command from the client computer’s Apple menu.
Unless you’re trying to restart a client that supports lights-out management, you
cannot restart a computer that has a current status other than “Available.” Remote
Desktop also uses lights-out management when you force a restart.
To restart a computer:
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 %JQQUG/CPCIG 4GUVCTV
4 Select the type of restart.
;QWECPCNNQYWUGTUVQUCXG°NGUQTECPEGNVJGTGUVCTVQT[QWECPHQTEGCPKOOGFKCVG
TGUVCTVYJKEJECWUGUVJGWUGTUVQNQUGWPUCXGFEJCPIGUKPCP[QRGP°NGU
5 Click Restart.
Unless you’re trying to shut down an client that supports lights-out management, you
cannot shut down a computer that has a status other than “Available.” Remote Desktop
also uses lights-out management when you force a shutdown.
If you shut down an Apple Remote Desktop client that doesn’t support lights-out
management, you can’t start it up using Remote Desktop.
The Shut Down command is especially useful when used with Energy Saver
preferences. You can set your client computers to start up every morning at a
designated time and use Remote Desktop to shut them down at night. The next
morning, they’ll start up and be ready to administer.
Starting Up a Computer
Apple Remote Desktop can start up clients that support lights-out management
.1/7PNKMGYCMKPIWREQORWVGTUVJKUFQGUP¨VTGN[QPVJGYCMGQPNCPPGVYQTM
RCEMGVCPFCNNQYU[QWVQUVCTVEQORWVGTUQPCFKÒGTGPVUWDPGV
$[FGHCWNVCHVGTUGNGEVKPICEQORWVGTNKUVYKVJCVNGCUVQPGENKGPVVJCVUWRRQTVU.1/C
PGYUVCVWUEQNWOPPCOGF¥.1/5VCVWU¦CRRGCTU6JG.1/UVCVWUUJQYUYJKEJQH[QWT
ENKGPVUUWRRQTV.1/CPFKHVJG[¨TGEQP°IWTGFVQCNNQY.1/CFOKPKUVTCVKQP
6JG.1/UVCVWUECPDG
To start up a computer:
1 Select a computer list in the Remote Desktop window.
2 +H[QW¨TGVT[KPIVQUVCTVWRCEQORWVGTYKVJC.1/UVCVWUQH¥#EEGUU&GPKGF¦UGNGEVVJG
computer and choose File > Get Info. In Attributes, click Edit. Enter the administrator’s
PCOGCPFRCUUYQTFHQT.1/CPFENKEM&QPG
$[FGHCWNVVJG.1/CFOKPKUVTCVQT¨UPCOGCPFRCUUYQTFKUVJGUCOGCUVJGQPGWUGF
HQT4GOQVG&GUMVQR/CPCIGOGPV*QYGXGT[QWECPWUGVJG)GV+PHQYKPFQYVQ
EJCPIGVJG.1/CFOKPKUVTCVQT¨UPCOGCPFRCUUYQTF
3 5GNGEVQPGQTOQTGEQORWVGTUHTQOVJGNKUVYKVJCEWTTGPVUVCVWUQH¥2QYGTGF1Ò¦
4 %JQQUG/CPCIG 2QYGT1P
5 Click Power On.
You’re free to make as many templates as your want, either from existing templates
or from scratch. Once saved, a template can be made the task’s default, with all new
instances of the task opening with the default template settings.
For more information about Task Templates, see “Creating and Using Task
Templates” on page 107.
6JGUGEQPFMKPFQHUETKRV[QWECPGZGEWVGCPFVJGOQUVEQOOQPKPVJG/CE15:
GPXKTQPOGPVKUCP#RRNG5ETKRVUETKRV6JGUGCTG°NGUVJCVEQPVCKP'PINKUJNKMG
commands, using the AppleScript programming language and they are created using
the Script Editor application.
Running a UNIX command as the current user fails if the target computer is at the
login window, because there’s no current user. You can use root user for tasks by
GPVGTKPITQQVKPVJGURGEK°GFWUGT°GNFQHVJGVCUMFKCNQI;QWFQP¨VCEVWCNN[PGGFVQ
have the root account enabled on the client computer to specify the root user. You
should never use sudo or su to do tasks as the root user. They are interactive and
expect further input and response from your script. Instead, run your script as root or
as another user with root privileges.
