Biopython Tutorial
Biopython Tutorial
Audience
This tutorial is prepared for professionals who are aspiring to make a career in the field of
bioinformatics programming using python as programming tool. This tutorial is intended
to make you comfortable in getting started with the Biopython concepts and its various
functions.
Prerequisites
Before proceeding with the various types of concepts given in this tutorial, it is being
assumed that the readers are already aware about bioinformatics. In addition to this, it
will be very helpful if the readers have a sound knowledge on Python.
All the content and graphics published in this e-book are the property of Tutorials Point (I)
Pvt. Ltd. The user of this e-book is prohibited to reuse, retain, copy, distribute or republish
any contents or a part of contents of this e-book in any manner without written consent
of the publisher.
We strive to update the contents of our website and tutorials as timely and as precisely as
possible, however, the contents may contain inaccuracies or errors. Tutorials Point (I) Pvt.
Ltd. provides no guarantee regarding the accuracy, timeliness or completeness of our
website or its contents including this tutorial. If you discover any errors on our website or
in this tutorial, please notify us at contact@[Link]
i
BioPython
Table of Contents
About the Tutorial ............................................................................................................................................ i
Audience ........................................................................................................................................................... i
Prerequisites ..................................................................................................................................................... i
Features ........................................................................................................................................................... 1
Goals ................................................................................................................................................................ 1
Advantages ...................................................................................................................................................... 2
GC Content .................................................................................................................................................... 14
Transcription ................................................................................................................................................. 14
Translation ..................................................................................................................................................... 14
SeqRecord...................................................................................................................................................... 17
FASTA ............................................................................................................................................................. 17
GenBank ........................................................................................................................................................ 19
ii
BioPython
Model ............................................................................................................................................................ 42
Chain .............................................................................................................................................................. 43
Residue .......................................................................................................................................................... 43
Atoms ............................................................................................................................................................ 43
Genome Diagram........................................................................................................................................... 60
Parsing ........................................................................................................................................................... 63
Interpolation .................................................................................................................................................. 64
Plotting .......................................................................................................................................................... 66
Hierarchical Clustering................................................................................................................................... 72
K - Clustering.................................................................................................................................................. 73
Conclusion ..................................................................................................................................................... 78
v
1. Biopython – Introduction BioPython
Biopython is the largest and most popular bioinformatics package for Python. It contains
a number of different sub-modules for common bioinformatics tasks. It is developed by
Chapman and Chang, mainly written in Python. It also contains C code to optimize the
complex computation part of the software. It runs on Windows, Linux, Mac OS X, etc.
Basically, Biopython is a collection of python modules that provide functions to deal with
DNA, RNA & protein sequence operations such as reverse complementing of a DNA string,
finding motifs in protein sequences, etc. It provides lot of parsers to read all major genetic
databases like GenBank, SwissPort, FASTA, etc., as well as wrappers/interfaces to run
other popular bioinformatics software/tools like NCBI BLASTN, Entrez, etc., inside the
python environment. It has sibling projects like BioPerl, BioJava and BioRuby.
Features
Biopython is portable, clear and has easy to learn syntax. Some of the salient features
are listed below:
Goals
The goal of Biopython is to provide simple, standard and extensive access to
bioinformatics through python language. The specific goals of the Biopython are listed
below:
1
BioPython
Advantages
Biopython requires very less code and comes up with the following advantages:
Population Genetics
Population genetics is the study of genetic variation within a population, and involves the
examination and modeling of changes in the frequencies of genes and alleles in
populations over space and time.
Biopython provides [Link] module for population genetics. This module contains all
the necessary functions to gather information about classic population genetics.
RNA Structure
Three major biological macromolecules that are essential for our life are DNA, RNA and
Protein. Proteins are the workhorses of the cell and play an important role as enzymes.
DNA (deoxyribonucleic acid) is considered as the “blueprint” of the cell. It carries all the
genetic information required for the cell to grow, take in nutrients, and propagate. RNA
(Ribonucleic acid) acts as “DNA photocopy” in the cell.
2
2. Biopython – Installation BioPython
This section explains how to install Biopython on your machine. It is very easy to install
and it will not take more than five minutes.
It is defined below:
It shows the version of python, if installed properly. Otherwise, download the latest
version of the python, install it and then run the command again.
3
BioPython
After executing this command, the older versions of Biopython and NumPy (Biopython
depends on it) will be removed before installing the recent versions.
[Link]
Download the file and unpack the compressed archive file, move into the source code
folder and type the below command:
This will build Biopython from the source code as given below:
4
BioPython
5
3. Biopython – Creating Simple Application BioPython
Let us create a simple Biopython application to parse a bioinformatics file and print the
content. This will help us understand the general concept of the Biopython and how it
helps in the field of bioinformatics.
Step 1: First, create a sample sequence file, “[Link]” and put the below content
into it.
The extension, fasta refers to the file format of the sequence file. FASTA originates from
the bioinformatics software, FASTA and hence it gets its name. FASTA format has multiple
sequence arranged one by one and each sequence will have its own id, name, description
and the actual sequence data.
Step 2: Create a new python script, *simple_example.py" and enter the below code and
save it.
file = open("[Link]")
Line 1 imports the parse class available in the [Link] module. [Link] module is
used to read and write the sequence file in different format and `parse’ class is used to
parse the content of the sequence file.
6
BioPython
Line 2 imports the SeqRecord class available in the [Link] module. This module
is used to manipulate sequence records and SeqRecord class is used to represent a
particular sequence available in the sequence file.
*Line 3" imports Seq class available in the [Link] module. This module is used to
manipulate sequence data and Seq class is used to represent the sequence data of a
particular sequence record available in the sequence file.
Line 5 opens the “[Link]” file using regular python function, open.
Line 7 parse the content of the sequence file and returns the content as the list of
SeqRecord object.
Line 9-15 loops over the records using python for loop and prints the attributes of the
sequence record (SqlRecord) such as id, name, description, sequence data, etc.
Step 3: Open a command prompt and go to the folder containing sequence file,
“[Link]” and run the below command:
Step 4: Python runs the script and prints all the sequence data available in the sample
file, “[Link]”. The output will be similar to the following content.
Id: sp|P25730|FMS1_ECOLI
Name: sp|P25730|FMS1_ECOLI
Decription: sp|P25730|FMS1_ECOLI CS1 fimbrial subunit A precursor (CS1 pilin)
Annotations: {}
Sequence Data:
MKLKKTIGAMALATLFATMGASAVEKTISVTASVDPTVDLLQSDGSALPNSVALTYSPAVNNFEAHTINTVVHTNDSD
KGVVVKLSADPVLSNVLNPTLQIPVSVNFAGKPLSTTGITIDSNDLNFASSGVNKVSSTQKLSIHADATRVTGGALTA
GQYQGLVSIILTKSTTTTTTTKGT
Sequence Alphabet: SingleLetterAlphabet()
Id: sp|P15488|FMS3_ECOLI
Name: sp|P15488|FMS3_ECOLI
Decription: sp|P15488|FMS3_ECOLI CS3 fimbrial subunit A precursor (CS3 pilin)
Annotations: {}
Sequence Data:
MLKIKYLLIGLSLSAMSSYSLAAAGPTLTKELALNVLSPAALDATWAPQDNLTLSNTGVSNTLVGVLTLSNTSIDTVS
IASTNVSDTSKNGTVTFAHETNNSASFATTISTDNANITLDKNAGNTIVKTTNGSQLPTNLPLKFITTEGNEHLVSGN
YRANITITSTIKGGGTKKGTTDKK
Sequence Alphabet: SingleLetterAlphabet()
We have seen three classes, parse, SeqRecord and Seq in this example. These three
classes provide most of the functionality and we will learn those classes in the coming
section.
7
4. Biopython – Sequence BioPython
Here, we have created a simple protein sequence AGCT and each letter represents
Alanine, Glycine, Cysteine and Threonine.
alphabet – used to represent the type of sequence. e.g. DNA sequence, RNA
sequence, etc. By default, it does not represent any sequence and is generic in
nature.
Alphabet Module
Seq objects contain Alphabet attribute to specify sequence type, letters and possible
operations. It is defined in [Link] module. Alphabet can be defined as below:
SingleLetterAlphabet - Generic alphabet with letters of size one. It derives from Alphabet
and all other alphabets type derives from it.
