Computational Methods For GPCR Drug Discovery PDF
Computational Methods For GPCR Drug Discovery PDF
Alexander Heifetz
Editor
Computational
Methods
for GPCR Drug
Discovery
METHODS IN MOLECULAR BIOLOGY
Series Editor
John M. Walker
School of Life and Medical Sciences
University of Hertfordshire
Hatfield, Hertfordshire, AL10 9AB, UK
Edited by
Alexander Heifetz
Evotec (UK) Ltd., Abingdon, Oxfordshire, UK
Editor
Alexander Heifetz
Evotec (UK) Ltd.
Abingdon, Oxfordshire, UK
v
Contents
Preface . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . v
Contributors. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ix
1 Current and Future Challenges in GPCR Drug Discovery . . . . . . . . . . . . . . . . . . . 1
Sid Topiol
2 Characterization of Ligand Binding to GPCRs
Through Computational Methods . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
Silvana Vasile, Mauricio Esguerra, Willem Jespers, Ana Oliveira,
Jessica Sallander, Johan Åqvist, and Hugo Gutiérrez-de-Terán
3 Breakthrough in GPCR Crystallography and Its Impact
on Computer-Aided Drug Design . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45
Antonella Ciancetta and Kenneth A. Jacobson
4 A Structural Framework for GPCR Chemogenomics:
What’s In a Residue Number? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73
Márton Vass, Albert J. Kooistra, Stefan Verhoeven,
David Gloriam, Iwan J.P. de Esch, and Chris de Graaf
5 GPCR Homology Model Generation for Lead Optimization . . . . . . . . . . . . . . . . . 115
Christofer S. Tautermann
6 GPCRs: What Can We Learn from Molecular Dynamics Simulations? . . . . . . . . . 133
Naushad Velgy, George Hedger, and Philip C. Biggin
7 Methods of Exploring Protein–Ligand Interactions to Guide
Medicinal Chemistry Efforts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 159
Paul Labute
8 Exploring GPCR-Ligand Interactions with the Fragment
Molecular Orbital (FMO) Method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 179
Ewa I. Chudyk, Laurie Sarrat, Matteo Aldeghi, Dmitri G. Fedorov,
Mike J. Bodkin, Tim James, Michelle Southey, Roger Robinson,
Inaki Morao, and Alexander Heifetz
9 Molecular Basis of Ligand Dissociation from G Protein-Coupled
Receptors and Predicting Residence Time. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 197
Dong Guo and Adriaan P. IJzerman
10 Methodologies for the Examination of Water in GPCRs . . . . . . . . . . . . . . . . . . . . . 207
Andrea Bortolato, Benjamin G. Tehan, Robert T. Smith,
and Jonathan S. Mason
11 Methods for Virtual Screening of GPCR Targets: Approaches
and Challenges . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 233
Jason B. Cross
12 Approaches for Differentiation and Interconverting GPCR
Agonists and Antagonists . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 265
Przemysław Miszta, Jakub Jakowiecki, Ewelina Rutkowska
Maria Turant, Dorota Latek, and Sławomir Filipek
vii
viii Contents
Index . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 431
Contributors
ix
x Contributors
Abstract
GPCRs play a pervasive physiological role and, in turn, are the leading target class for pharmaceuticals.
Beginning with the determination of the structure of rhodopsin, and dramatically accelerating since the
reporting of the first ligand-mediated GPCR X-ray structures, our understanding of the structural and
functional characteristics of these proteins has grown dramatically. Deploying this now rapidly emerging
information for drug discovery has already been extensively demonstrated through a watershed of studies
appearing in numerous scientific reports. Included in these expositions are areas such as sites and char-
acteristics of ligand to GPCR binding, protein activation, effector bias, allosteric mechanisms, dimerization,
polypharmacology and others. Computational chemistry studies are demonstrating an increasing role in
capitalizing on the structural studies to further advance our understanding of these proteins as well as to
drive drug discovery. Such drug discovery activities range from the design of orthosteric site inhibitors
through, for example, allosteric modulators, biased ligands, partial agonists and bitopic ligands.
Herein, these topics are outlined through specific examples in the hopes of providing a glimpse of the
state of the field.
Key words GPCR, Structure-based drug discovery, X-ray structure, Allosteric modulators,
Receptor bias
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_1, © Springer Science+Business Media LLC 2018
1
2 Sid Topiol
2.1 The With the role of 7TM proteins to induce signal propagation to the
Intracellular Rim intracellular region via interaction with their various effectors, this
region serves as the initial conduit for this information transmission
mechanism. The structures of the 7TM proteins and their changes
in this region determine whether fruitful interactions with the
effectors will take place (activation), to what extent these effective
interactions will occur (intrinsic activity), and with which effectors
these will occur (biased agonism). The various X-ray structures now
available, together with a wealth of molecular biological, biophysi-
cal, and biochemical studies, include examples spanning these vari-
ous possibilities. At the fully active protein extreme is the X-ray
structure of the fully activated β2AR receptor [7] in complex with a
high-affinity agonist BI-167107 and its effector, the hetero-
trimeric GTP binding protein Gs. As with many of the 7TM
X-ray structures, companion proteins used to aid in the crystalliza-
tion are included in the structure. Here, there are two such pro-
teins, the camelid nanobody Nb35 and T4L (replacing the
N-terminus of the 7TM). In this case, the role of the camelid
nanobody in helping to stabilize the active form of the 7TM protein
was demonstrated through molecular dynamics simulations [8] an
approach playing an increasing role in complementing X-ray struc-
tural information. In comparison with structures of the inactive
state, this structure reveals a more extended conformation for
helix 5 and an outward shift of helix 6 from the central helical
transmembrane axis while helices 3 and 7 move slightly inward.
Similar structural information for the transmembrane region is
available for the fully inactive protein extreme which has generally
been more accessible due to the greater availability of high affinity
antagonists (versus agonists) to facilitate protein crystallization as
illustrated by an X-ray structure of the adenosine 2a receptor
(A2aAR) [9]. Rhodopsin X-ray structures of the inactive state pro-
vide other, earlier examples. In addition to the X-ray structures of
the active and inactive extremes, there are now a number of exam-
ples of various intermediate states including complexes with partial
agonists, and demonstrating intermediate structural features. It is
noteworthy that the first X-ray structures of GPCR proteins were
those of rhodopsin, due in large part to the availability of large
quantities of the protein for crystallization. Thus, while ligand-
mediated GPCR (non-rhodopsin) proteins hold a central focus
for much of the interest in this area because of their pharmacologi-
cal role as drug targets, rhodopsin has played an early and
Current and Future Challenges in GPCR Drug Discovery 5
2.2 The Most While the role of these proteins is to communicate information
Intracellular Ligand from the extracellular region, generally via ligand (or light, in the
Site—To Date case of rhodopsin) mediated signaling, to the intracellular region
via interaction with various effectors, the location for the signal
modulating ligand has traditionally been understood to be in the
upper region of the protein for orthosteric as well as sites bordering
these orthosteric sites (acting as selectivity sources or allosteric
sites). In striking contrast to this, chemokine receptor X-ray struc-
tures for CCR2 and CCR9 demonstrate that inhibitor binding in
the extreme IC region of the protein and immediately proximal to
the effector binding region occurs [11, 12]. The CCR9 X-ray
structure has only one bound ligand, the inhibitor vercirnon,
which is bound at this site and juts out at the IC domain. Two
simultaneous inhibitor ligands are bound in the CCR2 X-ray struc-
ture. The first inhibitor, CCR2-RA-[R], is bound in the same
location as vercirnon in the CCR9 X-ray structure (see Fig. 1),
whereas the second ligand, BMS-681, is bound in the assumed
orthosteric site. The inhibitory role of the ligands at this extreme
IC location is reflected in the protein structure wherein the out-
ward movement of H6, required for the effector binding to the
7TM protein, is prevented by the inhibitor. Additionally, the inhi-
bitor’s position directly precludes effector binding. This IC region
allosteric site uncovered in these studies is not known to have any
endogenous role, and can be considered an illustration of a man-
made site [15].
