Angewandte

Chemie

DOI: 10.1002/anie.200705471
Peptide Ligation

An Efficient Fmoc-SPPS Approach for the Generation of Thioester

Peptide Precursors for Use in Native Chemical Ligation**
Juan B. Blanco-Canosa and Philip E. Dawson*

The straightforward C-terminal modification of peptides towards aminolysis and the base lability of previous N-
assembled on a solid support remains a significant challenge acylurea forming linkers.[13]
in peptide and protein chemistry. In particular, C-terminal Inspired by this work, we have found that o-aminoanilides
thioester peptides are important intermediates for the 1 are stable synthetic intermediates that can be efficiently
generation of active esters, amides and hydrazides[1, 2] and transformed into an aromatic N-acylurea moiety 2[14, 16]
are an essential component of many synthetic strategies for following chain elongation (Scheme 1). Since this group has
protein synthesis.[3] Currently, the most effective approach for been previously described as an N-acyl-benzimidazoli-
the synthesis of peptidyl thioesters is the in situ neutralization none,[13–16] we propose the use of the abbreviation Nbz to
protocol for tert-butoxycarbonyl solid-phase peptide synthesis indicate this leaving group. The resin-bound acylurea peptide
(Boc-SPPS)[4] using thioester linkers.[2, 5] However, many 2 can be deprotected and cleaved from the resin with
laboratories use Fmoc-SPPS (Fmoc = 9-fluor trifluoroacetic acid (TFA) using standard acid labile linkers
enylmethyloxycarbonyl) exclusively and such protocols are (e.g. Rink or Wang linkers). The resulting mildly activated
favored when synthesizing glyco- and phospho-
peptides. The thioester linkers used for Boc-
SPPS have limited utility for Fmoc-SPPS due to
the requirement for repeated Fmoc removal
under basic conditions. Considerable effort has
been applied to address this challenge[6] includ-
ing optimized Fmoc deprotection cocktails,[7]
thiol labile safety-catch linkers,[8] activation of
protected peptides in solution,[9] and recently
thioesters have been generated using O-to-S[10]
or N-to-S[11] acyl transfer. Despite these notable
advances, the synthesis of thioester peptides by
Fmoc-SPPS remains significantly more chal-
lenging than the synthesis of the corresponding
acid or amide peptide.
Herein, we describe an alternative approach
for the Fmoc synthesis of peptides for use in
native chemical ligation (NCL)[12] that is based
on the formation of a C-terminal N-acylurea
functionality. N-acylureas are mild acylating
agents that have previously been explored in
peptide synthesis by Pascal et al.[13, 14] and for Scheme 1. Synthetic strategy for Fmoc-SPPS of thioester peptides. Following SPPS,
thioamide synthesis by Rapoport et al.[15] and aminoanilide 1 undergoes specific acylation and cyclization to yield the resin-bound
Zacharie et al.[16] However, the utility of these acylurea peptide 2. Following cleavage and deprotection, peptide-Nbz 3 can undergo
groups as acylating agents has been limited due thiolysis to yield peptide thioester 4, or direct ligation to yield the native peptide 5.
to the low reactivity of N-acylurea products

[*] Dr. J. B. Blanco-Canosa, Dr. P. E. Dawson peptide-Nbz 3 is stable to the acidic conditions used for
Departments of Chemistry and Cell Biology peptide handling and purification. However, in neutral
The Scripps Research Institute aqueous buffers, the fully unprotected acylurea peptides
10550 N. Torrey Pines Road, La Jolla, CA 92037 (USA) undergo rapid thiolysis, enabling thioester peptide 4 to be
Fax: (+ 1) 858-784-7319
generated before purification or in situ during a native
E-mail: [email protected]
Homepage: http://www.scripps.edu/cb/dawson/ chemical ligation. Importantly, the linker is a stable amide
[**] This work was supported by the NIH GM059380 (P.E.D.) and the during chain assembly and the key activation step utilizes the
Spanish Ministerio de Educaci@n y Ciencia and the Fulbright most robust reaction in solid phase peptide synthesis: the
Scholar Program (J.B.B-C). acylation of an amine. As a result, the method is compatible
Supporting information for this article is available on the WWW with amino acid side chains and protecting groups commonly
under http://dx.doi.org/10.1002/anie.200705471. used in peptide synthesis.