To learn more about AppleScript, see AppleScript Help in Help Viewer or go to:
www.apple.com/applescript/
Alternatively, you could use a UNIX “read standard input” redirection which looks like:
osascript <<EndOfMyScript
...insert script here...
EndOfMyScript
For example, a simple script to create a folder and set its label would be entered as:
osascript <<EndOfMyScript
tell the application "Finder"
make new folder
set the name of the result to "New Folder"
set the label index of folder "New Folder" to 2
end tell
EndOfMyScript
5 Click Send.
The client computer executes the script.
The locations of two of the tools (networksetup and systemsetup) are added to the
default shell PATH, so you can access them through Remote Desktop as if they were
installed in one of the standard UNIX tool locations.
The kickstart tool isn’t in the default shell path. It must be activated explicitly at its
location:
/System/Library/CoreServices/RemoteManagement/ARDAgent.app/Contents/
Resources/kickstart
-listallnetworkservices
Displays a list of all the network services on the server’s hardware ports. An asterisk (*) indicates that
a network service is disabled.
-setbootp networkservice
7UGVJKUEQOOCPFVQUGVVJG6%2+2EQP°IWTCVKQPHQTVJGURGEK°GFPGVYQTMUGTXKEGVQWUG$1162
networksetup -setbootp "Built-in Ethernet"
-setmanualwithdhcprouter networkservice ip
7UGVJKUEQOOCPFVQURGEKH[COCPWCN+2CFFTGUUVQWUGHQT&*%2HQTVJGURGEK°GFPGVYQTMUGTXKEG
Example:
networksetup -setmanualwithdhcprouter "Built-in Ethernet" 192.168.100.120
-help
Displays a list of all the commands available in the Network Setup Tool, with explanatory information.
Any command that uses networksetup can be used in Remote Desktop using the
Send UNIX Command task.
Using systemsetup
The command-line tool systemsetupKUWUGFVQEQP°IWTGQVJGTPQPPGVYQTMU[UVGO
settings. You can use it to query or alter time zones, network time servers, sleep
UGVVKPIU'PGTI[5CXGTRTGHGTGPEGU4GOQVG.QIKP
55*RTGHGTGPEGUCPFOQTG;QW¨NN
°PFVJGEQOOCPFNKPGU[PVCZGZRNCPCVKQPUCPFGZCORNGKPVJGVQQN¨UJGNRRTQORVD[
entering the following line in the Terminal:
/System/Library/CoreServices/RemoteManagement/ARDAgent.app/Contents/
Support/systemsetup -help
-setdate mm:dd:yy
Use this command to set the current month, day, and year. Example:
systemsetup -setdate 04:15:02
-setlocalsubnetname name
5GV.QECN*QUVPCOGVQname. Example:
systemsetup -setlocalsubnetname LabMac1
-setremoteappleevents ( on | off )
Use this command to set whether the server responds to events sent by other computers (such as
AppleScript scripts). Example:
systemsetup -setremoreappleevents on
-setremotelogin ( on | off )
5GVUTGOQVGNQIKP
55*VQGKVJGTQPQTQÒ+ORQTVCPV+H[QWVWTPQÒTGOQVGNQIKP[QWYQP¨VDGCDNG
to administer the server using SSH for remote login. Example:
systemsetup -setremotelogin on
-setrestartfreeze ( on | off )
Use this command to specify whether the server restarts automatically after the system freezes.
Example:
systemsetup -setrestartfreeze on
-setrestartpowerfailure ( on | off )
Use this command to specify whether the server automatically restarts after a power failure. Example:
systemsetup -setrestartpowerfailure on
-setsleep minutes
5GVUCOQWPVQHKFNGVKOGWPVKNEQORWVGTUNGGRU5RGEKH[¥0GXGT¦QT¥1Ò¦HQTEQORWVGTUVJCVUJQWNF
never sleep. Important: if you set the system to sleep, you won’t be able to administer the server
remotely while it is sleeping. Example:
systemsetup -setsleep 60
-settime hh:mm:ss
Sets the current time. The provided time argument should be in 24-hour format. Example:
systemsetup -settime 16:20:00
-settimezone timezone
Use this command to set the local time zone. Use “-listtimezones” to list valid timezone arguments.