2.3 The B Site The X-ray crystal structure of corticotropin-releasing factor recep-
tor 1 (CRF1R), a member of the secretin like class B GPCRs, in
complex with the antagonist CP-376395 [16] revealed yet another
man-made 7TM ligand binding site (B site) which is also much
deeper than the classical orthosteric site. The location of
CP-376395, a compound identified through screening studies, is
further away from the IC region of the protein toward the EC
6 Sid Topiol
Fig. 1 Illustration of the range of GPCR ligand binding sites. Examples of binding sites of selected ligands in the
7TM domain, as seen from the side of the α-helical barrel. The ligands are superimposed with a ribbon
representation of the 7TM domain using the X-ray structure of β2AR. The identity of each ligand, the protein to
which it is bound, and the Protein Data Bank (PDB) [13] accession number of the complex are as follows:
vercirnon (purple carbon atoms) in CCR9 (PDB:5LWE); CP-376395 (yellow carbon atoms) in CRF1R (PDB:4K5Y);
sodium/water cluster (black sodium atom, red water molecules) in the A2aAR (PDB:4EIY); mavoglurant (spring
green carbon atoms) in mGluR5 (PDB:4OO9); iperoxo (plum carbon atoms) in the M2 receptor (PDB:4MQT);
carazolol (aqua carbon atoms) in the β2AR (PDB:2RH1); LY2119620 (gray carbon atoms) in the M2 receptor
(PDB:4MQT). Two views are shown at 90 rotation as indicated. The molecular graphics were generated in
Maestro [14]
region than that of the ligands in the CCR2 and CCR9 X-ray
structures described above (see Fig. 1). Nevertheless, it is still far
removed from the orthosteric binding sites expected for this class of
proteins wherein peptide-like ligands are expected to bind in, e.g.,
an open, v-shaped EC cavity as found in the X-ray structure of the
related class B receptor whose X-ray structure has also been solved
[17]. CP-376395 is selective for CRF1R over CRF2R. Two char-
acteristics of this site would suggest conflicting predictions regard-
ing its potential as a source of selectivity. Pervasive dogma argues
that allosteric sites offer greater opportunities for selectivity than
orthosteric sites, a principle based on the expected conservation of
residues among related proteins for common ligands at their
orthosteric sites. In contrast, there is generally expected to be less
variation in structure and sequence of 7TM proteins in the IC
direction than the EC direction. In this case, differences in just
two residues at this binding site between CRF1R and CRF2R could
provide the explanation for the greater preference observed with
CP-376395 for CRF1R. Analysis of this structure also suggests that
CP-376395 prevents the activating outward motion of TM6,
thereby explaining its inhibitory effect and offering clues for design
of ligands with desired intrinsic activity [16, 17].
Current and Future Challenges in GPCR Drug Discovery 7
2.4 The Ionic Lock As with a much of the early understanding of 7TM structure/
(“D(E)RY”) function relationships, evidence for this feature as a characterization
of the inactive state has its origins in rhodopsin X-ray structures.
Using the Ballesteros-Weinstein numbering scheme [18], the ionic
lock describes the structure of the cluster of residues D3.49, R3.50,
Y3.51 (“DRY”), and E6.30 as a means for establishing the inactive
state of the protein. In the structure of the inactive state of rhodop-
sin, R3.50 interacts with D3.49, E6.30, and T6.34. The ionic
interaction of R3.50 with E6.30 forms the lock between helices
3 and 6 which is associated with the inactive state. X-ray structures
of the inactive state of ligand-mediated class A GPCRs, e.g., the D3
dopamine receptor [19] have been found to include this ionic lock.
Interestingly, similar ionic and/or polar hydrogen bonding net-
works are found in X-ray structures of inactive forms of class B
[16, 17], class C [20, 21], and class F [22, 23] GPCRs. In active
state structures of rhodopsin and the β2AR [7, 24] the interaction
of R3.50 with E6.30 is no longer present, but R3.50 interacts with
Y5.58 instead. A number of X-ray structures with common ligands
but varying ionic cluster interactions, along with X-ray structures
with ligands of varying intrinsic activity, and molecular dynamics
simulations, lead to an emerging picture that these active/inactive
state ionic lock indicators are not guarantees of the activation state
but serve as indicators of their propensities for the given state
[15]. Moreover, they seem to contribute to the induction of the
structural changes more proximal to the effector.
2.5 Internal Water Sodium has been shown to act as an allosteric modulator of 7TM
Network and Its proteins. A 1.8-Å high-resolution X-ray structure of the A2aAR
Sodium Site with the inhibitor ZM241385 bound [25] shows the position of
a sodium atom at the center of a network of water molecules which
traverse much of the transmembrane region and has three clusters
whose central cluster contains the sodium atom (Fig. 1). This
cluster is situated between the ionic lock and the so-called toggle
switch (see below). This site can potentially serve as a ligand binding
site as supported by a crystal structure of the 7TM region of a class
C GPCR, the mGluR5 receptor [21] containing the bound nega-
tive allosteric modulator (NAM) mavoglurant whose lower portion
overlaps spatially with this sodium/water cluster (Fig. 1). In the
case of the A2aAR, the orthosteric site is located in the more
common upper region of the transmembrane as is the inhibitor
also seen in the A2aAR X-ray structure. For mGluR5 however, the
orthosteric site resides in an extracellular domain separated from
the 7TM domain by a “cysteine-rich” protein linker. The mavo-
glurant site in mGluR5 is thus another example of a man-made site
[26]. The role of this sodium/water-cluster region to serve as an
allosteric site to two very differently located orthosteric sites is
more uniformly understood when viewed as serving a common
function to modulate the same local transmembrane region.
8 Sid Topiol
In the case of the A2aAR, active state structures are available for
comparison [27, 28] and show that the hydrated sodium-ion
induces a kinking in helices VI and VII. Ameloride is known to
compete with this site for the A2aAR and it has been used for
structure-based design [29–33].
2.6 The CWxP Analogous to the ionic lock, a highly conserved CWxP motif con-
“Toggle Switch” tains tryptophan W6.48 whose orientation had been hypothesized
as a marker for the activation state of 7TM proteins. This has now
been verified extensively in numerous GPCR X-ray structures
where there is a shift in the position of the indole of W6.48 between
the active and inactive state structures, albeit not a flipping of the
indole ring as originally hypothesized. Interestingly, the driving
forces for this indole positioning are varied. In the inactive state
structures of rhodopsin [3], the histamine H1 receptor [34], and
the muscarinic M2 receptors [35], the inhibitors (retinal in the case
of rhodopsin) hold the corresponding indole of W6.48 in the same
position by directly interacting with it. In other instances, such as
the inhibitor bound inactive state X-ray structures of the β2AR
[4] or the dopamine D3 receptor [19], ligand interaction is with
an aromatic ring of an intervening residue. Whereas this region is
proximal to the endogenous ligand’s binding sites in class A 7TM
proteins, that is not the case for class C 7TM proteins such as
mGluRs. It is thus interesting that X-ray structures of the 7TM
domains of mGluRs show that allosteric inhibitor bound proteins
with ligands at this man-made site (for mGluRs) [20, 21] have their
corresponding tryptophan rings displace outward from the 7TM
core by the bound ligand. The role of the differences in the struc-
tural features in this region in protein activation is becoming
clearer. Comparing the active and inactive states of the A2aAR
[27, 36] shows that the agonist sits much deeper in the pocket
forming a series of hydrogen bonds with the protein as well as a
steric clash with W6.48 which collectively induce more active like
orientations and positions of H5 and H6.
2.7 The The approximately upper third region of the 7TM core generally
“Orthosteric” serves as the binding site for endogenous ligands, particularly for
Pocket—The HUB class A 7TM proteins and, in turn, for most synthetic ligands;
herein referring to this as the “HUB” region. In considering all
GPCRs, many more ligands are accommodated at the HUB than
effectors at the IC region. It is therefore intuitive that there is
considerable diversity at this HUB site as described above. This
diversity is rooted in multiple sources including significant amino
acid variability between 7TM proteins in the EC direction, still
greater variability in the 7TM connecting extracellular loops and
greater structural variation (such as degree of openness) in this
region.
Current and Future Challenges in GPCR Drug Discovery 9
2.8 The EC Rim The upper rim of the 7TM domain has the most diverse features
(Vestibule, Address that are reflected in the variability in the types of ligands residing
Site, Etc.) there as well as the nature of its usage. Ligands binding here range
from small molecules to relatively large peptides. Small ligands are
found occupying this region as seen, e.g., for the A2aAR and
CXCR4 receptors. This region serves as an allosteric “vestibule”
as in the case of muscarinic receptors [35, 37, 43] (Fig. 1). Regions
above or below this region can combine with it to form binding
sites for ligands. Together with the region below it, it is thus
utilized as an “address” pocket in conjunction with ligands binding
their “message” portions more deeply into the 7TM such as has
been seen for structures of the opioid receptors [44–47]. Alterna-
tively, ligands bound here can be found to also interact with por-
tions of the protein in the N-terminus direction for class A (e.g.,
CB1 [38]) and, e.g., class B proteins where structural and muta-
tional evidence indicates that endogenous ligand binding straddles
the 7TM and EC domains [17].
Current and Future Challenges in GPCR Drug Discovery 11
2.9 Binding To and The overall barrel-like shape of the transmembrane region of the
Through the External 7TM proteins, whose most commonly accepted orthosteric bind-
7TM Wall ing site lies inside the barrel-like structure, is consistent with a
simple model for the trajectory of ligands engaging in interactions
with these proteins. An alternate model for this trajectory has been
considered for some time, wherein a ligand approaches and enters a
7TM protein from the outer side of the barrel [48–50]. With
examples of X-ray structures showing ligands completely buried
within the 7TM and covered by EC loops now available for, e.g.,
rhodopsin [3], S1p1 [51], and PAR1 [52], an external trajectory
becomes a more plausible explanation for ligand entry. Indeed,
there is now proof of ligands actually binding partially external to,
or even completely external to the 7TM region (see GPR40 [53]
and P2Y1 [54] respectively). External interactions as modulators of
GPCR activity are supported by other types of data. Both homo-
and hetero-dimerization is known to play a role in the functioning
of various GPCRs [55–58]. Binding of cholesterol to the external
transmembrane region has been shown by X-ray structures (see,
e.g., [4, 59]) as well as electron microscopy [60] and is believed
to play a role in dimerization. Long time frame molecular dynamics
investigations are helpful in examining these potential interactions
[61] and new mass spectrometry-based tools are emerging to mea-
sure the dependence and degree of protein oligomerization due to
membrane lipid binding mediation [62]. As GPCR signaling is
dependent on changes in their helical positions and conformation
in the IC regions to prepare for effector interaction, it is not
surprising to find evidence that modulating such changes from
the external side of their transmembrane region is possible. Taken
together, the collection of structural information that is now avail-
able for 7TM proteins indicates that all regions of 7TM proteins,
inside and out, appear to provide potential sites for ligand
modulation.