8
BioPython
9
BioPython
Also, Biopython exposes all the bioinformatics related configuration data through
[Link] module. For example, IUPACData.protein_letters has the possible letters of
IUPACProtein alphabet.
Basic Operations
This section briefly explains about all the basic operations available in the Seq class.
Sequences are similar to python strings. We can perform python string operations like
slicing, counting, concatenation, find, split and strip in sequences.
>>> seq_string[0:2]
Seq('AG')
>>> seq_string[ : ]
Seq('AGCTAGCT')
>>> len(seq_string)
8
>>> seq_string.count('A')
2
10
BioPython
>>> seq1+seq2
Seq('AGCTTCGA', DNAAlphabet())
Here, the above two sequence objects, seq1, seq2 are generic DNA sequences and so
you can add them and produce new sequence. You can’t add sequences with incompatible
alphabets, such as a protein sequence and a DNA sequence as specified below:
To add two or more sequences, first store it in a python list, then retrieve it using ‘for
loop’ and finally add it together as shown below:
In the below section, various codes are given to get outputs based on the requirement.
11
BioPython
12
5. Biopython – Advanced Sequence Operations BioPython
In this chapter, we shall discuss some of the advanced sequence features provided by
Biopython.
Here, the complement() method allows to complement a DNA or RNA sequence. The
reverse_complement() method complements and reverses the resultant sequence from
left to right. It is shown below:
>>> nucleotide.reverse_complement()
Seq('GACTGACTTCGA', IUPACAmbiguousDNA())
13
BioPython
GC Content
Genomic DNA base composition (GC content) is predicted to significantly affect genome
functioning and species ecology. The GC content is the number of GC nucleotides divided
by the total nucleotides.
To get the GC nucleotide content, import the following module and perform the following
steps:
Transcription
Transcription is the process of changing DNA sequence into RNA sequence. The actual
biological transcription process is performing a reverse complement (TCAG → CUGA) to
get the mRNA considering the DNA as template strand. However, in bioinformatics and
so in Biopython, we typically work directly with the coding strand and we can get the
mRNA sequence by changing the letter T to U.
To get the DNA template strand, reverse_complement the back transcribed RNA as given
below:
>>> rna_seq.back_transcribe().reverse_complement()
Seq('ATACGATCGGCAT', IUPACUnambiguousDNA())
Translation
Translation is a process of translating RNA sequence to protein sequence. Consider a RNA
sequence as shown below:
14
BioPython
>>> rna_seq.translate()
Seq('MAIV', IUPACProtein())
It is possible in translate() method to stop at the first stop codon. To perform this, you
can assign to_stop=True in translate() as follows:
>>> [Link](to_stop=True)
Seq('MAIVMGR', IUPACProtein())
Here, the stop codon is not included in the resulting sequence because it does not contain
one.
Translation Table
The Genetic Codes page of the NCBI provides full list of translation tables used by
Biopython. Let us see an example for standard table to visualize the code:
15
BioPython
Biopython uses this table to translate the DNA to protein as well as to find the Stop codon.
16
6. Biopython – Sequence I/O Operations BioPython
Biopython provides a module, [Link] to read and write sequences from and to a file
(any stream) respectively. It supports nearly all file formats available in bioinformatics.
Most of the software provides different approach for different file formats. But, Biopython
consciously follows a single approach to present the parsed sequence data to the user
through its SeqRecord object.
SeqRecord
[Link] module provides SeqRecord to hold meta information of the sequence as
well as the sequence data itself as given below:
Let us understand the nuances of parsing the sequence file using real sequence file in
the coming sections.
FASTA
FASTA is the most basic file format for storing sequence data. Originally, FASTA is a
software package for sequence alignment of DNA and protein developed during the early
evolution of Bioinformatics and used mostly to search the sequence similarity.
Download and save this file into your Biopython sample directory as ‘[Link]’.
[Link] module provides parse() method to process sequence files and can be
imported as follows:
17
BioPython
parse() method contains two arguments, first one is file handle and second is file format.
Here, the parse() method returns an iterable object which returns SeqRecord on every
iteration. Being iterable, it provides lot of sophisticated and easy methods and let us see
some of the features.
next()
next() method returns the next item available in the iterable object, which we can be
used to get the first sequence as given below:
>>> first_seq_record =
next([Link](open('path/to/biopython/sample/[Link]'),'fasta'))
>>> first_seq_record.id
'gi|2765658|emb|Z78533.1|CIZ78533'
>>> first_seq_record.name
'gi|2765658|emb|Z78533.1|CIZ78533'
>>> first_seq_record.seq
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC',
SingleLetterAlphabet())
>>> first_seq_record.description
'gi|2765658|emb|Z78533.1|CIZ78533 [Link] 5.8S rRNA gene and ITS1 and ITS2
DNA'
>>> first_seq_record.annotations
{}
>>>
Here, seq_record.annotations is empty because the FASTA format does not support
sequence annotations.
list comprehension
We can convert the iterable object into list using list comprehension as given below:
>>> seq_iter =
[Link](open('path/to/biopython/sample/[Link]'),'fasta')
>>> all_seq = [seq_record for seq_record in seq_iter]
>>> len(all_seq)
94
>>>
18
BioPython
Here, we have used len method to get the total count. We can get sequence with
maximum length as follows:
>>> seq_iter =
[Link](open('path/to/biopython/sample/[Link]'),'fasta')
>>> max_seq = max(len(seq_record.seq) for seq_record in seq_iter)
>>> max_seq
789
>>>
>>> seq_iter =
[Link](open('path/to/biopython/sample/[Link]'),'fasta')
>>> seq_under_600 = [seq_record for seq_record in seq_iter if
len(seq_record.seq) < 600]
>>> for seq in seq_under_600:
... print([Link])
...
gi|2765606|emb|Z78481.1|PIZ78481
gi|2765605|emb|Z78480.1|PGZ78480
gi|2765601|emb|Z78476.1|PGZ78476
gi|2765595|emb|Z78470.1|PPZ78470
gi|2765594|emb|Z78469.1|PHZ78469
gi|2765564|emb|Z78439.1|PBZ78439
>>>
Writing a collection of SqlRecord objects (parsed data) into file is as simple as calling the
[Link] method as below:
This method can be effectively used to convert the format as specified below:
GenBank
It is a richer sequence format for genes and includes fields for various kinds of
annotations. Biopython provides an example GenBank file and it can be accessed at
<[Link] s/ls_orchid.gbk>.
Download and save file into your Biopython sample directory as ‘[Link]’
Since, Biopython provides a single function, parse to parse all bioinformatics format.
Parsing GenBank format is as simple as changing the format option in the parse method.
19
BioPython
next(parse(open('path/to/biopython/sample/[Link]'),'genbank'))
>>> seq_record.id
'Z78533.1'
>>> seq_record.name
'Z78533'
>>> seq_record.seq
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC',
IUPACAmbiguousDNA())
>>> seq_record.description
'[Link] 5.8S rRNA gene and ITS1 and ITS2 DNA'
>>> seq_record.annotations
{'molecule_type': 'DNA', 'topology': 'linear', 'data_file_division': 'PLN',
'date': '30-NOV-2006', 'accessions': ['Z78533'], 'sequence_version': 1, 'gi':
'2765658', 'keywords': ['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal
transcribed
spacer', 'ITS1', 'ITS2'], 'source': 'Cypripedium irapeanum', 'organism':
'Cypripedium irapeanum', 'taxonomy': ['Eukaryota', 'Viridiplantae',
'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta',
'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae',
'Cypripedioideae', 'Cypripedium'], 'references':
[Reference(title='Phylogenetics of the slipper orchids (Cypripedioideae:
Orchidaceae): nuclear rDNA ITS sequences', ...), Reference(title='Direct
Submission', ...)]}
20
7. Biopython – Sequence Alignments BioPython
Sequence alignment is the process of arranging two or more sequences (of DNA, RNA
or protein sequences) in a specific order to identify the region of similarity between them.
Identifying the similar region enables us to infer a lot of information like what traits are
conserved between species, how close different species genetically are, how species
evolve, etc. Biopython provides extensive support for sequence alignment.
Let us learn some of the important features provided by Biopython in this chapter:
Before starting to learn, let us download a sample sequence alignment file from the
Internet.