Example:
systemsetup -settimezone US/Pacific
-setusingnetworktime ( on | off )
5GVUYJGVJGTWUKPIPGVYQTMVKOGKUQPQTQÒ'ZCORNG
systemsetup -setusingnetworktime on
-setwakeonmodem ( on | off )
Use this command to specify whether or not the server wakes from sleep when modem activity is
detected. Example:
systemsetup -setwakeonmodem on
-setwakeonnetworkaccess ( on | off )
Use this command to specify whether the server wakes from sleep when a network admin packet is
sent to it. Example:
systemsetup -setwakeonnetworkaccess on
Any command that uses systemsetup can be used in Remote Desktop using the Send
UNIX Command task.
Using kickstart
The kickstart command-line utility is embedded within the Apple Remote Desktop
ENKGPVUQHVYCTG+VNGVU[QWKPUVCNNWPKPUVCNNCEVKXCVGEQP°IWTGCPFTGUVCTVEQORQPGPVU
QH#RRNG4GOQVG&GUMVQRYKVJQWVTGUVCTVKPIVJGEQORWVGT;QWECPEQP°IWTGCNNVJG
features found in the Remote Desktop section of the Sharing System Preferences.
The kickstartWVKNKV[ECPDGWUGFYKVJ55*VQEQP°IWTGTGOQVGEQORWVGTU
including Xserves. The kickstartWVKNKV[KUNQECVGFCV5[UVGO.KDTCT[%QTG5GTXKEGU
4GOQVG/CPCIGOGPV#4&#IGPVCRR%QPVGPVU4GUQWTEGUMKEMUVCTV
The syntax and list of actions possible with kickstart are available by running
kickstart as follows:
$sudo /System/Library/CoreServices/RemoteManagement/ARDAgent.app/
Contents/Resources/kickstart -help
You can use the sudo command with an administrator account to use the kickstart
utility, or you can use the Send UNIX Command. All commands presented in this
section should be typed as one line of text. It’s OK if the text wraps as you enter it; just
be sure not to enter Return characters.
This chapter describes Remote Desktop automation capabilities and how to use them.
The Task Server installs packages and changes client settings without direct control
from the Remote Desktop application. It also lets you install software packages and
change settings on clients that aren’t currently available on the network.
The Task Server also collects data from Remote Desktop clients and acts as a central
repository for cached report data. The Remote Desktop application console doesn’t
need to be open and active, and you can spread report data collection over a longer
period of time than with an intermittent network connection on an administrator
computer.
There are a few constraints on using a Task Server for administration. If you want to run
a Task Server on a computer other than the one that runs Remote Desktop, you need a
UGRCTCVG7PNKOKVGF/CPCIGF5[UVGOUNKEGPUG#NUQVJG6CUM5GTXGTRGTHQTOUQPN[VYQ
of the many tasks available from Remote Desktop.
162
6JG°TGYCNNUJQWNFCNNQYEQOOWPKECVKQPDGVYGGPVJGUGTXGTCPFVJGENKGPV+2CFFTGUU
groups on TCP and UDP ports 3283. Also, if you open TCP port 5900, you can control
clients. TCP port 22 should be open if you’re using SSH encryption (used if you’re
connecting to clients with Remote Desktop 3.2.1 or earlier installed).
3 If you use a Network Address Translation (NAT) router, forward TCP and UDP ports
3283 and 5900 to the task server computer. Forward other unique port pairs to clients
located behind the NAT router.
For more information about setting up NATs, see “Setting Up the Network” on page 80.
4 Check for proper connectivity from a few of the clients.
Ping the server from the clients and make connections on the correct ports.
5 Check for proper connectivity from the server.
Scan the IP address range of the clients and get network ping results from a sampling
of them.
Although you’ll use an administrator computer to query the Task Server, you should
back up report data on the Task Server, not the administrator computer.
+H[QWJCXGCPGZKUVKPINKUVQHEQORWVGTU[QWPGGFVQEQP°IWTGVJGOPQY(QT
information, see “Setting the Client’s Data Reporting Policy” on page 166.
6JGEQNNGEVKQPRQNKE[KPENWFGUHQWTMKPFUQHKPHQTOCVKQPU[UVGOFCVC°NGFCVCWUGT
accounting data, and application usage data.
+H[QWUVQRVJGENKGPVHTQOWRNQCFKPITGRQTVUVQCURGEK°ECFOKPKUVTCVQTEQORWVGTDWV
that administrator computer tries to connect to the client, the administrator computer
will resume receiving reports.