2.10 EC Domains for The class B, C, and F 7TM receptor subgroups are differentiated in
GPCR Classes B, C, part from class A 7TM receptors by an additional domain at their
and F N-terminus, the EC domain. X-ray structures for the 7TM domains
have been determined for examples of all three of these protein
subgroups and confirm their generally similar architecture to the
class A GPCR proteins. While peptidic ligands for the class B 7TM
proteins bind in between the 7TM and EC domains, the EC
domains of the class C and F 7TM proteins contain structurally
separated binding sites. Class C receptors contain a cysteine-rich
linker region that connects the 7TM domain to the so-called Venus
“flytrap” (VFT) domain to which the endogenous ligands bind,
such as glutamate in the case of mGluR receptors. X-ray structures
of the EC domains of class C and class F receptors with ligands
bound have been determined. For the EC domain, the structural
changes associated with the active versus inactive state of the VFT,
12 Sid Topiol
3.1 Virtual As was demonstrated soon after the first X-ray structures for GPCR
Screening, High- proteins were reported, high-throughput docking (HTD) cam-
Throughput Docking paigns using X-ray structure models for compounds acting at
those targets, and in the same fashion (site, active/inactive state,
etc.) are extremely effective for GPCR proteins. From a drug
discovery perspective, there is little doubt that this is an extremely
efficient and striking approach to begin studies of a target protein.
Screening of large databases of preexisting compounds, from com-
mercial or proprietary sources, can rapidly jump start a drug dis-
covery program with identification of potent compounds and
structure activity information. In silico HTD screening of large
databases containing millions of compounds, using a number of
different software systems, is already routinely conducted and used
to rank and select as few as tens or hundreds of compounds for
in vitro testing. Hit rates above 30% and yielding compounds with
activities in the single-digit nanomolar range are common
[15]. Integration of HTD methods with ligand-based methods or
protein-based pharmacophore methods often further improves
these successes. As expected, the success of these approaches
depends on how close to this optimal paradigm one operates.
Within a subgroup of closely related targets for proteins with
common endogenous ligands (e.g., adrenergic or dopaminergic
receptors) homology models based on X-ray structures of other
members of the subgroup yield comparable results to those where
the X-ray structure of the target of interest is used. However, in
silico screening for an agonist using an antagonist bound structure
of the same protein as a template is often more challenging than for
an antagonist using a homology model based on an X-ray structure
template of another protein in an inactive state within the same
subgroup. This is because differing states of a protein have greater
deviation in their binding site structures from their templates than
common states within a subgroup where there are few amino acid
changes. As one progresses to create and deploy homology models
based on templates of X-ray structures outside a target sub-group
the reliability of the homology model decreases. In part, this is due
to the reduction in sequence identity, and consequentially reduc-
tion in structural similarity in the transmembrane helices. More
elaborate protocols such as the use of multiple templates help
improve the accuracy of the homology models. More significantly,
the extracellular loops, and in some instances sections of the
N-terminal, vary much more significantly in shape, length, fold
etc., while contributing significantly to ligand binding at the HUB.
3.2 Structure-Based The strengths and weaknesses described for HTD pertain more
Drug Design generally to computational drug discovery for GPCR proteins. It
has become commonplace to employ models of 7TM proteins in
drug discovery activities as evidenced by the extensive reporting of
these approaches in the medicinal chemistry literature. Unlike
14 Sid Topiol
4.1 Allosteric Sites: The use of X-ray structures of GPCRs for discovery and design of
Another Look at the ligands in the simplest approach, i.e., for the same site and same
Other Site activity as the X-ray structure, is now well established and remark-
ably effective. As noted, at the most common (for class A) 7TM
orthosteric HUB site, structural differences observed between
inactive and active state structures provide a clear explanation for
the deterioration of results when inactive structures are used (with-
out other moderations or considerations) to identify activating
compounds. It is reasonable to assume that similar differences
Current and Future Challenges in GPCR Drug Discovery 15
would occur at other ligand binding sites, i.e., allosteric sites, such
as those described herein, but there is as yet not much data available
to test this. The HUB site serving as the orthosteric site for class A
proteins, however, serves as an allosteric site for non-class A pro-
teins. X-ray structures for the smoothened class F GPCR, with
activators or inhibitors bound reveal differences between their
binding sites [22, 23]. For the mGluRs, while X-ray structures in
the 7TM domain are only available with inhibitors bound, SAR
data finds that very small ligand changes result in the switch
between activating and inactivating ligands [21, 26, 68]. Whether
this apparent sensitivity is inherent in the role of this site as an
allosteric site or simply a consequence of the still limited informa-
tion is unclear. Relatedly, whereas by definition an allosteric site is a
site other than that where the endogenous ligand binds (the
orthosteric site), other implications for the allosteric nomenclature,
e.g., the modulation of the orthosteric binding site events, may
point to a different perspective. GPCRs are a category of proteins
whose architecture and prominent functioning can be described as
proteins whose communication with intracellular effectors is gen-
erally modulated by ligand interaction at the control-center/HUB
site. It therefore seems logical to re-consider the EC domain sites of
non-class A GPCRs as operationally allosteric sites as compared to
their more unifying (with respect to class A GPCRs) HUB. By
analogy to class A GPCRs, these 7TM sites would be directly
involved in signal transmission in the IC direction as opposed to
the usual indirect model wherein these 7TM sites modulate signal-
ing in the EC direction (at the EC domain) which must then
propagate back through the same 7TM domain—where they
began. Evidence for both perspectives exists vis. the X-ray structure
of the complete smoothened protein [66] shows evidence for
ligand binding in the 7TM domain resulting in interactions from
the 7TM with the EC domain which influence EC ligand binding
whereas evidence for the direct ligand control at the IC region of
non-class A GPCR proteins is provided by reports of a truncated
mGluR5 protein without its EC domain which can be activated by a
TM binding ligand [69]. The inherent machinery of GPCRs thus
questions whether the usual roles, experimental analyses, and
ligand design of allosteric modulators should be treated differently
for non-class A GPCRs.
4.2 Multi-Target A critical factor in the action of drugs is the profile of their activity at
Tuning: Within and varying targets. This target profile is important even when only
Between Subgroups, simple inhibition is considered at multiple targets and extends to
to Other Classes, considerations of varying activities at different sites of different
Tuning In Vs. Out, proteins such as activators with respect to one site and inhibitors
Polypharmacology with respect to another. Indeed, poly-pharmacology has grown as a
medicinal approach. The growing structural information that has
become available now introduces a broad selection of opportunities
16 Sid Topiol
4.3 Site and Roles: Considering the breath of non-HUB sites for which there is now
Alternative Pressure evidence for ligand binding and protein modulation, it appears that
Points almost any site is a possible site for effective ligand binding and
protein action modulation. Driven by ligand binding at these sites,
or pressure points, GPCRs seem to operate through a model some-
what akin to a collection of 7 chop sticks. Relatively rigid trans-
membrane helices adjust their positions, with additional localized
(e.g., ionic lock) structural changes in specific residue conforma-
tions and interactions, which mediate signaling. From a drug dis-
covery perspective, the primary criteria for selecting a site of ligand
intervention may be less a question of whether a site is technically
orthosteric or allosteric but which site(s) provides the optimal
pressure point. Understanding the interplay among these sites will
be helpful here as well and is an area where computational investi-
gations can play an important role [78]. The HUB site seems
intuitively the most common, opening gambit—probably inherent
in the GPCR architecture. While distal from the effector, the HUB
seems to benefit from a leveraging mechanism (chop stick model).
The inner most IC region, with its proximity to the incoming
Current and Future Challenges in GPCR Drug Discovery 17
4.4 Multiple Sites An underlying theme in the search for a number of alternate modes
Within and Between of action of ligands is the incorporation of components of ligands
Proteins, Bivalent, acting at two sites into a single ligand. The various sites available for
Bitopic, Linked ligand modulation to be paired may be relegated to structure-based
design in many cases. Pairing can occur within or between GPCRs.