Step 2: Choose any one family having less number of seed value. It contains minimal
data and enables us to work easily with the alignment. Here, we have selected/clicked
PF18225 and it opens [Link] and shows complete details
about it, including sequence alignments.
Step 3: Go to alignment section and download the sequence alignment file in Stockholm
format (PF18225_seed.txt).
Let us try to read the downloaded sequence alignment file using [Link] as below:
Read alignment using read method. read method is used to read single alignment data
available in the given file. If the given file contain many alignment, we can use parse
method. parse method returns iterable alignment object similar to parse method in
[Link] module.
>>> print(alignment)
SingleLetterAlphabet() alignment with 6 rows and 65 columns
21
BioPython
MQNTPAERLPAIIEKAKSKHDINVWLLDRQGRDLLEQRVPAKVA...EGP B7RZ31_9GAMM/59-123
AKQRGIAGLEEWLHRLDHSEAIPIFLIDEAGKDLLEREVPADIT...KKP A0A0C3NPG9_9PROT/58-119
ARRHGQEYFQQWLERQPKKVKEQVFAVDQFGRELLGRPLPEDMA...KKP A0A143HL37_9GAMM/57-121
TRRHGPESFRFWLERQPVEARDRIYAIDRSGAEILDRPIPRGMA...NKP A0A0X3UC67_9GAMM/57-121
AINRNTQQLTQDLRAMPNWSLRFVYIVDRNNQDLLKRPLPPGIM...NRK B3PFT7_CELJU/62-126
AVNATEREFTERIRTLPHWARRNVFVLDSQGFEIFDRELPSPVA...NRT K4KEM7_SIMAS/61-125
>>>
We can also check the sequences (SeqRecord) available in the alignment as well as
below:
Multiple Alignments
In general, most of the sequence alignment files contain single alignment data and it is
enough to use read method to parse it. In multiple sequence alignment concept, two or
more sequences are compared for best subsequence matches between them and results
in multiple sequence alignment in a single file.
If the input sequence alignment format contains more than one sequence alignment,
then we need to use parse method instead of read method as specified below:
Here, parse method returns iterable alignment object and it can be iterated to get actual
alignments.
22
BioPython
Let us write an example to find the sequence alignment of two simple and hypothetical
sequences using pairwise module. This will help us understand the concept of sequence
alignment and how to program it using Biopython.
Step 1
Import the module pairwise2 with the command given below:
Step 2
Create two sequences, seq1 and seq2:
Step 3
Call method [Link] along with seq1 and seq2 to find the alignments
using the below line of code:
Here, globalxx method performs the actual work and finds all the best possible
alignments in the given sequences. Actually, Bio.pairwise2 provides quite a set of
methods which follows the below convention to find alignments in different scenarios.
Here, the sequence alignment type refers to the alignment type which may be global or
local. global type is finding sequence alignment by taking entire sequence into
consideration. local type is finding sequence alignment by looking into the subset of the
given sequences as well. This will be tedious but provides better idea about the similarity
between the given sequences.
X refers to matching score. The possible values are x (exact match), m (score
based on identical chars), d (user provided dictionary with character and match
score) and finally c (user defined function to provide custom scoring algorithm).
Y refers to gap penalty. The possible values are x (no gap penalties), s (same
penalties for both sequences), d (different penalties for each sequence) and
finally c (user defined function to provide custom gap penalties)
23
BioPython
So, localds is also a valid method, which finds the sequence alignment using local
alignment technique, user provided dictionary for matches and user provided gap penalty
for both sequences.
Here, blosum62 refers to a dictionary available in the pairwise2 module to provide match
score. -10 refers to gap open penalty and -1 refers to gap extension penalty.
Step 4
Loop over the iterable alignments object and get each individual alignment object and
print it.
Step 5
Bio.pairwise2 module provides a formatting method, format_alignment to better visualize
the result:
ACCGGT
| | ||
A-C-GT
Score=4
ACCGGT
|| ||
AC--GT
Score=4
ACCGGT
| || |
A-CG-T
Score=4
ACCGGT
|| | |
AC-G-T
Score=4
24
BioPython
>>>
Biopython also provides another module to do sequence alignment, Align. This module
provides a different set of API to simply the setting of parameter like algorithm, mode,
match score, gap penalties, etc., A simple look into the Align object is as follows:
ClustalW
MUSCLE
Let us write a simple example in Biopython to create sequence alignment through the
most popular alignment tool, ClustalW.
Step 3: Set cmd by calling ClustalwCommanLine with input file, [Link] available
in Biopython package.
25
BioPython
([Link]
[Link])
Step 4: Calling cmd() will run the clustalw command and give an output of the resultant
alignment file, [Link].
26
8. Biopython – Overview of BLAST BioPython
BLAST stands for Basic Local Alignment Search Tool. It finds regions of similarity
between biological sequences. Biopython provides [Link] module to deal with NCBI
BLAST operation. You can run BLAST in either local connection or over Internet
connection.
NCBIWW module provides qblast function to query the BLAST online version,
[Link] qblast supports all the parameters supported by
the online version.
To obtain any help about this module, use the below command and understand the
features:
>>> help([Link])
Help on function qblast in module [Link]:
Supports all parameters of the qblast API for Put and Get.
Please note that BLAST on the cloud supports the NCBI-BLAST Common
URL API ([Link] To
use this feature, please set url_base to
'[Link] and
format_object='Alignment'. For more details, please see
27
BioPython
[Link]
st
Usually, the arguments of the qblast function are basically analogous to different
parameters that you can set on the BLAST web page. This makes the qblast function easy
to understand as well as reduces the learning curve to use it.
Step 1: Create a file named blast_example.fasta in the Biopython directory and give
the below sequence information as input:
>sequence A
ggtaagtcctctagtacaaacacccccaatattgtgatataattaaaattatattcatat
tctgttgccagaaaaaacacttttaggctatattagagccatcttctttgaagcgttgtc
>sequence B
ggtaagtcctctagtacaaacacccccaatattgtgatataattaaaattatattcatat
tctgttgccagaaaaaacacttttaggctatattagagccatcttctttgaagcgttgtc
28
BioPython
Step 4: Now, call the qblast function passing sequence data as main parameter. The
other parameter represents the database (nt) and the internal program (blastn).
blast_results holds the result of our search. It can be saved to a file for later use and
also, parsed to get the details. We will learn how to do it in the coming section.
Step 5: The same functionality can be done using Seq object as well rather than using
the whole fasta file as shown below:
Now, call the qblast function passing Seq object, [Link] as main parameter.
Step 6: result_handle object will have the entire result and can be saved into a file for
later usage.
We will see how to parse the result file in the later section.
29
BioPython
Connecting BLAST
In general, running BLAST locally is not recommended due to its large size, extra effort
needed to run the software, and the cost involved. Online BLAST is sufficient for basic
and advanced purposes. Of course, sometime you may be required to install it locally.
Consider you are conducting frequent searches online which may require a lot of time
and high network volume and if you have proprietary sequence data or IP related issues,
then installing it locally is recommended.
Step 1: Download and install the latest blast binary using the given link:
[Link]
Step 2: Download and unpack the latest and necessary database using the below link:
[Link]
BLAST software provides lot of databases in their site. Let us download [Link] file from
the blast database site and unpack it into alu folder. This file is in FASTA format. To use
this file in our blast application, we need to first convert the file from FASTA format into
blast database format. BLAST provides makeblastdb application to do this conversion.
cd /path/to/alu
makeblastdb -in alu.n -parse_seqids -dbtype nucl -out alun
Running the above code will parse the input file, alu.n and create BLAST database as
multiple files [Link], [Link], etc. Now, we can query this database to find the
sequence.
We have installed the BLAST in our local server and also have sample BLAST database,
alun to query against it.
Step 3: Let us create a sample sequence file to query the database. Create a file
[Link] and put the below data into it.