6QUVQRENKGPVUHTQOWRNQCFKPITGRQTVUVQCURGEK°ECFOKPKUVTCVQTEQORWVGT
1 Select one or more computers.
2 Choose File > Get Info.
3 Select the Administrators tab and click the Edit button.
This list shows all computers that administer the client and task servers associated with
the administrator computers. The status indicator indicates whether the administrator
computer is currently authenticated with the client.
4 Select an administrator computer in the list and click Remove (–).
You can’t remove administrator computers that are currently authenticated with
the client.
5 Click Done.
When you schedule an automated task, information about the scheduled task is saved
on the administrator computer. At the appointed time, the client software on that
computer activates and initiates the task. Remote Desktop must be open to perform a
scheduled task.
To schedule a task:
1 Select a computer list in the Remote Desktop window.
2 Select one or more computers in the selected computer list.
3 Choose the task you want to schedule from the menu bar.
4 %QP°IWTGVJGVCUMCUPGGFGF
5 Before executing the task, click the Schedule button.
The scheduling information is revealed.
6 Choose when and how often you want the task to execute.
7 If you want the task to repeat, click Repeating Every then set the repeat interval.
8 Click OK.
9 Save the task and choose where the task will appear in the Remote Desktop window.
This section provides a brief description of AppleScript, a brief discussion of using the
Remote Desktop AppleScript dictionary, and a sample script.
AppleScript Basics
AppleScript scripts consist of commands that are sent to objects. Objects can be a
wide variety of things, including applications, scripts, windows, settings, or the Finder.
6JGUGQDLGEVUECPTGEGKXGCURGEK°EUGVQHEQOOCPFUCPFTGURQPFYKVJVJGFGUKTGF
actions. Essentially, a script tells an application (Remote Desktop in this case) to either
complete a certain task or retrieve information. You can give the script decision-
making capabilities by using conditional statements; you can give the script a memory
D[FG°PKPIXCTKCDNGU
Remote Desktop has made all of its fundamental functions scriptable. The tasks
that you perform as an administrator by pointing and clicking the mouse can all be
accomplished by running an AppleScript script. For example, you can:
Get information about a computer
Rename a computer
Add computers to a list
Copy or install items
Execute a report task
PROPERTIES
KF
7PKEQFGVGZVTQ6JGWPKSWGKFGPVK°GT
77+&QHVJGEQORWVGTNKUV
A “computer list” is an object which contains other objects (“computers” in this case)
and has properties like its “id” and its “name.” When queried, this object can return the
values for the properties (in Unicode text as indicated), but you can’t change “id” from
within the script (it’s labeled r/o for read-only). This object can be acted upon by the
“verbs,” or messages, in a script.
The dictionary also contains “verbs,” or messages. These verbs are commands that act
on the objects in the dictionary. For example, in the Remote Desktop dictionary there’s
a verb named “add,” that has this entry:
to computer list : The computer list (or task) to add the computer to.
This entry tells you what the verb can act on and how. This entry says that Remote
&GUMVQRECPCFFCURGEK°GFEQORWVGTVQCEQORWVGTNKUV6JGQDLGEVU¥EQORWVGT¦CPF
“computer list” are being acted upon by “add.”
WARNING: This sample script is for educational use only, and no warranty is explicit
or implied as to the suitability of this script for your computing environment. The
script also deletes items on the target computers. Use it at your own risk.
end tell
Here’s the sample script from the previous section, but done using Automator:
;QWECPETGCVGCP#WVQOCVQTYQTM±QYCRRNKECVKQP(KPFGTRNWIKPQTK%CNCNCTOUKOKNCT
to the AppleScript script mentioned above. By stringing together Remote Desktop
actions in Automator, you accomplish the same work as an AppleScript script, but
without having to write code.
Appendix
Icon and Port Reference
1ÔKPG#RRNG4GOQVG&GUMVQRENKGPV
174
List Menu Icons
The following icons are used in the Apple Remote Desktop list area of the Remote
Desktop main window.
Smart list
Scanner
Finished successfully
Incomplete
Queued
Scheduled
Icon Indicates
or One or more service statistics is red. This takes precedence over any yellow or
green indicator.
or One or more service statistics is yellow. This takes precedence over any green indicator
Service is operating within established parameters.
No service information available.
No status information is
available
DIsk Usage Usage is at 90% or less
No status information is
available
(TGG/GOQT[ .GUUVJCPWUGF
No status information is
available
Appendix
4GRQTV(KGNF&G°PKVKQPU4GHGTGPEG
6JGHQNNQYKPIUGEVKQPUFGUETKDGVJGCXCKNCDNG°GNFUKPUQOG
of the Apple Remote Desktop reports.