More traditional pairing of adjoining sites such as for opioid ligands
having an “address” and “message” component now has available
X-ray structures revealing the corresponding sites on the proteins
[44–47]. As structural information becomes available it would be
promising to expand the use of this structural information in the
design of bitopic ligands linking together allosteric and orthosteric
18 Sid Topiol
5 Concluding Remarks
References
1. Unwin PNT, Henderson R (1975) Molecular protein-coupled receptor. Science
structure determination by electron micros- 318:1258–1265
copy of unstained crystalline specimens. J Mol 5. Rosenbaum DM, Cherezov V, Hanson MA
Biol 94:425–440 et al (2007) GPCR engineering yields
2. Baldwin JM, Henderson R, Beckman E et al high-resolution structural insights into β2-
(1988) Images of purple membrane at 2.8A adrenergic receptor function. Science
resolution obtained by cryo-electron micros- 318:1266–1273
copy. J Mol Biol 202(3):585–591 6. Wacker D, Wang S, McCorvy JD et al (2017)
3. Palczewski K, Kumasaka T, Hori T et al (2000) Crystal structure of an LSD-bound human
Crystal structure of rhodopsin: a G protein- serotonin receptor. Cell 168:377–389
coupled receptor. Science 289:739–745 7. Rasmussen SGF, DeVree BT, Zou Y et al
4. Cherezov V, Rosenbaum DM, Hanson MA (2011) Crystal structure of the β2 adrenergic
et al (2007) High-resolution crystal structure receptor–Gs protein complex. Nature
of an engineered human β2-adrenergic G 477:549–555
Current and Future Challenges in GPCR Drug Discovery 19
37. Kruse AC, Hu J, Pan AC, Arlow DH et al 53. Srivastava A, Yano JK, Hirozane Y et al (2014)
(2012) Structure and dynamics of the M3 mus- High-resolution structure of the human
carinic acetylcholine receptor. Nature GPR40 receptor bound to allosteric agonist
482:552–556 TAK-875. Nature 513:124–127
38. Shao Z, Yin J, Chapman K et al (2016) High- 54. Zhang D, Gao Z, Jacobson K et al (2015) Two
resolution crystal structure of the human CB1 disparate ligand-binding sites in the human
cannabinoid receptor. Nature 540:602–606 P2Y1 receptor. Nature 520:317–321
39. Zhang K, Zhang J, Gao Z-G (2014) Structure 55. Rozenfeld R, Gomez I, Devi L (2011) Opioid
of the human P2Y12 receptor in complex with receptor dimerization. In: Pasternak GW
an antithrombotic drug. Nature 509:115–118 (ed) The opiate receptors, vol 23. Humana,
40. Warne T, Moukhametzianov R, Baker JG et al New York, pp 407–437
(2011) The structural basis for agonist and 56. Milligan G (2009) The role of dimerisation in
partial agonist action on a β1-adrenergic recep- the cellular trafficking of G-protein-coupled
tor. Nature 469:241–244 receptors. Curr Opin Pharmacol 10:1–7
41. Wang C, Jiang Y, Ma J et al (2013) Structural 57. Birdsall N (2010) Class A GPCR heterodimers:
basis for molecular recognition at serotonin evidence from binding studies. Trends Phar-
receptors. Science 340:610–614 macol Sci 31:499–508
42. Wacker D, Wang C, Katritch V et al (2013) 58. Gonza’lez-Maeso J, Ang RL, Yuen T et al
Structural features for functional selectivity at (2008) Identification of a serotonin/glutamate
serotonin receptors. Science 340:615–619 receptor complex implicated in psychosis.
43. Kruse AC, Ring AM, Manglik A et al (2013) Nature 452:93–98
Activation and allosteric modulation of a musca- 59. Hanson MA, Cherezov V, Griffith MT et al
rinic acetylcholine receptor. Nature 504:101–106 (2008) A specific cholesterol binding site is
44. Manglik A, Kruse AC, Kobilka TS et al (2012) established by the 2.8 a structure of the human
Crystal structure of the μ-opioid receptor β2-adrenergic receptor. Structure 16:897 905
bound to a morphinan antagonist. Nature 60. Ruprecht JJ, Mielke T, Vogel R et al (2004)
485:321–326 Electron crystallography reveals the structure
45. Granier S, Manglik A, Kruse AC et al (2012) of metarhodopsin I. EMBO J 23:3609 3620
Structure of the δ-opioid receptor bound to 61. Lee JY, Lyman E (2012) Predictions for cho-
naltrindole. Nature 485:400–404 lesterol interaction sites on the A2A adenosine
46. Wu H, Wacker D, Mileni M et al (2012) Struc- receptor. J Am Chem Soc 134:16512–16515
ture of the human κ-opioid receptor in com- 62. Gupta K Donlan JAC Hopper JTS et al (2017)
plex with JDTic. Nature 485:327–332 The role of interfacial lipids in stabilizing mem-
47. Thompson AA, Liu W, Chun E et al (2012) brane protein oligomers. Nature 541:421–424
Structure of the nociceptin/orphanin FQ 63. Kunishima N, Shimada Y, Tsuji Y et al (2000)
receptor in complex with a peptide mimetic. Structural basis of glutamate recognition by a
Nature 485:395–399 dimeric metabotropic glutamate receptor.
48. Hurst D, Grossfield A, Lynch D et al (2010) A Nature 407:971–977
lipid pathway for ligand binding is necessary for 64. Chappell MD, Li R, Smith SC et al (2016)
a cannabinoid G protein-coupled receptor. J Discovery of (1S,2R,3S,4S,5R,6R)-2-amino-
Biol Chem 285:17954–17964 3-[(3,4- difluorophenyl)sulfanylmethyl]-4-
49. Sch€adel S, Heck MM, Maretzki D et al (2003) hydroxy-bicyclo[3.1.0]hexane-2,6- dicarbox-
Ligand channeling within a G-protein-coupled ylic acid hydrochloride (LY3020371·HCl): a
receptor: the entry and exit of retinals in native potent, metabotropic glutamate 2/3 receptor
opsin. J Biol Chem 278:24896–24903 antagonist with antidepressant-like activity. J
50. Filipek S, Stenkamp R, Teller D et al (2003) G Med Chem 59:10974–10993
protein-coupled receptor rhodopsin: a pro- 65. Topiol S, Sabio M, Uberti M (2010) Exploration
spectus. Annu Rev Physiol 65:851–879 of structure-based drug design opportunities for
51. Hanson MA, Roth CB, Jo E et al (2012) Crys- mGluRs. Neuropharmacology 60:93–101
tal structure of a lipid G protein-coupled recep- 66. Byrne EFX, Sircar R, Paul Miller S et al (2016)
tor. Science 335:851–855 Structural basis of smoothened regulation by
52. Zhang C, Srinivasan Y, Arlow DH et al (2012) its extracellular domains. Nature 535:517–522
High-resolution crystal structure of human 67. Frimurer TM, Mende F, Graae A-S et al (2017)
protease-activated receptor 1. Nature Model-based discovery of synthetic agonists
492:387–392 for the Zn2+ sensing G-protein-coupled
Current and Future Challenges in GPCR Drug Discovery 21
Abstract
The recent increase in available G protein-coupled receptor structures now contributes decisively to the
structure-based ligand design. In this context, computational approaches in combination with medicinal
chemistry and pharmacology are extremely helpful. Here, we provide an update on our structure-based
computational protocols, used to answer key questions related to GPCR-ligand binding. All combined,
these techniques can shed light on ligand binding modes, determine the molecular basis of conformational
selection, for agonists and antagonists, as well as of subtype selectivity. To illustrate each of these questions,
we will consider examples from existing projects on three families of class A (rhodopsin-like) GPCRs: one
small-molecule (nucleotide-like) family, i.e., the adenosine receptors, and two peptide-binding receptors:
neuropeptide-Y and angiotensin II receptors. The successful application of the same computational proto-
cols to investigate this diverse group of receptor families gives an idea of the general applicability of our
methodology in the characterization of GPCR-ligand binding.
Key words Homology modeling, Molecular dynamics, Free energy perturbation, Structure-based
drug design
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_2, © Springer Science+Business Media LLC 2018
23
24 Silvana Vasile et al.
pharmacology has guided drug discovery in the field. With the new
century, structural characterization of the targeted receptors started
to be an accessible reality, allowing for the alluring perspective of
GPCR structure-based drug design [2, 3]. The signature of GPCR
ligand design and functional characterization has been a blend of
biochemical studies, pharmacology, medicinal chemistry efforts,
and computational modeling. In this framework, computer-aided
ligand design for GPCRs has evolved from an era dominated by
ligand-based techniques to the use of mature structure-based
methods, such as virtual screening or free energy calculations
[4, 5].
1.3 Adenosine Adenosine is the signaling molecule that activates four subtypes of
Receptors class A GPCRs: A1, A2A, A2B and A3 adenosine receptors (ARs)
[13]. These are highly demanded therapeutic targets, ubiquitously
expressed in the human body and associated with several diseases
such as several inflammatory processes (A2A and A3); respiratory
pathological events such as allergic asthma (A2B and A3); vascular
diseases (A2A) as well as arrhythmias and stroke (A1). Because of the
widespread of the adenosine signaling system, and the high homol-
ogy among the four ARs, the development of selective ligands is
challenging. Traditionally, ligand design toward ARs has utilized
ligand-based techniques, such as QSAR, as well as on modification
of complex heterocycles with poor pharmacokinetic properties.