>gnl|alu|Z15030_HSAL001056 (Alu-J)
AGGCTGGCACTGTGGCTCATGCTGAAATCCCAGCACGGCGGAGGACGGCGGAAGATTGCT
TGAGCCTAGGAGTTTGCGACCAGCCTGGGTGACATAGGGAGATGCCTGTCTCTACGCAAA
AGAAAAAAAAAATAGCTCTGCTGGTGGTGCATGCCTATAGTCTCAGCTATCAGGAGGCTG
GGACAGGAGGATCACTTGGGCCCGGGAGTTGAGGCTGTGGTGAGCCACGATCACACCACT
GCACTCCAGCCTGGGTGACAGAGCAAGACCCTGTCTCAAAACAAACAAATAA
>gnl|alu|D00596_HSAL003180 (Alu-Sx)
AGCCAGGTGTGGTGGCTCACGCCTGTAATCCCACCGCTTTGGGAGGCTGAGTCAGATCAC
CTGAGGTTAGGAATTTGGGACCAGCCTGGCCAACATGGCGACACCCCAGTCTCTACTAAT
AACACAAAAAATTAGCCAGGTGTGCTGGTGCATGTCTGTAATCCCAGCTACTCAGGAGGC
TGAGGCATGAGAATTGCTCACGAGGCGGAGGTTGTAGTGAGCTGAGATCGTGGCACTGTA
30
BioPython
CTCCAGCCTGGCGACAGAGGGAGAACCCATGTCAAAAACAAAAAAAGACACCACCAAAGG
TCAAAGCATA
>gnl|alu|X55502_HSAL000745 (Alu-J)
TGCCTTCCCCATCTGTAATTCTGGCACTTGGGGAGTCCAAGGCAGGATGATCACTTATGC
CCAAGGAATTTGAGTACCAAGCCTGGGCAATATAACAAGGCCCTGTTTCTACAAAAACTT
TAAACAATTAGCCAGGTGTGGTGGTGCGTGCCTGTGTCCAGCTACTCAGGAAGCTGAGGC
AAGAGCTTGAGGCTACAGTGAGCTGTGTTCCACCATGGTGCTCCAGCCTGGGTGACAGGG
CAAGACCCTGTCAAAAGAAAGGAAGAAAGAACGGAAGGAAAGAAGGAAAGAAACAAGGAG
AG
The sequence data are gathered from the alu.n file; hence, it matches with our database.
Step 4: BLAST software provides many applications to search the database and we use
blastn. blastn application requires minimum of three arguments, db, query and
out. db refers to the database against to search; query is the sequence to match and
out is the file to store results. Now, run the below command to perform this simple query:
Running the above command will search and give output in the [Link] file as given
below (partially data):
<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN"
"[Link]
<BlastOutput>
<BlastOutput_program>blastn</BlastOutput_program>
<BlastOutput_version>BLASTN 2.7.1+</BlastOutput_version>
<BlastOutput_reference>Zheng Zhang, Scott Schwartz, Lukas Wagner, and Webb
Miller (2000), "A greedy algorithm for aligning DNA sequences", J
Comput Biol 2000; 7(1-2):203-14.</BlastOutput_reference>
<BlastOutput_db>alun</BlastOutput_db>
<BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
<BlastOutput_query-def>gnl|alu|Z15030_HSAL001056 (Alu-J)</BlastOutput_query-
def>
<BlastOutput_query-len>292</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_expect>10</Parameters_expect>
<Parameters_sc-match>1</Parameters_sc-match>
<Parameters_sc-mismatch>-2</Parameters_sc-mismatch>
<Parameters_gap-open>0</Parameters_gap-open>
<Parameters_gap-extend>0</Parameters_gap-extend>
<Parameters_filter>L;m;</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>Query_1</Iteration_query-ID>
<Iteration_query-def>gnl|alu|Z15030_HSAL001056 (Alu-J)</Iteration_query-def>
<Iteration_query-len>292</Iteration_query-len>
<Iteration_hits>
<Hit>
31
BioPython
<Hit_num>1</Hit_num>
<Hit_id>gnl|alu|Z15030_HSAL001056</Hit_id>
<Hit_def>(Alu-J)</Hit_def>
<Hit_accession>Z15030_HSAL001056</Hit_accession>
<Hit_len>292</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>540.342</Hsp_bit-score>
<Hsp_score>292</Hsp_score>
<Hsp_evalue>4.55414e-156</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>292</Hsp_query-to>
<Hsp_hit-from>1</Hsp_hit-from>
<Hsp_hit-to>292</Hsp_hit-to>
<Hsp_query-frame>1</Hsp_query-frame>
<Hsp_hit-frame>1</Hsp_hit-frame>
<Hsp_identity>292</Hsp_identity>
<Hsp_positive>292</Hsp_positive>
<Hsp_gaps>0</Hsp_gaps>
<Hsp_align-len>292</Hsp_align-len>
<Hsp_qseq>AGGCTGGCACTGTGGCTCATGCTGAAATCCCAGCACGGCGGAGGACGGCGGAAGATTGCTTGAGCCTA
GGAGTTTGCGACCAGCCTGGGTGACATAGGGAGATGCCTGTCTCTACGCAAAAGAAAAAAAAAATAGCTCTGCTGGTG
GTGCATGCCTATAGTCTCAGCTATCAGGAGGCTGGGACAGGAGGATCACTTGGGCCCGGGAGTTGAGGCTGTGGTGAG
CCACGATCACACCACTGCACTCCAGCCTGGGTGACAGAGCAAGACCCTGTCTCAAAACAAACAAATAA</Hsp_qseq
>
<Hsp_hseq>AGGCTGGCACTGTGGCTCATGCTGAAATCCCAGCACGGCGGAGGACGGCGGAAGATTGCTTGAGCCTA
GGAGTTTGCGACCAGCCTGGGTGACATAGGGAGATGCCTGTCTCTACGCAAAAGAAAAAAAAAATAGCTCTGCTGGTG
GTGCATGCCTATAGTCTCAGCTATCAGGAGGCTGGGACAGGAGGATCACTTGGGCCCGGGAGTTGAGGCTGTGGTGAG
CCACGATCACACCACTGCACTCCAGCCTGGGTGACAGAGCAAGACCCTGTCTCAAAACAAACAAATAA</Hsp_hseq
>
<Hsp_midline>|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||</Hsp_m
idline>
</Hsp>
</Hit_hsps>
</Hit>
.........................
.........................
.........................
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>327</Statistics_db-num>
<Statistics_db-len>80506</Statistics_db-len>
<Statistics_hsp-len>16</Statistics_hsp-len>
<Statistics_eff-space>21528364</Statistics_eff-space>
<Statistics_kappa>0.46</Statistics_kappa>
<Statistics_lambda>1.28</Statistics_lambda>
<Statistics_entropy>0.85</Statistics_entropy>
32
BioPython
</Statistics>
</Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>
The above command can be run inside the python using the below code:
Here, the first one is a handle to the blast output and second one is the possible error
output generated by the blast command.
Since we have provided the output file as command line argument (out=“[Link]”)
and sets the output format as XML (outfmt=5), the output file will be saved in the current
working directory.
Now, open the file directly using python open method and use NCBIXML parse
method as given below:
33
BioPython
34
9. Biopython – Entrez Database BioPython
Entrez is an online search system provided by NCBI. It provides access to nearly all
known molecular biology databases with an integrated global query supporting Boolean
operators and field search. It returns results from all the databases with information like
the number of hits from each databases, records with links to the originating database,
etc.
Some of the popular databases which can be accessed through Entrez are listed below:
Pubmed
Pubmed Central
In addition to the above databases, Entrez provides many more databases to perform the
field search.