6JG°NGUGCTEJTGRQTVU
(KNG5GCTEJ5QHVYCTG8GTUKQPCPF5QHVYCTG&KÒGTGPEGCTGP¨V
KPENWFGFDGECWUGVJGKT°GNFUENQUGN[OCVEJVJQUGCNTGCF[HQWPFKPVJG(KPFGT
For information about generating reports, see “Creating Reports” on page 120.
178
List category Field name Notes or example
#XCKNCDNG7UGT/GOQT[ /GOQT[KP-$
$QQV41/ 41/XGTUKQPPWODGT
Bus Clock Speed +P/*\
Bus Clock Speed (Non Display +P/*\
Field)
Bus Data Size
CPU Speed +P/*\
CPU Speed (Non Display Field) +P/*\
Serial Number
Vector Processor Yes/No
.%CEJG5K\G In KB
.%CEJG5K\G In KB
/CEJKPG%NCUU
/CEJKPG/QFGN
/GOQT[ In KB
'ORV[4#/5NQVU
PCI slots
PCI Slots Used
Processor Count
CPU Type Internal value
Sales Order Number
8/5K\G
6QVCN4#/5NQVU
Devices ATA Device Count
Firewire Device Count
Keyboard Connected
/QWUG%QPPGEVGF
Optical Drive Type
SCSI Device Count
USB Device Count
Storage Report
List category Field name Notes or example
Hardware &TKXG/CPWHCEVWTGT
&TKXG/QFGN
Drive Revision
Drive Protocol
Removable Yes/No
Serial Number
.QIKECN7PKV0WODGT
Detachable
Volume Options OS version
Memory Report
Field name Notes or example
5NQV+FGPVK°GT &+//,
Size +P/$
Speed 2%
/CE15:QPN[
Type 5&4#/
Date collected
Appendix
AppleScript Remote Desktop Suite
This appendix isn’t a substitute for the AppleScript dictionary view in Script Editor. It’s
KPENWFGFCUCSWKEMTGHGTGPEGUQ[QWECP°PF#RRNG5ETKRVEQOOCPFUD[UGCTEJKPIVJKU
2&(°NG6JGFKEVKQPCT[JCUVJGOQUVTGEGPVKPHQTOCVKQPCDQWVUETKRVCDNGQDLGEVUCPF
events in Remote Desktop, and better usability.
to computer list: The computer list (or task) to add the computer to.
[on computer list]: The computer list (or computer) on which to run the task.
from computer list: The computer list (or task) to remove the computer from.
190
application n [inh. application; see also Standard Suite]: the Remote Desktop
top-level scripting object.
'.'/'065
contains computers, computer lists, copy items tasks, copy to me tasks, documents,
empty trash tasks, install package tasks, lock screen tasks, logout tasks, open
application tasks, open item tasks, rename computer tasks, restart tasks, send message
tasks, send unix command tasks, set local startup disk tasks, set network startup disk
tasks, share screen tasks, shutdown tasks, sleep tasks, unlock screen tasks, upgrade
client tasks, wake up tasks, windows.
PROPERTIES
PROPERTIES
boot volume (Unicode text, r/o): The boot volume of the computer.
current user (Unicode text, r/o): The currently logged in user on the computer.
DNS name (Unicode text, r/o): The DNS name of the computer.
KF
7PKEQFGVGZVTQ6JGWPKSWGKFGPVK°GT
77+&QHVJGEQORWVGT
Internet address (Unicode text, r/o): The Internet address of the computer.
last activity (date, r/o): The time of the most recent activity on the computer.
last contacted (date, r/o): The time of last contact with the computer.
physical memory (Unicode text, r/o): The physical ram installed in the computer.
primary Ethernet address (Unicode text, r/o): The primary ethernet address of
the computer.
status message (Unicode text, r/o): The current status of the computer.
U[UVGOXGTUKQP
7PKEQFGVGZVTQ6JG/CE15XGTUKQPTWPPKPIQPVJGEQORWVGT
PROPERTIES
KF
7PKEQFGVGZVTQ6JGWPKSWGKFGPVK°GT
77+&QHVJGEQORWVGTNKUV
copy items task n [inh. task > item]: Copy items to the target computers.