1
During the processing of this manuscript one structure for the AT2 receptor (5UHN) and 2 structures for the A1
adenosine receptor (PDB codes 5N2S and 5UEN) were released.
26 Silvana Vasile et al.
Fig. 1 Phylogenetic tree of GPCRs, indicating the location of the receptors considered in this chapter. Red dots
denote families with at least one crystal structure. The insets show the 3D structure of the binding site of each
receptor considered in this chapter, as obtained with the methodology here described
1.4 Neuropeptide Y The next case study belongs to the neuropeptide-Y (NPY) system
Receptors of signaling peptides and receptors mediating important physiolog-
ical and behavioral processes, such as appetite regulation, anxiety,
pain or learning, and memory control [14]. As a consequence,
there is increasing interest from the pharmaceutical sector in the
regulation of this system, in particular in the search of anti-obesity
drugs [15]. Neuropeptide Y (NPY), peptide YY (PYY), and pancre-
atic polypeptide (PP) are each 36 residues peptides, arranged as a
proline-rich N-terminus followed by a conserved α-helical central
fold and an unwound amidated C-terminal pentapeptide. The three
peptides are the natural ligands for the four Y receptors expressed in
humans (Y1, Y2, Y4 and Y5; more subtypes are found in other
species) [14]. While the modification of these peptides can lead to
more selective agonists for any of the Y receptors, most antagonists
are peptidomimetics of the C-terminal tail of the natural agonists.
During the past years, we have used and developed the compu-
tational protocols described here in the search for antagonists of Y1
and agonists for the Y2 receptors. With no crystal structure available
for any of the Y receptors (Fig. 1), homology models of the two
receptors were built, and used to define the antagonist and agonist
binding modes respectively. The hY1 receptor in complex with
antagonist BIBP3226 was further used to develop our free energy
perturbation (FEP) protocol, which we apply to characterize the
effect of protein mutations and ligand SAR for different GPCRs
[16]. As for the hY2 receptor, the homology model of the active-
like conformation was used to define the binding mode of the
natural agonists NPY and PYY [17], in an example of receptor-
peptide docking illustrated below.
2 Theory/Materials
2.1 Homology Despite the steady increase in the number of GPCR crystal struc-
Modeling and MD tures, the reality is that the majority of receptors have yet unknown
Refinement with structure. In these cases, homology (or comparative) modeling
GPCR-ModSim remains one of the most important techniques for obtaining a
reasonable 3D structural model to use in rational ligand design
[7–9]. As a result, homology modeling is implemented in a number
of specific web-servers, among which GPCR-ModSim emerges as a
complete tool for the modeling and simulation of GPCRs [23, 24]
(see Note 1 for alternative solutions).
We will describe here the use of the last version of
GPCR-ModSim [24], freely accessible at the web address
http://gpcr-modsim.org (see Note 2 about optional academic
accounts). The only input required is a FASTA sequence or the
UNIPROT code of the GPCR to be modeled. Thereafter, the
modeling process consists of consecutive steps, which are illu-
strated below for the case of the AT2 angiotensin receptor [22]
(see Note 3 for additional examples).
1. Identification of the best template and generation of a template
(s)/target pairwise sequence alignment. This is done by
performing a multiple sequence alignment (MSA) of the
query sequence against a profile of available templates of
known 3D structure. While in the case of a random protein
this step involves a BLAST search against a large database of
non-redundant protein sequences or available PDB structures,
in GPCR-ModSim we restrict this search to a carefully curated
structure-based profile-alignment of crystallized receptors.
These are classified into three categories depending on receptor
conformation: inactive (22 structures), active-like (8 struc-
tures), and fully active conformations (3 structures). The
default criterion is to select the template with highest sequence
identity in the transmembrane region (see Note 4 for additional
considerations). However, in cases of moderate sequence iden-
tity the overall structural similarity between the obtained
model and the single template used can be artificially high, a
problem that can be counterbalanced with the choice of addi-
tional templates [25, 26]. To use this option, a pairwise
sequence identity (SI) is provided for each of the topological
regions, aiding in the selection of the best template(s) for each
region. Since the whole modeling process is based on the
Characterization of Ligand Binding to GPCRs Through Computational Methods 29
2.2 Ligand Docking Once the 3D structure of the GPCR of interest is available, either
from crystallography or from molecular modeling, the next step in
the ligand design process is to define the binding mode of the
ligand(s) of interest. The goal here is to describe the protein–ligand
interactions at the physicochemical level and use this information to
validate the structural model to guide further ligand optimization
and establishment of the SAR. Depending on the chemical nature
of the ligand (e.g., a small molecule or peptide), the number of
ligands, and the quality of the 3D structural model of the receptor,
30 Silvana Vasile et al.
2.3 Computation of While docking provides a useful tool for the generation of possible
Binding Free Energies binding poses, scoring functions generally fail to accurately predict
the free energy of ligand binding. Therefore, rescoring with more
elaborate methods for the estimation of free energy of binding is
Characterization of Ligand Binding to GPCRs Through Computational Methods 31
Fig. 2 Thermodynamic cycle used to perform in silico SDM. For a mutation of glutamine to leucine, one needs
to perform four independent MD simulations (horizontal arrows in the figure) to transform each sidechain into
alanine, both in the presence (top panels) and in the absence (bottom panels) of the ligand. The figure
illustrates the quantification of the effect of Gln (wt) to Leu (mut) in the binding affinity of the PYY peptide into
the Y2 receptor (vertical arrows)
where
U m ¼ ð1 λm ÞU i þ λm U f
where hΔGi are the average values of Gibbs free energies over
several replicate MD trajectories (i.e., same conditions but different
Characterization of Ligand Binding to GPCRs Through Computational Methods 33
3 Methods
3.1 Homology This example, extracted from our ligand design project for the AT2
Modeling of the AT2 receptor, illustrates the capacity of both single template and
Receptor multiple-template homology modeling. The full process has been
adapted to be followed using the last version of GPCR-ModSim,
and consists of the following steps:
l The native sequence for this receptor (P50052) can be down-
loaded from the Uniprot portal and manually edited in order to
remove the long N-terminus (1–32) and C-terminus (336–360)
fragments, because of the lack of templates for these regions
among the crystallized GPCRs.
l The edited sequence is then uploaded to GPCR-ModSim. Select
“Model a GPCR,” and paste the edited sequence into the win-
dow. Leave the “inactive” templates as we will model the inactive
conformation of the receptor in this example and press “Sub-
mit.” The next window shows a range of options to select
templates. We will illustrate both single and multiple template
options in parallel modeling stages.
l Option 1: Single-template modeling. The server will offer as the
best template the AT1 receptor (PDB code 4YAY), which has a
sequence overall/TM identity of 31/42% respectively. Click on
“Model,” select “10” number of models and click on “Submit.”
Once the process is finished, we will select the model with high-
est DopeHR score.
l Option 2: multiple-template modeling. In the “Model” window,
one can select additional templates for different topological
regions. The choice of templates is indicated in Table 1, and is
based on dual criteria: the matrix of partial similarities provided
by GPCR-ModSim, plus the consideration of phylogenetic rela-
tionships. The overall idea is to preserve the sequences with
higher homologies for each topological region of the receptor.
34 Silvana Vasile et al.
Table 1
Templates selected, indicating the topological regions where each
template is considered, for the multiple template homology modeling of
the AT2 inactive receptor
3.2 Ligand Docking We illustrate here our docking protocols for small molecules as well
and Initial Screening as peptide docking to GPCRs. Small-molecule docking protocols
are used to elucidate common binding mode of series of ligands in
the adenosine receptors, and to identify the binding mode of AT2
receptor agonists and antagonists. The peptide-docking protocols,
on the other hand, allow us to identify the binding mode of the
peptidic natural agonists of the AT receptors and NPY receptors.