Angew. Chem. Int. Ed. 2008, 47, 6851 –6855  2008 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim 6851
Communications

Scheme 2. Synthesis of LYRAG-Nbz. DIEA = N,N-diisopropylethylamine, HBTU = O-(benzotriazol-l-yl)-N,N,N’,N’-tetramethyluronium hexafluoro-

phosphate, HOBt = 1-hydroxybenzotriazole, Pbf = 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl, TIS = triisopropylsilane.

To test the method, we first synthesized the peptide

LYRAG-Nbz (Scheme 2). Starting with Rink-PEG-PS resin
(0.2 mmol g 1, ABI; PEG = polyethylene glycol, PS = poly-
styrene, ABI = Applied Biosystems), 3-Fmoc-4-diaminoben-
zoic acid (Fmoc-Dbz) was coupled and the Fmoc group
deprotected with 20 % piperidine. Notably, after acylation,
the free amino group in position 3 or 4 becomes hindered/
deactivated and does not need further protection. Subsequent
amino acids were coupled by standard Fmoc-SPPS with the
N-terminal amino acid being introduced as Boc-Leu. Follow-
ing chain assembly, the C-terminus was activated through
acylation with p-nitrophenylchloroformate followed by the
addition of base to promote intramolecular attack of the
anilide to form the resin-bound benzimidazolinone. The
peptide was deprotected and quantitatively cleaved from
the Rink-PEG resin by treatment with TFA.
As shown in Figure 1 A, the desired peptide LYRAG-Nbz
was obtained in high purity. No aminoanilide products were
observed indicating that the conversion to the benzimidazo-
linone is quantitative. In this short peptide, the isomeric
acylurea products are resolved by HPLC, indicating a 4:1
ratio. However, treatment of the peptide with 4-mercapto-
phenylacetic acid (MPAA) rapidly yields a single thioester
product (LYRAG-SAr, Figure 1 B; Ar = aryl). Importantly,
the thioester conversion occurs at pH 7.0 in under an hour,
minimizing the likelihood of base mediated side reactions in
susceptible peptides. In addition, since the benzimidazolinone
is a poor nucleophile, the equilibrium lies fully towards the
aryl-thioester product. These properties suggest that the Nbz
peptides will be especially useful in the generation of aryl
thioesters used in kinetically controlled and auxiliary-medi-
ated ligation methods.[17]
The rapid conversion of LYRAG-Nbz to LYRAG-SAr
suggested that acylurea peptides could be used directly in
NCL without prior isolation of the thioester precursor. To test
the in situ activation of the LYRAG peptide, we mixed
LYRAG-Nbz (2 mm) with the N-terminal Cys peptide
Figure 1. Synthesis, thioester exchange and ligation of LYRAG-Nbz.
CRAFS (2.8 mm) at ph 7.0 in 6 m Gn·HCl Gn = guanidine, A) HPLC chromatogram of crude LYRAG-Nbz. B) Thiolysis of crude
200 mm Na2HPO4, 200 mm MPAA, 20 mm TCEP·HCl LYRAG-Nbz in 200 mm MPAA, pH 7.0 after 1 h. C) Ligation of CRAFS
(TCEP = tris(carboxyethyl)phosphine).[18] As shown in Fig- to LYRAG-Nbz after 50 min, pH 7.0.

6852 www.angewandte.org  2008 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim Angew. Chem. Int. Ed. 2008, 47, 6851 –6855
 Angewandte
Chemie