'.'/'065
contained by application.
PROPERTIES
bandwidth limit (integer): Network usage limit in kilobytes per second (0 = unlimited).
EQP±KEVTGUQNWVKQP
CUMYJCVVQFQTGPCOGVJGGZKUVKPIKVGOTGPCOGVJGKVGODGKPI
EQRKGFTGRNCEGTGRNCEGKHQNFGT5RGEK°GUYJCVVQFQKHVJGKVGO
UCNTGCF[GZKUVKP
this location.
EQR[KVGOU
NKUV#NKUVQH°NGUCPFQTHQNFGTUVQEQR[
FGUVKPCVKQPITQWR
7PKEQFGVGZV+HQYPGTUJKRKUUGVVQC¨URGEK°EQYPGT¨CXCNKFITQWR
name on the destination computer.
FGUVKPCVKQPQYPGT
7PKEQFGVGZV+HQYPGTUJKRKUUGVVQC¨URGEK°EQYPGT¨CXCNKFWUGT
name on the destination computer.
FGUVKPCVKQPRCVJ
CNKCU+HVJGNQECVKQPKU¨URGEK°EHQNFGT¨CHWNN[URGEK°GFRCVJVQVJG
destination folder.
QYPGTUJKR
EWTTGPVEQPUQNGWUGTEWTTGPVQYPGTFGUVKPCVKQPHQNFGTQYPGTURGEK°E
QYPGT5RGEK°GUVJGPGYQYPGTUJKRQHVJGEQRKGFKVGO
U
should open (boolean): Should the items be opened after being copied
copy to me task n [inh. task > item]: Copy items from the target computers to
the administrator computer.
'.'/'065
contained by application.
PROPERTIES
bandwidth limit (integer): Network usage limit in kilobytes per second (0 = unlimited).
EQP±KEVTGUQNWVKQP
CUMYJCVVQFQTGPCOGVJGGZKUVKPIKVGOTGPCOGVJGKVGODGKPI
EQRKGFTGRNCEGTGRNCEGKHQNFGT5RGEK°GUYJCVVQFQKHVJGKVGO
UCNTGCF[GZKUVKP
this location.
EQR[KVGOU
NKUV#NKUVQH°NGUCPFQTHQNFGTUVQEQR[
FGUVKPCVKQPRCVJ
CNKCU+HVJGNQECVKQPKU¨URGEK°EHQNFGT¨CHWNN[URGEK°GFRCVJVQVJG
destination folder.
empty trash task n [inh. task > item]: Empty the trash on the target computers.
'.'/'065
contained by application.
contained by application.
PROPERTIES
CHVGTKPUVCNNKPI
CVVGORVTGUVCTVFQPQVJKPIHQTEGKOOGFKCVGTGUVCTV5RGEK°GUYJCVVQ
do after installing the package(s).
bandwidth limit (integer): Network usage limit in kilobytes per second (0 = unlimited).
delegating to task server (boolean): Should this task be delegated to the task server
lock screen task n [inh. task > item]: Lock the screen(s) on the target computers.
'.'/'065
contained by application.
PROPERTIES
OGUUCIG
7PKEQFGVGZV/GUUCIGVQFKURNC[QPVJGUETGGP
U
logout task n [inh. task > item]: Log out the current user on the target computers.
'.'/'065
contained by application.
open application task n [inh. task > item]: Launch an application on the
target computers.
'.'/'065
contained by application.
PROPERTIES
contained by application.
PROPERTIES
°NGU
NKUV#NKUVQH°NGUVQQRGP
power on task n [inh. task > item]: Start up the target computers.
'.'/'065
contained by application.
rename computer task n [inh. task > item]: Change the name of the target
computers.
'.'/'065
contained by application.
PROPERTIES
target name (Unicode text): The new name for the computer.
restart task n [inh. task > item]: Restart the target computers.
'.'/'065
contained by application.
PROPERTIES
user can save changes or cancel (boolean): Is the user allowed to save changes or
cancel the restart
send message task n [inh. task > item]: Send a text message to the target
computers.
'.'/'065
contained by application.
PROPERTIES
OGUUCIG
7PKEQFGVGZV/GUUCIGVQFKURNC[QPVJGUETGGP
U
contained by application.
PROPERTIES
set local startup disk task n [inh. task > item]: Set the startup volume on the target
computers.
'.'/'065
contained by application.