3.2.1 Protein Preparation Regardless of whether we are exploring the binding of a small
molecule, a peptide, or a protein, the first step is to prepare the
conformation of the receptor considered. As we have discussed, this
might have been generated by homology modeling (see the AT2
Characterization of Ligand Binding to GPCRs Through Computational Methods 35
3.2.2 Small-Molecule l The ligands are drawn in the Maestro suite in 2D format, or
Docking alternatively imported into this program from a database (i.e.,
SDFile). Thereafter, a 3D structure is obtained with the LigPrep
utility in the Schrödinger package considering the following
options: the ionizable groups are protonated at physiological pH
with the Epik extension, and all stereoisomers and tautomers are
saved separately to be considered for parallel docking runs. A data-
base of ligands is saved in SDF format (see file ligands_A2A.sdf).
l We check if there is evidence for considering water molecules as
part of the binding site. If so, two parallel docking calculations
are computed: one without any water molecule, and a second
run where we include selected water molecules. The waters
should have been extracted in the protein-preparation stage,
saved as a separate PDB file, and considered for docking with
the corresponding option in GOLD “toogle” option from
GOLD Suite 5.2. With this flag, only the water molecules that
improve the binding score are retained and considered for the
binding (no water molecules are considered in this example).
l A typical docking run with GOLD in our lab considers the
following parameters: each ligand is docked 20 times with
default (high accuracy) genetic algorithm search parameters,
using the scoring function Chemscore. The ligand is fully flexi-
ble, including the consideration of amide bond flipping and
rotation of protein hydroxyl groups. We typically consider a
sphere of 15 Å radius defining the binding pocket of the recep-
tor, which in the AR projects is centered on the sidechain (CD1)
of Ile7.39. As a second example, in the AT projects a docking
sphere of the same size is centered on an equidistant point
between residues K5.42, R4.64, and Y7.43.
l The selection of the docking pose is done by a combination of
three criteria. (a) The binding mode proposed for a congeneric
36 Silvana Vasile et al.
Fig. 3 Binding mode of the A2AAR partial agonist used in this example [36] (magenta) in the crystal structure of
the receptor (rainbow color, TM1-blue ! TM7-red), superimposed on the crystallographic conformation of
adenosine bound to the A2AAR (gray)
3.2.3 Peptide Docking The protocols for peptide docking will be illustrated with the docking
of the NPY peptide into the homology model built for the hY2
receptor, as described in reference [17]. Two parallel strategies are
considered:
Automated Docking with This is a two-step strategy: first, the C-terminal dipeptide [CH3C
HADDOCK (O)-R35-Y36-NH2] is docked into the TM crevice of the homol-
ogy model, and the selected docking pose is used in a second stage
to define distance restraints that guide the automated protein–pro-
tein docking.
l The 2D structure of the dipeptide is drawn with the help of the
Maestro suite and the 3D version is obtained with LigPrep
(Schrödinger LCC, New York, NY).
l Docking is performed with GOLD, using the same parameters
as for small-molecule docking except for the following: sphere of
25 Å radius centered in the middle point between residues
Thr2.61 and Gln6.55; 50 docking runs; clustering according
to a 5 Å RMSD.
l Building of the initial structure of the NPY peptide: this is done
with default homology modeling settings in Modeller, using as a
template the structure of the aPP peptide (PDB code 2BF9, 53%
seq ID), and selecting the best model according to the DOPE-
HR scoring function.
l Docking with HADDOCK: based on mutagenesis data and the
contacts estimated from the docking of the dipeptide with
GOLD, residues Y36, R35, and R33 from the peptide and
residues Tyr2.64, Tyr3.30, Gln3.32, Tyr5.43, Asp6.59, and Leu6.51
from the receptor are selected as active residues to define the
“ambiguous distance restraints” guiding the docking. The best
200 structures are subjected to a rigid-body energy minimiza-
tion (2000 runs) in explicit solvent, selecting DMSO to better
represent the membrane environment of GPCRs.
Automated Docking of the This is also a two-step strategy, where the automated docking is
C-Terminus and Manual performed on a larger fragment (five residues) of the unwound
Elongation C-terminal tail of the peptide, and the adjustment of the full
α-helical structure of the NPY is done at a second stage by manual
docking followed by geometry optimization and MD.
l The structure of the pentapeptide [CH3C(O)-32TRQRY36-
NH2] is obtained as described previously (Subheading “Auto-
mated Docking with HADDOCK”).
l The Induced Fit Docking in Schrödinger Suite 2011 (Schrödin-
ger LCC, New York, NY) is used to dock the pentapeptide with
default settings. The grid of 30x30x30 points is centered in the
same point as described in the “Haddock” protocol.
38 Silvana Vasile et al.
3.3 Analyzing As stated in the introduction, the overall protein fold around the
Subtype Selectivity TM binding site is well conserved among GPCRs, though the
meta-analysis of crystal structures reveals some differences in helical
bending and orientation [37]. Earlier analyses revealed that the
phylogenetic relationship within the GPCR superfamily could be
reproduced by multiple sequence alignment of the pseudosequence
comprising the residues in the binding crevice [38]. Such a pseu-
dosequence alignment is the starting point for our exploration of
selectivity issues. Here, one can map the ligand affinity data on
receptor subtypes and receptor mutagenesis studies, with structural
and sequence differences. A first inspection at this level might give
some hints for the topologically equivalent positions that are
responsible for selectivity, which can be further examined by the
in silico mutagenesis protocol described in the next section.
In the angiotensin project, we modeled the two AT receptors in
both the active-like and inactive conformations (see Subheading 3.1
and Note 6). Two pairs of agonists and antagonists, derived from the
same chemical scaffold, were docked as explained in Subheading
3.2.1. A conserved binding mode was defined, which is shown in
Fig. 4. The main anchoring points are salt-bridge interactions of the
sulfonyl carbamate group with residues K5.42 and R4.64, conserved in
all cloned angiotensin receptors. The imidazole ring, which is the
only structural difference in selective compounds, is pointing toward
the extracellular side of transmembrane regions TM1-TM2 and
TM7. The pseudosequence alignment of the binding crevice
(Fig. 4) revealed differences in the hydrophobic cluster composed
by the residues F/L2.53, L2.57, W2.60, T/Y2.64, Y2.65, V/L3.32, P7.36,
and I7.39 (note the notation AT1/AT2 for differing amino acid
positions between the two receptors), as illustrated in Fig. 4.
3.4 Binding Free Our FEP protocol is here illustrated to reproduce the effect of a
Energy Simulations: In single-point mutation H2506.52N in the A2AAR, which slightly
Silico Mutagenesis favors the binding affinity of the agonist NECA, and is extracted
and SAR from our extensive in silico characterization of this system [34].
l The receptor complex, which is obtained in this case from a
crystal structure (PDB code 2YD0), is embedded in a lipid
Characterization of Ligand Binding to GPCRs Through Computational Methods 39
Fig. 4 The selective AT2 antagonist (compound 2 in Ref. 22) docked to the AT2 receptor model built in
Subheading 3.1 is superimposed on the crystal structure of the AT1 receptor (dark gray). The residues
identified as selectivity hotspots are labeled and shown in sticks in the 3D picture, and identified in black on
the pseudo-sequence alignment between AT1 and AT2 (bottom)
4 Notes
References
1. Santos R, Ursu O, Gaulton A et al (2017) A 522:279–336. https://doi.org/10.1016/
comprehensive map of molecular drug targets. B978-0-12-407865-9.00015-7
Nat Rev Drug Discov 16:19–34. https://doi. 5. Rodriguez D, Gutierrez-de-Teran H (2013)
org/10.1038/nrd.2016.230 Computational approaches for ligand discovery
2. Stevens RC, Cherezov V, Katritch V et al and design in class-a G protein-coupled recep-
(2013) The GPCR network: a large-scale col- tors. Curr Pharm Des 19:2216–2236
laboration to determine human GPCR struc- 6. Fredriksson R, Lagerström MC, Lundin L-G,
ture and function. Nat Rev Drug Discov Schiöth HB (2003) The G-protein-coupled
12:25–34. https://doi.org/10.1038/ receptors in the human genome form five
nrd3859 main families. Phylogenetic analysis, paralogon
3. Jazayeri A, Andrews SP, Marshall FH (2016) groups, and fingerprints. Mol Pharmacol
Structurally enabled discovery of adenosine 63:1256–1272. https://doi.org/10.1124/
A2A receptor antagonists. Chem Rev mol.63.6.1256
117:21–37. https://doi.org/10.1021/acs.che 7. Michino M, Abola E, GPCR Dock 2008 Parti-
mrev.6b00119 cipants et al (2009) Community-wide assess-
4. Kooistra AJ, Roumen L, Leurs R et al (2013) ment of GPCR structure modelling and ligand
From Heptahelical bundle to hits from the docking: GPCR dock 2008. Nat Rev Drug
haystack: structure-based virtual screening for Discov 8:455–463. https://doi.org/10.
GPCR ligands. Methods Enzymol 1038/nrd2877
Characterization of Ligand Binding to GPCRs Through Computational Methods 43
Abstract
Recent crystallographic structures of G protein-coupled receptors (GPCRs) have greatly advanced our
understanding of the recognition of their diverse agonist and antagonist ligands. We illustrate here how this
applies to A2A adenosine receptors (ARs) and to P2Y1 and P2Y12 receptors (P2YRs) for ADP. These X-ray
structures have impacted the medicinal chemistry aimed at discovering new ligands for these two receptor
families, including receptors that have not yet been crystallized but are closely related to the known
structures. In this Chapter, we discuss recent structure-based drug design projects that led to the discovery
of: (a) novel A3AR agonists based on a highly rigidified (N)-methanocarba scaffold for the treatment of
chronic neuropathic pain and other conditions, (b) fluorescent probes of the ARs and P2Y14R, as chemical
tools for structural probing of these GPCRs and for improving assay capabilities, and (c) new more drug-
like antagonists of the inflammation-related P2Y14R. We also describe the computationally enabled molec-
ular recognition of positive (for A3AR) and negative (P2Y1R) allosteric modulators that in some cases are
shown to be consistent with structure-activity relationship (SAR) data. Thus, computational modeling has
become an essential tool for the design of purine receptor ligands.