ure 1 C, the ligation reaction proceeded efficiently, And under synthesis of large polypeptides using standard Fmoc-SPPS
these mild conditions, the only side product stemmed from protocols. To test the robustness of the Dbz moiety, we
trace hydrolysis.[19] At intermediate time points, we found synthesized a functionally diverse 29-amino-acid peptide
only trace amounts of the LYRAG-SAr peptide, suggesting derived from rabies virus glycoprotein (Rvg) that has recently
that it was immediately converted into LYRAGCRAFS. been shown to be an effective carrier for cargo delivery into
These observations are consistent with aryl thioester forma- cells and through the blood–brain barrier.[22] Synthesis was
tion being rate determining under these ligation conditions. performed on a 0.1 mmol scale using 4-fold excess (0.4 mmol)
To probe the scope of the method, we synthesized a series of amino acid and the activating mixture (HBTU/HOBt/
of peptides with Ala, Phe, Tyr, Leu, Val, and Pro in the C- DIEA (1:1:1.5)). The last residue (Tyr) was introduced as the
terminal position (Table 1). The loading on the Dbz linker side-chain-unprotected Boc-Tyr. After peptide elongation, an
aliquot of peptide-resin (100 mg) was removed and p-nitro-
phenylchloroformate was added in CH2Cl2. The resulting
Table 1: Peptide-Nbz synthesized by Fmoc-SPPS.
peptidyl-carbamate was treated with 0.5 m DIEA/DMF
Entry Peptide-Nbz Purity [%][a] Recovered Yield [%][b] (15 min), to afford the peptide-Nbz resin that was then
1 LYRAG-Nbz 95 90 cleaved with TFA. As shown in Figure 2, the peptide was
2 LYRGA-Nbz 90 70
3 LARGF-Nbz 96 88
4 LARGY-Nbz 93 90
5 AYRGL-Nbz 92 87
6 LYRAP-Nbz 93 71
7 LYRGV-Nbz 94 67
8 (29aa)Rvg-Nbz 57 36
[a] Crude purity based on HPLC detection trace at 220 nm. [b] Non-
optimized, the peptide is cleaved quantitatively from the Rink-PEG-PS
resin.

was quantitative for each amino acid (see Supporting

Information). Alternatively, 3-(Fmoc-Ala)-4-diaminobenzoic
acid (Fmoc-Ala-Dbz-OH) was synthesized in order to obtain Figure 2. Rvg-Nbz HPLC and ESI mass (insert) of crude synthetic
the peptide LYRGA-Nbz as a single isomer. We anticipate product. Mass observed: [M+H] 3426.0 Da, (calcd: [M+H]
that the use of preformed Fmoc-aa-Dbz (aa = amino acid) 3426.8 Da). Rvg sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNG-
linkers will be the most robust method for synthesis of Nbz Nbz.
peptides using preloaded Fmoc-aa-Dbz-resins in a similar
manner to commercially available Boc-aa-Pam-resins and obtained in high purity (57 % by HPLC integration) and a
Fmoc-aa-Wang-resins. yield of 36 % was recovered after preparative HPLC. As with
Following chain assembly, the activation of the Dbz group the LYRAG-Nbz model peptide, the Rvg-Nbz peptide
with p-nitrophenylchloroformate and subsequent acidolytic efficiently exchanged with thiols to yield activated aryl
cleavage was near quantitative in all cases including the thioesters (Supporting Information, pages S32–S34).[23] In
hindered Val and Pro residues. Importantly, epimerization of addition, 2.0 mm of Rvg peptide (3.6 mg, 1.0 F 10 3 mmol) was
the C-terminal amino acid was less than 2 %.[20] One ligated in situ with a second polypeptide, Tsr[24] (30 aa, 3.8 mg,
advantage of the acylurea method is that chain elongation 1.2 F 10 3 mmol, 2.4 mm) at pH 7.0 in 6 m Gn·HCl, 200 mm
occurs with a C-terminal amide linkage. As a result, no Na2HPO4, 200 mm MPAA, 20 mm TCEP·HCl to yield a 59
diketopiperazine formation was observed, even with the amino acid polypeptide (4.7 mg, 70 %, Figure 3). After 2 h, no
cyclization-prone LYRAP-Nbz peptide. Indeed, in previous acylurea peptide remained. Significantly, these peptides
work we observed significant diketopiperazine formation in contain the diverse functionality typical of complex peptides
the same peptide when using Boc-SPPS on a thioester resin.[5] and proteins.
The six peptides were ligated with 2–3 mm CRAFS, These results suggest that N-acylurea activation will have
pH 7.0, 25 8C, reaching completion in under 2 h except for broad utility in organic synthesis, including peptide and
Val (10 h) and Pro (24 h) residues considered to be poorly protein chemistry. These mildly activated peptides undergo
compatible with NCL.[5] On a preparative scale, 2.5 mm rapid thiolysis to yield thioester peptides under standard NCL
AYRGL-Nbz (7.5 mg, 1.0 F 10 2 mmol) and 3.0 mm CRAFS conditions. Importantly, activation of the Dbz moiety is
(7.0 mg, 1.2 F 10 2 mmol) formed the product AYRGL- compatible with both unhindered (Gly) and hindered (Val) C-
CRAFS (10.9 mg, 9.5 F 10 3 mmol) in 95 % yield of isolated terminal amino acids and is resistant to epimerization. In
product with no side reactions other than trace hydrolysis. addition, the Dbz group is stable to standard Fmoc-SPPS
From these studies, we anticipate that N-acylurea peptides coupling and deprotection protocols as demonstrated by the
will be versatile precursors to peptidyl thioesters.[2, 5, 21] efficient synthesis of Rvg, a 29 aa rabies-derived peptide.
Since a primary utility of thioester peptides is in the Since the method relies exclusively on the acylation of amines
synthesis of proteins and complex bioconjugates, it is essential and requires no additional protecting groups, it is compatible
for the o-aminoanilide linker to be compatible with the with standard side-chain protection strategies, linkers and