Biopython provides an Entrez specific module, [Link] to access Entrez database. Let
us learn how to access Entrez using Biopython in this chapter:
Next set your email to identify who is connected with the code given below:
35
BioPython
Now, call einfo function to find index term counts, last update, and available
links for each database as defined below:
The einfo method returns an object, which provides access to the information through its
read method as shown below:
<DbName>pubmed</DbName>
<DbName>protein</DbName>
<DbName>nuccore</DbName>
<DbName>ipg</DbName>
<DbName>nucleotide</DbName>
<DbName>nucgss</DbName>
<DbName>nucest</DbName>
<DbName>structure</DbName>
<DbName>sparcle</DbName>
<DbName>genome</DbName>
<DbName>annotinfo</DbName>
<DbName>assembly</DbName>
<DbName>bioproject</DbName>
<DbName>biosample</DbName>
<DbName>blastdbinfo</DbName>
<DbName>books</DbName>
<DbName>cdd</DbName>
<DbName>clinvar</DbName>
<DbName>clone</DbName>
<DbName>gap</DbName>
<DbName>gapplus</DbName>
<DbName>grasp</DbName>
<DbName>dbvar</DbName>
<DbName>gene</DbName>
<DbName>gds</DbName>
<DbName>geoprofiles</DbName>
<DbName>homologene</DbName>
<DbName>medgen</DbName>
<DbName>mesh</DbName>
<DbName>ncbisearch</DbName>
<DbName>nlmcatalog</DbName>
<DbName>omim</DbName>
<DbName>orgtrack</DbName>
<DbName>pmc</DbName>
<DbName>popset</DbName>
<DbName>probe</DbName>
<DbName>proteinclusters</DbName>
<DbName>pcassay</DbName>
36
BioPython
<DbName>biosystems</DbName>
<DbName>pccompound</DbName>
<DbName>pcsubstance</DbName>
<DbName>pubmedhealth</DbName>
<DbName>seqannot</DbName>
<DbName>snp</DbName>
<DbName>sra</DbName>
<DbName>taxonomy</DbName>
<DbName>biocollections</DbName>
<DbName>unigene</DbName>
<DbName>gencoll</DbName>
<DbName>gtr</DbName>
</DbList>
</eInfoResult>
The data is in XML format, and to get the data as python object, use [Link] method
as soon as [Link]() method is invoked:
Here, record is a dictionary which has one key, DbList as shown below:
>>> [Link]()
[u'DbList']
Accessing the DbList key returns the list of database names shown below:
>>> record[u'DbList']
['pubmed', 'protein', 'nuccore', 'ipg', 'nucleotide', 'nucgss',
'nucest', 'structure', 'sparcle', 'genome', 'annotinfo', 'assembly',
'bioproject', 'biosample', 'blastdbinfo', 'books', 'cdd', 'clinvar',
'clone', 'gap', 'gapplus', 'grasp', 'dbvar', 'gene', 'gds', 'geoprofiles',
'homologene', 'medgen', 'mesh', 'ncbisearch', 'nlmcatalog', 'omim',
'orgtrack', 'pmc', 'popset', 'probe', 'proteinclusters', 'pcassay',
'biosystems', 'pccompound', 'pcsubstance', 'pubmedhealth', 'seqannot',
'snp', 'sra', 'taxonomy', 'biocollections', 'unigene', 'gencoll', 'gtr']
>>>
Basically, Entrez module parses the XML returned by Entrez search system and provide
it as python dictionary and lists.
Search Database
To search any of one the Entrez databases, we can use [Link]() module. It
is defined below:
37
BioPython
If you want to search across database, then you can use [Link]. This is similar
to [Link] except it is enough to specify the keyword and skip the database
parameter.
38
BioPython
Fetch Records
Enterz provides a special method, efetch to search and download the full details of a
record from Entrez. Consider the following simple example:
>>> record
SeqRecord(seq=Seq('ATTTTTTACGAACCTGTGGAAATTTTTGGTTATGACAATAAATCTAGTTTAGTA...GA
A',
SingleLetterAlphabet()), id='EU490707.1', name='EU490707.1',
description='EU490707.1
Selenipedium aequinoctiale maturase K (matK) gene, partial cds; chloroplast',
dbxrefs=[])
39
10. Biopython – PDB Module BioPython
PDB files distributed by the Protein Data Bank may contain formatting errors that make
them ambiguous or difficult to parse. The [Link] module attempts to deal with these
errors automatically.
The [Link] module implements two different parsers, one is mmCIF format and second
one is pdb format.
Let us learn how to parser each of the format in detail:
mmCIF Parser
Let us download an example database in mmCIF format from pdb server using the below
command:
This will download the specified file ([Link]) from the server and store it in the current
working directory.
Here, PDBList provides options to list and download files from online PDB FTP server.
retrieve_pdb_file method needs the name of the file to be downloaded without extension.
retrieve_pdb_file also have option to specify download directory, pdir and format of the
file, file_format. The possible values of file format are as follows:
40
BioPython
Here, QUIET suppresses the warning during parsing the file. get_structure will parse
the file and return the structure with id as 2FAT (first argument).
After running the above command, it parses the file and prints possible warning, if
available.
>>> data
<Structure id=2FAT>
To get the type, use type method as specified below,
>>> print(type(data))
<class '[Link]'>
We have successfully parsed the file and got the structure of the protein. We will learn
the details of the protein structure and how to get it in the later chapter.
PDB Parser
Let us download an example database in PDB format from pdb server using the below
command:
This will download the specified file ([Link]) from the server and store it in the
current working directory.
Now, check the structure and its type with the code snippet given below:
>>> data
<Structure id=2fat>
>>> print(type(data))
<class '[Link]'>
Well, the header structure stores the dictionary information. To perform this, type the
below command:
41
BioPython
>>> print([Link]())
dict_keys(['name', 'head', 'deposition_date', 'release_date',
'structure_method', 'resolution', 'structure_reference', 'journal_reference',
'author', 'compound', 'source', 'keywords', 'journal'])
>>>
>>> print([Link]["name"])
an anti-urokinase plasminogen activator receptor (upar) antibody: crystal
structure and binding epitope
>>>
You can also check the date and resolution with the below code:
>>> print([Link]["release_date"])
2006-11-14
>>> print([Link]["resolution"])
1.77
PDB Structure
PDB structure is composed of a single model, containing two chains.
Each residue is composed of multiple atoms, each having a 3D position represented by (x, y,
z) coordinates.
Let us learn how to get the structure of the atom in detail in the below section:
Model
The Structure.get_models() method returns an iterator over the models. It is defined
below:
Here, a Model describes exactly one 3D conformation. It contains one or more chains.
42
BioPython
Chain
The Model.get_chain() method returns an iterator over the chains. It is defined below:
Residue
The Chain.get_residues() method returns an iterator over the residues. It is defined
below:
Atoms
The Residue.get_atom() returns an iterator over the atoms as defined below:
An atom holds the 3D coordinate of an atom and it is called a Vector. It is defined below:
>>> atoms[0].get_vector()
<Vector 18.49, 73.26, 44.16>
43
11. Biopython – Motif Objects BioPython
>>> print([Link])
0 1 2 3
A: 2.00 1.00 0.00 1.00
C: 0.00 1.00 2.00 0.00
G: 0.00 1.00 1.00 0.00
T: 1.00 0.00 0.00 2.00
>>> [Link]["A", :]
(2, 1, 0, 1)
If you want to access the columns of counts, use the below command:
>>> [Link][:, 3]
{'A': 1, 'C': 0, 'T': 2, 'G': 0}
44
BioPython
AGCTTACG
ATCGTACC
TTCCGAAT
GGTACGTA
AAGCTTGG
You can create your own logo using the following link:
[Link]
Add the above sequence and create a new logo and save the image named [Link] in
your biopython folder.
[Link]
>>> [Link]("[Link]")
This DNA sequence motif is represented as a sequence logo for the LexA-binding motif.
JASPAR Database
JASPAR is one of the most popular databases. It provides facilities of any of the motif
formats for reading, writing and scanning sequences. It stores meta-information for each
motif. The module [Link] contains a specialized class [Link] to
represent meta-information attributes.
45
BioPython
[Link]
>MA0001 ARNT 1
AACGTGatgtccta
>MA0001 ARNT 2
CAGGTGggatgtac
>MA0001 ARNT 3
TACGTAgctcatgc
>MA0001 ARNT 4
AACGTGacagcgct
>MA0001 ARNT 5
CACGTGcacgtcgt
>MA0001 ARNT 6
cggcctCGCGTGc
In the above file, we have created motif instances. Now, let us create a motif object from
the above instances:
Here, data reads all the motif instances from [Link] file.
To print all the instances from data, use the below command:
46
BioPython
>>> print([Link])
0 1 2 3 4 5
A: 2.00 5.00 0.00 0.00 0.00 1.00
C: 3.00 0.00 5.00 0.00 0.00 0.00
G: 0.00 1.00 1.00 6.00 0.00 5.00
T: 1.00 0.00 0.00 0.00 6.00 0.00
>>>
47
12. Biopython – BioSQL Module BioPython
BioSQL is a generic database schema designed mainly to store sequences and its related
data for all RDBMS engine. It is designed in such a way that it holds the data from all
popular bioinformatics databases like GenBank, Swissport, etc. It can be used to store
in-house data as well.