PROPERTIES
DQQVXQNWOG
7PKEQFGVGZV5RGEK°EXQNWOGQHFTKXGVQDQQV
QRVKQPCN
restarting (boolean): Should the machine be restarted after setting the startup volume
set network startup disk task n [inh. task > item]: Set the startup volume on the
target computers.
'.'/'065
contained by application.
PROPERTIES
from server (Unicode text): Internet address of the server to boot from.
restarting (boolean): Should the machine be restarted after setting the startup volume
share screen task n [inh. task > item]: Share a computers screen to the target
computers.
'.'/'065
contained by application.
PROPERTIES
source computer (computer): The computer (other than the admin) whose screen to
share.
contained by application.
PROPERTIES
user can save changes or cancel (boolean): Is the user allowed to save changes or
cancel the shutdown
sleep task n [inh. task > item]: Put the target computers to sleep.
'.'/'065
contained by application.
task n [inh. item]: A task. This abstract class represents the tasks which can be
GZGEWVGFD[4GOQVG&GUMVQR6JGTGCTGUWDENCUUGUHQTGCEJURGEK°EV[RGQHVCUM
'.'/'065
contained by application.
PROPERTIES
computer list (computer list): The computer list associated with the task.
KF
7PKEQFGVGZVTQ6JGWPKSWGKFGPVK°GT
77+&QHVJGEQORWVGT
TGEWTTGPEG
7PKEQFGVGZVTQ#UVTKPIYJKEJFGUETKDGUVJGVCUMTGEWTTGPEGKHFG°PGF
UVCTVKPICV
FCVG+HVJGVCUMKUUEJGFWNGFVJGFCVGCPFVKOGQHVJG°TUVGZGEWVKQP
unlock screen task n [inh. task > item]: Release the screen(s) of the target
computers.
'.'/'065
contained by application.
upgrade client task n [inh. task > item]: Upgrade the Remote Desktop client on the
target computers.
'.'/'065
contained by application.
wake up task n [inh. task > item]: Wake up the target computers.
'.'/'065
contained by application.
Appendix
SQLite Schema Sample
Output:
cid name type notnull dflt_value pk
---------- ---------- ------------ ---------- ---------- ----------
0 ObjectName VARCHAR(128) 99 0
1 PropertyNa VARCHAR(128) 99 0
2 PropertyMa INTEGER 0 0
198
Sample list of system information table
Command:
sudo /usr/bin/sqlite3 -column -header /var/db/RemoteManagement/RMDB/rmdb.
sqlite3 'PRAGMA table_info(systeminformation);'
Output:
cid name type notnull dflt_value pk
---------- ---------- ---------- ---------- ---------- ----------
0 ComputerID CHAR(17) 99 0
1 ObjectName VARCHAR(12 99 0
2 PropertyNa VARCHAR(12 99 0
3 ItemSeq INTEGER 0 0
4 Value VARCHAR(51 0 0
5 LastUpdate VARCHAR(20 0 0
Output:
ObjectName PropertyName PropertyMapID
--------------------- -------------------- -------------
Mac_SystemInfoElement WirelessCardIsActive 0
Mac_SystemInfoElement WirelessCardFirmware 1
Mac_SystemInfoElement WirelessCardHardware 2
Mac_SystemInfoElement WirelessCardLocale 3
Mac_SystemInfoElement WirelessCardType 4
Mac_SystemInfoElement WirelessCardInstalle 5
Mac_SystemInfoElement WirelessChannelNumbe 6
Mac_SystemInfoElement WirelessNetworkAvail 7
Mac_SystemInfoElement WirelessIsComputerTo 8
......
Output:
ComputerID ObjectName PropertyName ItemSeq Value
LastUpdated
----------------- -------------------- ------------ ---------- ------
-------------- --------------------
00:1b:63:9f:5a:00 Mac_HardDriveElement DataDate 0
2009-03-05T22:06:04Z 2009-03-05T22:06:04Z
00:1b:63:9f:5a:00 Mac_HardDriveElement LastConsiste 0
2009-03-05T22:06:04Z 2009-03-05T22:06:04Z
00:1b:63:9f:5a:00 Mac_HardDriveElement UnixMountPoi 0 /dev/
disk0s2 2009-03-05T22:06:04Z
00:1b:63:9f:5a:00 Mac_HardDriveElement Model 0 WDC
WD3200AAJS-40RYA 2009-03-05T22:06:04Z
......