Key words Adenosine receptor, P2Y receptor, Structure-based drug design, X-ray crystallography,
Nucleosides, Nucleotides
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_3, © Springer Science+Business Media LLC 2018
45
46 Antonella Ciancetta and Kenneth A. Jacobson
Fig. 1 Structures of ligands described in the text for the: (a) AR and (b) P2YR families. The native agonists are
adenosine (1) and inosine (2), to a lesser extent, for ARs and ADP (26), ATP (27), UDP-glucose (30), and UDP
and UTP (not shown) for the P2YRs
Computer-Aided Drug Design for Adenosine and P2Y Receptors 47
Fig. 1 (continued)
2 Materials
2.1 X-Ray Structures The pace of reports on X-ray crystallographic GPCR structures,
of Complexes of Purine which are membrane-bound, has recently accelerated due to meth-
Receptors odological advances [33–36]. Although it is not yet a routine
process, and not amenable to the high-throughput methods
applied to X-ray crystallography of soluble proteins, the several
hundred structures, corresponding to dozens of GPCRs in differ-
ent complexes, have already turned the tide in drug discovery
approaches for this important superfamily of drug targets. We
analyze the current state of knowledge of purine receptors as an
illustration.
Computer-Aided Drug Design for Adenosine and P2Y Receptors 49
Table 1
Reported X-ray crystal structures of purine receptors (all human) and methods used in the
determination
(continued)
50 Antonella Ciancetta and Kenneth A. Jacobson
Table 1
(continued)
2.1.1 X-ray Structures The first structure of any purine receptor was an A2AAR complex
of the A1AR and A2AAR with potent antagonist 4-[2-[7-amino-2-(2-furyl)-1,2,4-triazolo
[1,5-a][1, 3, 5]triazin-5-yl-amino]ethyl]phenol (ZM241385, 13)
reported in 2007 [20]. The overall ligand arrangement was roughly
perpendicular to the membrane plane, in contrast to other GPCR
structures. This general orientation of the various ligands as stretch-
ing from the pharmacophore binding site toward the outer surface
applies to various ligands, such as the A2AAR structure in complex
with the high affinity xanthine amine congener (XAC, 12a) antag-
onist [21]. This ligand arrangement—roughly parallel to the TMs
(transmembrane domains)—was anticipated by earlier modeling
and by the many chain-functionalized analogues of agonists and
antagonists, which suggested that the distal tethered portions of
the molecules were exposed to the medium. There is more freedom
of substitution on the distal portions, because they are not
limited by the steric constraints of the pharmacophore binding
site [14, 37, 38].
Coordination of triazolo-triazine ZM241385 13 and other
antagonists in the A2AAR binding site (Fig. 2a) occurs through
both H-bonding and interactions with hydrophobic sidechains,
such as Leu6.51 (using Ballesteros-Weinstein convention for
amino acid numbering in the TMs [39]). The heterocyclic ring
forms π–π stacking with Phe168 (EL2). A conserved Asn6.55
(Asn253 in the A2AAR) forms bidentate H-bonds with the
Computer-Aided Drug Design for Adenosine and P2Y Receptors 51
Fig. 2 Left panel: High-resolution X-ray crystallographic structures of the hA2AAR [23] with (a) ZM241385
(13) and (b) NECA [16] (3). Right panel: Contacts between four cocrystallized ligands and the hA2AAR are
depicted
exocyclic amine and a triazole ring nitrogen atom, and the exocyclic
amine also H-bonds with Glu169 in EL2 (Fig. 2b). There are
differences in the position of the 2-(4-hydroxyphenyl)ethyl side-
chain of ZM241385 between different reported structures [16,
30], which suggests that this moiety, which approaches the recep-
tor’s exofacial side, has more conformational freedom than the
52 Antonella Ciancetta and Kenneth A. Jacobson
2.1.2 X-ray Structures Unlike AR molecular modeling, early P2YR molecular modeling
of the P2Y1R and P2Y12R based on the structure of bovine rhodopsin and other templates was
less successful in predicting the position and key interactions of
agonists and antagonists [59]. Ligands that have been cocrystallized
in P2YR X-ray structures include both agonists and antagonists
(Fig. 1b). The subsequent P2Y1 and P2Y12R X-ray structures
[29–31], representing each of the two P2YR subfamilies, brought
many surprises, i.e., features that were unlike any GPCR structures
previously determined (Figs. 3 and 4). Comparison of agonist-bound
and antagonist-bound P2Y12R indicates unprecedented structural
plasticity in the outer TM portions and the extracellular loops
(Fig. 4). There is a major difference in conformation needed to
56 Antonella Ciancetta and Kenneth A. Jacobson
Fig. 3 High-resolution X-ray crystallographic structure of the hA2AAR with high affinity agonist UK432097 (4)
bound (left, green carbon atoms) [17], and comparison with a hybrid homology model of the hA3AR with potent
C2-arylethynyl agonist MRS5980 (8) bound (right, magenta carbon atoms) [52]
Fig. 4 Left panel: High-resolution X-ray crystallographic structures [29] of the hP2Y1R showing the binding
sites for orthosteric antagonist MRS2500 (31) (yellow carbon atoms) and allosteric antagonist (NAM) BPTU (34)
(gray carbon atoms). Right panel: Contacts between two cocrystallized ligands and the hP2Y1R
Fig. 5 Left panel: Superimposition between X-ray crystallographic structures of the hP2Y12R in complex with
2-MeSADP (28) (yellow ribbon representation for the receptor and yellow carbon atoms for the ligand) [31] and
AZD1283 (35) (dark cyan ribbon representation for the receptor and dark cyan carbon atoms for the ligand)
[30]. Right panel: Contacts between two cocrystallized ligands and the hP2Y12R
58 Antonella Ciancetta and Kenneth A. Jacobson
3 Methods
3.1 Structure-Based Early molecular modeling and site-directed mutagenesis of the ARs
Medicinal Chemistry based on the bovine rhodopsin structure was relatively successful in
of the ARs predicting the position of agonists and antagonists in the orthos-
teric binding site and their interacting residues, as was subsequently
validated in the X-ray structures of antagonist-bound and later
agonist-bound A2AARs. The ARs are members of Family A
rhodopsin-like GPCRs, which is very close in overall structure to
rhodopsin itself, although the sequence homology is low. Conse-
quently, AR molecular modeling based on a rhodopsin template
gave favorable results prior to and during the initial A2AAR struc-
tural determination [37, 54, 55, 63]. The binding mode of nucleo-
sides observed in the agonist-bound A2AAR structures was
generalized to be consistent with the SAR of other known ligands,
leading to their structural modification guided by predicted favor-
able interactions with the receptor [64].
3.1.1 Medicinal The A2AAR structures have been utilized for virtual screening
Chemistry of the A2AAR (VS) campaigns to discover novel chemotypes that bind to the
ARs [65] and to modify known ligands [61, 65–67].
Previous efforts to model GPCR ligands were focused on an
overlay of common structures in different ligands to generate a
pharmacophore hypothesis of the molecular features needed for
binding [68], and these hypotheses often did not take into account
the receptor structure. Docking of 751 known antagonists in the
A2AAR structure to create a refined pharmacophore model
improved the predictive ability of subsequent quantitative SAR
statistical models [69]. The pharmacophore hypothesis was vali-
dated with new test set of 29 A2AAR antagonists related to
ZM241385 13.
Computer-Aided Drug Design for Adenosine and P2Y Receptors 59
3.1.2 Medicinal Originally, it was thought that A3AR antagonists might have
Chemistry of the A3AR broader application in the clinic than agonists, because of proin-
flammatory effects associated with acute agonist administration
[71]. A3AR antagonists have been proposed for the treatment of
glaucoma or kidney fibrosis [71–73]. However, it is now recog-
nized that A3AR agonists have shown efficacy in various animal
models of inflammatory disease, cancer and chronic neuropathic
pain [71, 74–76]. Thus, the improvement of the affinity and selec-
tivity of A3AR agonists has clear clinical relevance. Furthermore,
prototypical agonists IB-MECA 5 and Cl-IB-MECA 6 have
demonstrated safety and efficacy in Phase 2 and 1/2 clinical trials,
respectively, and are now progressing to more advances trials in
rheumatoid arthritis, psoriasis, hepatocellular carcinoma, and non-
alcoholic steatohepatitis (NASH) [71, 75].
The three-dimensional GPCR structures and related homology
models have been used for improving the affinity and selectivity of
known ligands as needed. For example, the design of A3AR agonists
has benefited from iterative cycles of ligand docking to A3AR
homology models followed by synthesis of new ligand analogues
and model refinement. Differences between the structures of the
AR subtypes are identified in the modeling process and can be used
advantageously to increase selectivity.
60 Antonella Ciancetta and Kenneth A. Jacobson
3.1.3 Virtual Screening In silico screening of diverse chemical libraries has identified
to Discover AR Ligands numerous novel chemotypes for GPCR modulation. In silico
in General screening has identified chemically diverse ligands at each of the
AR subtypes. This structure-based drug design approach has been
applied using the A2AAR X-ray structures resulting in typical hit
rates of up to 40% with Ki values 10 μM [65, 74, 81]. In many
cases, the hits displayed not only A2AAR affinity but also affinity at
the closely related A1AR and/or A3AR. Thus, VS is a means of
discovering novel chemotypes for binding to other AR family
members because of the close structural homology.