Angew. Chem. Int. Ed. 2008, 47, 6851 –6855  2008 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim www.angewandte.org 6853
Communications
activated Nbz peptides should widen the application of
chemoselective ligation methods for the synthesis of complex
post-translationally modified proteins and other macromole-
cules.

Received: November 30, 2007

Revised: May 27, 2008
Published online: July 24, 2008

. Keywords: aminoanilides · native chemical ligation · peptides ·

solid-phase synthesis · thioester

[1] S. Aimoto, Biopolymers 1999, 51, 247 – 265.

[2] J. A. Camarero, A. Adeva, T. W. Muir, Lett. Pept. Sci. 2000, 7,
17 – 21.
[3] P. E. Dawson, S. B. Kent, Annu. Rev. Biochem. 2000, 69, 923 –
960.
[4] M. Schnolzer, P. Alewood, A. Jones, D. Alewood, S. B. H. Kent,
Int. J. Pept. Res. Ther. 2007, 13, 31 – 44.
[5] T. M. Hackeng, J. H. Griffin, P. E. Dawson, Proc. Natl. Acad. Sci.
USA 1999, 96, 10068 – 10073.
[6] J. A. Camarero, A. R. Mitchell, Protein Pept. Lett. 2005, 12, 723 –
728, and references therein.
[7] a) X. Q. Li, T. Kawakmi, S. Aimoto, Tetrahedron Lett. 1998, 39,
8669 – 8672; b) A. B. Clippingdale, C. J. Borrow, J. D. Wade, J.
Pept. Sci. 2000, 6, 225 – 234.
[8] a) G. W. Kenner, J. R. McDermott, R. C. Sheppard, J. Chem.
Soc. D 1971, 636 – 637; b) B. J. Backes, A. A. Virgilio, J. A.
Ellman, J. Am. Chem. Soc. 1996, 118, 3055 – 3056; c) B. J. Backes,
J. A. Ellman, J. Org. Chem. 1999, 64, 2322 – 2330; d) Y. Shin,
K. A. Winans, B. J. Backes, S. B. H. Kent, J. A. Ellman, C. R.
Bertozzi, J. Am. Chem. Soc. 1999, 121, 11684 – 11689; e) R.
Ingenito, E. Bianchi, D. Fattori, A. Pessi, J. Am. Chem. Soc. 1999,
121, 11369 – 11374; f) A. Sewing, D. Hilvert, Angew. Chem. 2001,
113, 3503 – 3505; Angew. Chem. Int. Ed. 2001, 40, 3395 – 3396;
g) J. A. Camarero, B. J. Hackel, J. J. De Yoreo, A. R. Mitchell, J.
Org. Chem. 2004, 69, 4145 – 4151.
[9] a) S. Futaki, K. Sogawa, J. Maruyama, T. Asahara, M. Niwa,
Tetrahedron Lett. 1997, 38, 6237 – 6240; b) A. R. Mezo, R. P.
Cheng, B. Imperiali, J. Am. Chem. Soc. 2001, 123, 3885 – 3891;
c) Y. Kajihara, A. Yoshihara, K. Hirano, N. Yamamoto, Carbo-
hydr. Res. 2006, 341, 1333 – 1340.
[10] a) P. Botti, M. Villain, S. Manganiello, H. Gaertner, Org. Lett.
2004, 6, 4861 – 4864; b) B. Wu, J. Chen, J. D. Warren, G. Chen, Z.
Hua, S. J. Danishefsky, Angew. Chem. 2006, 118, 4222 – 4231;
Angew. Chem. Int. Ed. 2006, 45, 4116 – 4125.