MySQL ([Link])
PostgreSQL ([Link])
Oracle (biosqldb-ora/*.sql)
SQLite ([Link])
It also provides minimal support for Java based HSQLDB and Derby databases.
BioPython provides very simple, easy and advanced ORM capabilities to work with BioSQL
based database. BioPython provides a module, BioSQL to do the following
functionality:
biodatabase
bioentry
biosequence
seqfeature
taxon
taxon_name
antology
term
48
BioPython
dxref
Here, we shall create a SQLite based BioSQL database using the below steps.
cd /path/to/your/biopython/sample
mkdir sqlite-biosql
cd sqlite-biosql
Step 5: Copy the [Link] file from the BioSQL project (/sql/biosqldb-
[Link]`) and store it in the current directory.
Step 6: Run the below command to create all the tables.
Step 7: Run the below command to see all the new tables in our database.
sqlite> .headers on
sqlite> .mode column
sqlite> .separator ROW "\n"
sqlite> SELECT name FROM sqlite_master WHERE type='table';
biodatabase
taxon
taxon_name
ontology
term
term_synonym
term_dbxref
term_relationship
term_relationship_term
term_path
49
BioPython
bioentry
bioentry_relationship
bioentry_path
biosequence
dbxref
dbxref_qualifier_value
bioentry_dbxref
reference
bioentry_reference
comment
bioentry_qualifier_value
seqfeature
seqfeature_relationship
seqfeature_path
seqfeature_qualifier_value
seqfeature_dbxref
location
location_qualifier_value
sqlite>
The first three commands are configuration commands to configure SQLite to show the
result in a formatted manner.
Step 8: Copy the sample GenBank file, ls_orchid.gbk provided by BioPython team
[Link]
[Link] into the current directory and save it as [Link].
Step 9: Create a python script, load_orchid.py using the below code and execute it.
db = server.new_database("orchid")
count = [Link]([Link]("[Link]", "gb"), True)
[Link]()
[Link]()
The above code parses the record in the file and converts it into python objects and
inserts it into BioSQL database. We will analyze the code in later section.
Finally, we created a new BioSQL database and load some sample data into it. We shall
discuss the important tables in the next chapter.
50
BioPython
Simple ER Diagram
biodatabase table is in the top of the hierarchy and its main purpose is to organize a
set of sequence data into a single group/virtual database. Every entry in the
biodatabase refers to a separate database and it does not mingle with another
database. All the related tables in the BioSQL database have references to biodatabase
entry.
bioentry table holds all the details about a sequence except the sequence data. sequence
data of a particular bioentry will be stored in biosequence table.
taxon and taxon_name are taxonomy details and every entry refers this table to specify
its taxon information.
After understanding the schema, let us look into some queries in the next section.
BioSQL Queries
Let us delve into some SQL queries to better understand how the data are organized and
the tables are related to each other. Before proceeding, let us open the database using
the below command and set some formatting commands:
.header and .mode are formatting options to better visualize the data. You can
also use any SQLite editor to run the query.
List the virtual sequence database available in the system as given below:
51
BioPython
select
*
from
biodatabase;
*** Result ***
sqlite> .width 15 15 15 15
sqlite> select * from biodatabase;
biodatabase_id name authority description
--------------- --------------- --------------- ---------------
1 orchid
sqlite>
List the entries (top 3) available in the database orchid with the below given code:
select
be.*,
[Link]
from
bioentry be
inner join
biodatabase bd
on bd.biodatabase_id = be.biodatabase_id
where
[Link] = 'orchid' Limit 1,
3;
*** Result ***
sqlite> .width 15 15 10 10 10 10 10 50 10 10
sqlite> select be.*, [Link] from bioentry be inner join biodatabase bd on
bd.biodatabase_id = be.biodatabase_id where [Link] = 'orchid' Limit 1,3;
bioentry_id biodatabase_id taxon_id name accession
identifier division description
version name
--------------- --------------- ---------- ---------- ---------- --------
-- ---------- -------------------------------------------------- ----------
----------
2 1 19 Z78532 Z78532 2765657
PLN [Link] 5.8S rRNA gene and ITS1 and ITS2 DN 1
orchid
3 1 20 Z78531 Z78531 2765656
PLN [Link] 5.8S rRNA gene and ITS1 and ITS2 DN 1
orchid
4 1 21 Z78530 Z78530 2765655
PLN [Link] 5.8S rRNA gene and ITS1 and ITS2 D 1
orchid
sqlite>
52
BioPython
List the sequence details associated with an entry (accession: Z78530, name: C.
fasciculatum 5.8S rRNA gene and ITS1 and ITS2 DNA) with the given code:
select
substr(cast([Link] as varchar), 0, 10) || '...' as seq,
[Link],
[Link],
[Link],
[Link]
from
biosequence bs
inner join
bioentry be
on be.bioentry_id = bs.bioentry_id
inner join
biodatabase bd
on bd.biodatabase_id = be.biodatabase_id
where
[Link] = 'orchid'
and [Link] = 'Z78532';
*** Result ***
sqlite> .width 15 5 10 50 10
sqlite> select substr(cast([Link] as varchar), 0, 10) || '...' as seq,
[Link], [Link], [Link], [Link] from biosequence bs inner
join bioentry be on be.bioentry_id = bs.bioentry_id inner join biodatabase bd
on bd.biodatabase_id = be.biodatabase_id where [Link] = 'orchid' and
[Link] = 'Z78532';
seq length accession description
name
------------ ---------- ---------- ----------------------------------------
----------- ----------
CGTAACAAG... 753 Z78532 [Link] 5.8S rRNA gene and ITS1
and ITS2 DNA orchid
sqlite>
Get the complete sequence associated with an entry (accession: Z78530, name: C.
fasciculatum 5.8S rRNA gene and ITS1 and ITS2 DNA) using the below code:
select
[Link]
from
biosequence bs
inner join
bioentry be
on be.bioentry_id = bs.bioentry_id
inner join
biodatabase bd
on bd.biodatabase_id = be.biodatabase_id
where
[Link] = 'orchid'
and [Link] = 'Z78532';
*** Result ***
53
BioPython
select distinct
[Link]
from
biodatabase d
inner join
bioentry e
on e.biodatabase_id = d.biodatabase_id
inner join
taxon t
on t.taxon_id = e.taxon_id
inner join
taxon_name tn
on tn.taxon_id = t.taxon_id
where
[Link] = 'orchid' limit 10;
*** Result ***
sqlite> select distinct [Link] from biodatabase d inner join bioentry e on
e.biodatabase_id = d.biodatabase_id inner join taxon t on t.taxon_id =
e.taxon_id inner join taxon_name tn on tn.taxon_id = t.taxon_id where [Link] =
'orchid' limit 10;
name
------------------------------
Cypripedium irapeanum
Cypripedium californicum
Cypripedium fasciculatum
Cypripedium margaritaceum
Cypripedium lichiangense
Cypripedium yatabeanum
Cypripedium guttatum
Cypripedium acaule
pink lady's slipper
Cypripedium formosanum
sqlite>
54
BioPython
server.load_database_sql(SQL_FILE)
[Link]()
db = server.new_database("orchid")
count = [Link]([Link]("[Link]", "gb"), True)
[Link]()
[Link]()
We will have a deeper look at every line of the code and its purpose:
Line 2: Loads the BioSeqDatabase module. This module provides all the functionality to
interact with BioSQL database.
Line 5: open_database opens the specified database (db) with the configured driver
(driver) and returns a handle to the BioSQL database (server). Biopython supports sqlite,
mysql, postgresql and oracle databases.
Line 6-10: load_database_sql method loads the sql from the external file and executes
it. commit method commits the transaction. We can skip this step because we already
created the database with schema.
Line 12: new_database methods creates new virtual database, orchid and returns a
handle db to execute the command against the orchid database.
Line 13: load method loads the sequence entries (iterable SeqRecord) into the orchid
database. [Link] parses the GenBank database and returns all the sequences in it
as iterable SeqRecord. Second parameter (True) of the load method instructs it to fetch
the taxonomy details of the sequence data from NCBI blast website, if it is not already
available in the system.
Line 15: close closes the database connection and destroys the server handle.
55
BioPython
db = server["orchid"]
seq_record = [Link](gi=2765658)
print(seq_record.id, seq_record.description[:50] + "...")
print("Sequence length %i," % len(seq_record.seq))
Here, server["orchid"] returns the handle to fetch data from virtual databaseorchid.
lookup method provides an option to select sequences based on criteria and we have
selected the sequence with identifier, 2765658. lookup returns the sequence information
as SeqRecordobject. Since, we already know how to work with SeqRecord`, it is easy to
get data from it.
Remove a Database
Removing a database is as simple as calling remove_database method with proper
database name and then committing it as specified below:
56
13. Biopython – Population Genetics BioPython
Population genetics plays an important role in evolution theory. It analyses the genetic
difference between species as well as two or more individuals within the same species.
Biopython provides [Link] module for population genetics and mainly supports
`GenePop, a popular genetics package developed by Michel Raymond and Francois
Rousset.
A simple parser
Let us write a simple application to parse the GenePop format and understand the
concept.
Download the genePop file provided by Biopython team in the link given below:
[Link]
en
record = [Link](open("[Link]"))
>>> record.loci_list
['136255903', '136257048', '136257636']
>>> record.pop_list
['4', 'b3', '5']
>>> [Link]
[[('1', [(3, 3), (4, 4), (2, 2)]), ('2', [(3, 3), (3, 4), (2, 2)]), ('3', [(3,
3), (4, 4), (2, 2)]), ('4', [(3, 3), (4,
3), (None, None)])], [('b1', [(None, None), (4, 4), (2, 2)]), ('b2', [(None,
None), (4, 4), (2, 2)]), ('b3', [(None, None), (4, 4), (2, 2)])], [('1', [(3,
3), (4, 4), (2, 2)]), ('2', [(3, 3), (1, 4), (2, 2)]), ('3', [(3, 2), (1, 1),
(2, 2)]), ('4', [(None, None), (4, 4), (2, 2)]), ('5', [(3, 3), (4, 4), (2,
2)])]]
>>>
Here, there are three loci available in the file and three sets of population: First population
has 4 records, second population has 3 records and third population has 5 records.
[Link] shows all sets of population with alleles data for each locus.
57
BioPython
>>> record.remove_population(0)
>>> [Link]
[[('b1', [(None, None), (4, 4), (2, 2)]), ('b2', [(None, None), (4, 4), (2,
2)]), ('b3', [(None, None), (4, 4), (2, 2)])], [('1', [(3, 3), (4, 4), (2,
2)]), ('2', [(3, 3), (1, 4), (2, 2)]), ('3', [(3, 2), (1, 1), (2, 2)]), ('4',
[(None, None), (4, 4), (2, 2)]), ('5', [(3, 3), (4, 4), (2, 2)])]]
>>>
>>> record.remove_locus_by_position(0)
>>> record.loci_list
['136257048', '136257636']
>>> [Link]
[[('b1', [(4, 4), (2, 2)]), ('b2', [(4, 4), (2, 2)]), ('b3', [(4, 4), (2,
2)])], [('1', [(4, 4), (2, 2)]), ('2', [(1, 4), (2, 2)]), ('3', [(1, 1), (2,
2)]), ('4', [(4, 4), (2, 2)]), ('5', [(4, 4), (2, 2)])]]
>>>
>>> record.remove_locus_by_name('136257636')
>>> record.loci_list
['136257048']
>>> [Link]
[[('b1', [(4, 4)]), ('b2', [(4, 4)]), ('b3', [(4, 4)])], [('1', [(4, 4)]),
('2', [(1, 4)]), ('3', [(1, 1)]), ('4', [(4,
4)]), ('5', [(4, 4)])]]
>>>
First, install the GenePop software and place the installation folder in the system path.
To get basic information about GenePop file, create a EasyController object and then call
get_basic_info method as specified below:
Here, the first item is population list and second item is loci list.
58
BioPython
To get all allele list of a particular locus, call get_alleles_all_pops method by passing locus
name as specified below:
To get allele list by specific population and locus, call get_alleles by passing locus name
and population position as given below:
59
14. Biopython – Genome Analysis BioPython
A genome is complete set of DNA, including all of its genes. Genome analysis refers to
the study of individual genes and their roles in inheritance.
Genome Diagram
Genome diagram represents the genetic information as charts. Biopython uses
[Link] module to represent GenomeDiagram. The
GenomeDiagram module requires ReportLab to be installed.
Create a FeatureSet for each separate set of features you want to display, and
add [Link] objects to them.
Create a GraphSet for each graph you want to display, and add graph data to
them.
Create a Track for each track you want on the diagram, and add GraphSets and
FeatureSets to the tracks you require.
Create a Diagram, and add the Tracks to it.
Tell the Diagram to draw the image.
Write the image to a file.
[Link]
[Link] and read records from SeqRecord object then finally draw a genome diagram. It is
explained below,
60
BioPython
Now, we can apply color theme changes using alternative colors from green to grey as
defined below:
After executing the above command, you could see the following image saved in your
Biopython directory.
** Result **
[Link]
61
BioPython
You can also draw the image in circular format by making the below changes:
Chromosomes Overview
DNA molecule is packaged into thread-like structures called chromosomes. Each
chromosome is made up of DNA tightly coiled many times around proteins called histones
that support its structure.
Chromosomes are not visible in the cell’s nucleus — not even under a microscope —when
the cell is not dividing. However, the DNA that makes up chromosomes becomes more
tightly packed during cell division and is then visible under a microscope.
In humans, each cell normally contains 23 pairs of chromosomes, for a total of 46.
Twenty-two of these pairs, called autosomes, look the same in both males and females.
The 23rd pair, the sex chromosomes, differ between males and females. Females have
two copies of the X chromosome, while males have one X and one Y chromosome.
62
15. Biopython – Phenotype Microarray BioPython
Parsing
Phenotype microarray data can be in two formats: CSV and JSON. Biopython supports
both the formats. Biopython parser parses the phenotype microarray data and returns
as a collection of PlateRecord objects. Each PlateRecord object contains a collection of
WellRecord objects. Each WellRecord object holds data in 8 rows and 12 columns format.
The eight rows are represented by A to H and 12 columns are represented by 01 to 12.
For example, 4th row and 6th column are represented by D06.
Let us understand the format and the concept of parsing with the following example:
[Link]
sv
Step 3: Invoke [Link] method passing the data file and format option (“pm-
csv”). It returns the iterable PlateRecord as below,
63
BioPython
WellRecord['H12']')
>>>
Step 5: As discussed earlier, a plate contains 8 rows each having 12 items. WellRecord
can be access in two ways as specified below:
Step 6: Each well will have series of measurement at different time points and it can be
accessed using for loop as specified below:
Interpolation
Interpolation gives more insight into the data. Biopython provides methods to interpolate
WellRecord data to get information for intermediate time points. The syntax is similar to
list indexing and so, easy to learn.
To get the data at 20.1 hours, just pass as index values as specified below:
>>> well[20.10]
69.40000000000003
>>>
We can pass start time point and end time point as well as specified below:
>>> well[20:30]
[67.0, 84.0, 102.0, 119.0, 135.0, 147.0, 158.0, 168.0, 179.0, 186.0]
>>>
The above command interpolate data from 20 hour to 30 hours with 1 hour interval. By
default, the interval is 1 hour and we can change it to any value. For example, let us give
15 minutes (0.25 hour) interval as specified below:
64
BioPython
>>> well[Link].25]
[67.0, 73.0, 75.0, 81.0]
>>>
>>> [Link]()
Traceback (most recent call last):
...
[Link]: Install scipy to extract curve parameters.
>>> [Link]
>>> getattr(well, 'min')
0.0
>>> getattr(well, 'max')
388.0
>>> getattr(well, 'average_height')
205.42708333333334
>>>
Biopython depends on scipy module to do advanced analysis. It will calculate min, max
and average_height details without using scipy module.
65
16. Biopython – Plotting BioPython
This chapter explains about how to plot sequences. Before moving to this topic, let us
understand the basics of plotting.