[11] a) Y. Ohta, S. Itoh, A. Shigenaga, S. Shintaku, N. Fujii, A. Otaka,
Org. Lett. 2006, 8, 467 – 470; b) F. Nagaike, Y. Onuma, C.
Kanazawa, H. Hojo, A. Ueki, Y. Nakahara, Y. Nakahara, Org.
Lett. 2006, 8, 4465 – 4468.
[12] P. E. Dawson, T. W. Muir, I. Clark-Lewis, S. B. H. Kent, Science
1994, 266, 776 – 779.
[13] R. Sola, P. Saguer, M. L. David, R. Pascal, J. Chem. Soc. Chem.
Commun. 1993, 1786 – 1788.
[14] R. Pascal, D. Chauvey, R. Sola, Tetrahedron Lett. 1994, 35, 6291 –
6294.
[15] M. A. Shalaby, C. W. Grote, H. Rapoport, J. Org. Chem. 1996,
61, 9045 – 9048.
Figure 3. Ligation of Rvg-Nbz and Tsr (N-terminal Cys, 30 aa). HPLC [16] B. Zacharie, G. Sauve, C. Penney, Tetrahedron 1993, 49, 10489 –
traces are shown at 0 and 2 h. RvgTsr, mass observed: [M+H] 10500.
6367.0 Da, (calculated: 6367.3 Da). [17] a) J. Offer, P. E. Dawson, Org. Lett. 2000, 2, 23 – 26; b) J. Offer,
C. N. C. Boddy, P. E. Dawson, J. Am. Chem. Soc. 2002, 124,
4642 – 4646.
resins and should also enable orthogonal protecting groups to [18] a) P. E. Dawson, M. J. Churchill, M. R. Ghadiri, S. B. H. Kent, J.
be utilized. As a result, straightforward access to C-terminally Am. Chem. Soc. 1997, 119, 4325 – 4329; b) E. C. B. Johnson,

6854 www.angewandte.org  2008 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim Angew. Chem. Int. Ed. 2008, 47, 6851 –6855
 Angewandte
Chemie

S. B. H. Kent, J. Am. Chem. Soc. 2006, 128, 6640 – 6646; c) D. [22] P. Kumar, H. Wu, J. L. McBride, K-E. Jung, M. H. Kim, B. L.
Bang, B. L. Pentelute, S. B. H. Kent, Angew. Chem. Int. Ed. 2006, Davidson, S. K. Lee, P. Shankar, N. Manjunath, Nature 2007, 448,
45, 3985 – 3988. 39 – 43.
[19] In the absence of thiol additives (MPAA), significant hydrolysis [23] Note, both the Rvg-SAr and the cyclic thiolactone products were
of the LYRAG-Nbz was observed (see the Supporting Informa- observed, highlighting the advantage of in situ thiolysis.
tion, pages S30–S32). [24] Tsr is a 30-mer peptide fragment of Thrombospondin-1 anti-
[20] As monitored by HPLC in comparison to C-terminally epimer- angiogenic protein. T. K. Tiefenbrunn, P. E. Dawson, unpub-
ized peptide LARGDY-Nbz (synthesized separately). lished results.
[21] M. Villain, H. Gaertner, P. Botti, Eur. J. Org. Chem. 2003, 3267 –
3272.

Angew. Chem. Int. Ed. 2008, 47, 6851 –6855  2008 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim www.angewandte.org 6855