Plotting
Matplotlib is a Python plotting library which produces quality figures in a variety of
formats. We can create different types of plots like line chart, histograms, bar chart, pie
chart, scatter chart, etc.
pyLab is a module that belongs to the matplotlib which combines the numerical
module numpy with the graphical plotting module pyplot. Biopython uses pylab
module for plotting sequences. To do this, we need to import the below code:
import pylab
Before importing, we need to install the matplotlib package using pip command with the
command given below:
>seq0
FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF
>seq1
KYRTWEEFTRAAEKLYQADPMKVRVVLKYRHCDGNLCIKVTDDVVCLLYRTDQAQDVKKIEKFHSQLMRLME
>seq2
EEYQTWEEFARAAEKLYLTDPMKVRVVLKYRHCDGNLCMKVTDDAVCLQYKTDQAQDVKKVEKLHGK
>seq3
MYQVWEEFSRAVEKLYLTDPMKVRVVLKYRHCDGNLCIKVTDNSVCLQYKTDQAQDVK
>seq4
EEFSRAVEKLYLTDPMKVRVVLKYRHCDGNLCIKVTDNSVVSYEMRLFGVQKDNFALEHSLL
>seq5
SWEEFAKAAEVLYLEDPMKCRMCTKYRHVDHKLVVKLTDNHTVLKYVTDMAQDVKKIEKLTTLLMR
>seq6
FTNWEEFAKAAERLHSANPEKCRFVTKYNHTKGELVLKLTDDVVCLQYSTNQLQDVKKLEKLSSTLLRSI
>seq7
SWEEFVERSVQLFRGDPNATRYVMKYRHCEGKLVLKVTDDRECLKFKTDQAQDAKKMEKLNNIFF
>seq8
SWDEFVDRSVQLFRADPESTRYVMKYRHCDGKLVLKVTDNKECLKFKTDQAQEAKKMEKLNNIFFTLM
>seq9
KNWEDFEIAAENMYMANPQNCRYTMKYVHSKGHILLKMSDNVKCVQYRAENMPDLKK
66
BioPython
>seq10
FDSWDEFVSKSVELFRNHPDTTRYVVKYRHCEGKLVLKVTDNHECLKFKTDQAQDAKKMEK
Line Plot
Now, let us create a simple line plot for the above fasta file.
>>> [Link]("count")
Text(0, 0.5, 'count')
>>>
>>> [Link]()
Step 6: Draw simple line chart by calling plot method and supplying records as input.
>>> [Link](records)
[<[Link].Line2D object at 0x10b6869d 0>]
>>> [Link]("[Link]")
67
BioPython
Result
After executing the above command, you could see the following image saved in your
Biopython directory.
Histogram Chart
A histogram is used for continuous data, where the bins represent ranges of data.
Drawing histogram is same as line chart except [Link]. Instead, call hist method of
pylab module with records and some custum value for bins (5). The complete coding is
as follows:
68
BioPython
>>> [Link]("count")
Text(0, 0.5, 'count')
>>>
>>> [Link]()
Step 6: Draw simple line chart by calling plot method and supplying records as input.
>>> [Link](records,bins=5)
(array([2., 3., 1., 3., 2.]), array([57., 60., 63., 66., 69., 72.]), <a list
of 5 Patch objects>)
>>>
>>> [Link]("[Link]")
Result
After executing the above command, you could see the following image saved in your
Biopython directory.
69
BioPython
GC Percentage in Sequence
GC percentage is one of the commonly used analytic data to compare different
sequences. We can do a simple line chart using GC Percentage of a set of sequences and
immediately compare it. Here, we can just change the data from sequence length to GC
percentage. The complete coding is given below:
>>> [Link]("Genes")
Text(0.5, 0, 'Genes')
>>> [Link]()
Step 6: Draw simple line chart by calling plot method and supplying records as input.
>>> [Link](gc)
[<[Link].Line2D object at 0x10b6869d 0>]
>>> [Link]("[Link]")
70
BioPython
Result
After executing the above command, you could see the following image saved in your
Biopython directory.
71
17. Biopython – Cluster Analysis BioPython
In general, Cluster analysis is grouping a set of objects in the same group. This concept
is mainly used in data mining, statistical data analysis, machine learning, pattern
recognition, image analysis, bioinformatics, etc. It can be achieved by various algorithms
to understand how the cluster is widely used in different analysis.
In this chapter, we will check out important algorithms in Biopython to understand the
fundamentals of clustering on a real dataset.
Biopython uses [Link] module for implementing all the algorithms. It supports the
following algorithms:
Hierarchical Clustering
K - Clustering
Self-Organizing Maps
Hierarchical Clustering
Hierarchical clustering is used to link each node by a distance measure to its nearest
neighbor and create a cluster. [Link] node has three attributes: left, right and
distance. Let us create a simple cluster as shown below:
If you want to construct Tree based clustering, use the below command:
The above function returns a Tree cluster object. This object contains nodes where the
number of items are clustered as rows or columns.
K - Clustering
It is a type of partitioning algorithm and classified into k - means, medians and medoids
clustering. Let us understand each of the clustering in brief.
K-means Clustering
This approach is popular in data mining. The goal of this algorithm is to find groups in
the data, with the number of groups represented by the variable K.
The algorithm works iteratively to assign each data point to one of the K groups based
on the features that are provided. Data points are clustered based on feature similarity.
K-medians Clustering
It is another type of clustering algorithm which calculates the mean for each cluster to
determine its centroid.
K-medoids Clustering
This approach is based on a given set of items, using the distance matrix and the number
of clusters passed by the user.
73
BioPython
The kcluster function takes a data matrix as input and not Seq instances. You need to
convert your sequences to a matrix and provide that to the kcluster function.
One way of converting the data to a matrix containing numerical elements only is by
using the [Link] function. It basically translates each letter in a sequence
to its ASCII counterpart.
This creates a 2D array of encoded sequences that the kcluster function recognized and
uses to cluster your sequences.
Self-Organizing Maps
This approach is a type of artificial neural network. It is developed by Kohonen and often
called as Kohonen map. It organizes items into clusters based on rectangular topology.
Let us create a simple cluster using the same array distance as shown below:
>>> print(map)
[[[-1.36032469 0.38667395]]
[[-0.41170578 1.35295911]]]
>>> print(clusterid)
[[1 0]
[1 0]
[1 0]]
Here, clusterid is an array with two columns, where the number of rows is equal to the
number of items that were clustered, and data is an array with dimensions either rows
or columns.
74
BioPython
# define a matrix
>>> A = array([[1, 2], [3, 4], [5, 6]])
>>> print(A)
[[1 2]
[3 4]
[5 6]]
>>> print(C)
[[-2. -2.]
[ 0. 0.]
[ 2. 2.]]
>>> print(V)
[[ 4. 4.]
[ 4. 4.]]
>>> print(vectors)
[[ 0.70710678 -0.70710678]
[ 0.70710678 0.70710678]]
>>> print(values)
[ 8. 0.]
75
BioPython
Let us apply the same rectangular matrix data to [Link] module as defined below:
76
18. Biopython – Machine Learning BioPython
Supervised learning is based on input variable (X) and output variable (Y). It uses an
algorithm to learn the mapping function from the input to the output. It is defined below:
Y = f(X)
The main objective of this approach is to approximate the mapping function and when
you have new input data (x), you can predict the output variables (Y) for that data.
k-Nearest Neighbors
k-Nearest neighbors is also a supervised machine learning algorithm. It works by
categorizing the data based on nearest neighbors. Biopython provides [Link] module
to predict variables based on k-nearest neighbors algorithm.
Naive Bayes
Naive Bayes classifiers are a collection of classification algorithms based on Bayes’
Theorem. It is not a single algorithm but a family of algorithms where all of them share
a common principle, i.e. every pair of features being classified is independent of each
other. Biopython provides [Link] module to work with Naive Bayes algorithm.
Markov Model
A Markov model is a mathematical system defined as a collection of random variables,
that experiences transition from one state to another according to certain probabilistic
rules. Biopython provides [Link] and [Link] modules to
work with Markov models.
77
19. Biopython – Testing Techniques BioPython
Biopython have extensive test script to test the software under different conditions to
make sure that the software is bug-free. To run the test script, download the source code
of the Biopython and then run the below command:
python run_tests.py
This will run all the test scripts and gives the following output:
python test_AlignIO.py
Conclusion
As we have learned, Biopython is one of the important software in the field of
bioinformatics. Being written in python (easy to learn and write), It provides extensive
functionality to deal with any computation and operation in the field of bioinformatics. It
also provides easy and flexible interface to almost all the popular bioinformatics software
to exploit the its functionality as well.
78