Furthermore, nearly all of the hit molecules in VS of ARs were
found to be AR antagonists, using as a template either an
antagonist-bound A2AAR structure (as expected) or an agonist-
bound structure (unexpected) [74, 81, 82]. This illustrated the
close structural tolerance needed for AR activation and that non-
ribosides were highly unlikely to be suitable. Instead, the challenge
62 Antonella Ciancetta and Kenneth A. Jacobson
3.1.4 A3AR Allosteric Nearly all of the AR X-ray structures reported contained orthosteric
Modulators ligands, but modeling has been applied to the binding of allosteric
ligands as well. Several classes of nitrogen heterocyclic molecules
have been shown to be positive allosteric modulators (PAMs) for
the A3AR, but no X-ray structures to firmly establish their binding
site on the receptor. One such allosteric enhancer is N-
(3,4-dichloro-phenyl)-2-cyclohexyl-1H-imidazo[4,5-c]quinolin-
4-amine (LUF6000, 10). Nevertheless, site-directed mutagenesis
and modeling approaches, including Supervised Molecular Dynam-
ics (SuMD), have attempted to determine the residues involved in
their allosteric binding vs. the residues needed for orthosteric bind-
ing [89]. In the SuMD study, LUF6000 was found to engage in
interactions with a putative meta-binding site located at the inter-
face between EL2 and the upper region of TM5 and TM6, prior to
reaching the orthosteric site. A π–π stacking interaction established
with Phe168 (EL2) triggered the allosteric modulator to reach the
orthosteric binding site occupied by the agonist adenosine (1). In
the final ternary complex, LUF6000 established hydrophobic con-
tacts with residues in the upper region of the orthosteric binding
site, thus acting as “pocket cap.”
3.2.2 Medicinal The first step in extending the reported P2YR structures to novel
Chemistry of the P2Y12R ligands and subsequently to other P2YR subtypes was an effort to
explain the known ligand SAR. Representative P2Y12R ligands
from different chemical classes were docked in the structures
[58]. The P2Y12R X-ray structures with nucleotides bound
(2-MeSADP and the corresponding triphosphate) differ greatly in
conformation from the complex with nonnucleotide antagonist
AZD1283 35 bound (Fig. 4). Therefore, the question arose as to
which structure could best serve as a suitable template for modeling
the binding of various known P2Y12R ligands. The nucleotide
complex(es) were found to be a suitable template for various ago-
nists and diverse antagonists, many of which contain negatively
charged groups. These diverse anionic groups were predicted to
interact with Lys7.35—similar to its interaction with the partial
negative charge of a sulfonyl oxygen of 35 in its P2Y12R complex
(Fig. 4). The binding of nucleotide Cangrelor 32, which is now an
approved antithrombotic drug, was well accommodated in the
same orientation as 2-MeSADP 28 in its P2Y12R complex (Fig. 6
left). The adenine moiety forms ππ stacking with Tyr3.33, sug-
gesting that nonaromatic nucleobase substitution is not possible at
P2Y12R (Fig. 4). Although bulkier than the corresponding
Computer-Aided Drug Design for Adenosine and P2Y Receptors 65
Fig. 6 High-resolution X-ray crystallographic structures of the hP2Y12R with agonist 2-MeSADP (28) bound
(purple carbon atoms, left), and comparison with a homology model of the hP2Y14R with potent nonnucleotide
antagonist MRS4217 (37) bound (pink carbon atoms, right) [14]
4 Notes
Acknowledgments
References
1. Santos R, Ursu O, Gaulton A et al (2016) A pathogenesis and treatment of rheumatic dis-
comprehensive map of molecular drug tar- eases. Nat Rev Rheumatol 13:41–51. https://
gets. Nat Rev Drug Discov 16:19–34. doi.org/10.1038/nrrheum.2016.178
https://doi.org/10.1038/nrd.2016.230 8. Zimmermann H, Zebisch M, Str€a ter N
2. Mason JS, Bortolato A, Weiss DR et al (2013) (2012) Cellular function and molecular struc-
High end GPCR design: crafted ligand design ture of ecto-nucleotidases. Purinergic Signal
and druggability analysis using protein struc- 8:437–502. https://doi.org/10.1007/
ture, lipophilic hotspots and explicit water s11302-012-9309-4
networks. In Silico Pharmacol 1:23. https:// 9. Boison D (2013) Adenosine kinase: exploita-
doi.org/10.1186/2193-9616-1-23 tion for therapeutic gain. Pharmacol Rev
3. Tautermann CS (2014) GPCR structures in 65:906–943. https://doi.org/10.1124/pr.
drug design, emerging opportunities with 112.006361
new structures. Bioorg Med Chem Lett 10. Schöneberg T, Hermsdorf T, Engemaier E
24:4073–4079. https://doi.org/10.1016/j. et al (2007) Structural and functional evolu-
bmcl.2014.07.009 tion of the P2Y12-like receptor group. Puri-
4. Rodrı́guez D, Ranganathan A, Carlsson J nergic Signal 3:255–268. https://doi.org/
(2015) Discovery of GPCR ligands by molec- 10.1007/s11302-007-9064-0
ular docking screening: novel opportunities 11. Verkhratsky A, Burnstock G (2014) Biology
provided by crystal structures. Curr Top of purinergic signalling: its ancient evolution-
Med Chem 15:2484–2503 ary roots, its omnipresence and its multiple
5. Kooistra AJ, Vischer HF, McNaught-Flores D functional significance. BioEssays
et al (2016) Function-specific virtual screen- 36:697–705. https://doi.org/10.1002/bies.
ing for GPCR ligands using a combined scor- 201400024
ing method. Sci Rep 6:28288. https://doi. 12. Toti KS, Osborne D, Ciancetta A et al (2016)
org/10.1038/srep28288 South (S)- and north (N)-methanocarba-7-
6. Burnstock G (2016) Short- and long-term deazaadenosine analogues as inhibitors of
(trophic) purinergic signalling. Philos Trans human adenosine kinase. J Med Chem
R Soc B Biol Sci 371:20150422. https:// 59:6860–6877. https://doi.org/10.1021/
doi.org/10.1098/rstb.2015.0422 acs.jmedchem.6b00689
7. Cronstein BN, Sitkovsky M (2016) Adeno- 13. Tosh DK, Deflorian F, Phan K et al (2012)
sine and adenosine receptors in the Structure-guided design of A3 adenosine
68 Antonella Ciancetta and Kenneth A. Jacobson
Abstract
The recent surge of crystal structures of G protein-coupled receptors (GPCRs), as well as comprehensive
collections of sequence, structural, ligand bioactivity, and mutation data, has enabled the development of
integrated chemogenomics workflows for this important target family. This chapter will focus on cross-
family and cross-class studies of GPCRs that have pinpointed the need for, and the implementation of, a
generic numbering scheme for referring to specific structural elements of GPCRs. Sequence- and structure-
based numbering schemes for different receptor classes will be introduced and the remaining caveats will be
discussed. The use of these numbering schemes has facilitated many chemogenomics studies such as
consensus binding site definition, binding site comparison, ligand repurposing (e.g. for orphan receptors),
sequence-based pharmacophore generation for homology modeling or virtual screening, and class-wide
chemogenomics studies of GPCRs.
Key words G protein-coupled receptors, GPCRs, Crystal structures, Chemogenomics, Drug discov-
ery, Ligand repurposing, Numbering schemes, Mutations
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_4, © Springer Science+Business Media LLC 2018
73
74 Márton Vass et al.
Fig. 1 GPCR phylogenetic tree with crystallized receptors and number of publicly available crystal structures
with unique ligands indicated. The alignment of representative class A and all class B, C and F GPCR X-ray
76 Márton Vass et al.
Fig. 1 (continued) structures reveals the conserved transmembrane heptahelical fold as well as large
differences in the extra- and intracellular loop regions and in the structures co-crystallized in complex with
Gs-protein or Arrestin-1. Moreover, the diversity of ligand binding sites is also highlighted. The aligned
structures are Rhodopsin (PDB: 1F88 [21], 5DGY [22] co-crystallized with Arrestin-1), β1 (PDB: 2Y00 [23]),
β2 (PDB: 3SN6 [24] co-crystallized with trimeric Gs-protein), H1 (PDB: 3RZE [25]), CXCR4 (PDB: 3ODU [26]),
CCR2 (PDB: 5T1A [27]), GCGR (PDB: 4L6R [28], 5EE7 [29]), CRF1 (PDB: 4K5Y [30], 4Z9G [31]), mGlu1 (PDB:
4OR2 [32]), mGlu5 (PDB: 4OO9 [33], 5CGC [34], 5CGD [34]), SMO (PDB: 4JKV [35], 4N4W [19], 4O9R [36],
4QIM [19], 4QIN [19], 5L7D [37] truncated before S190, 5L7I [37])
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 77
class F/Frizzled (smoothened, SMO) receptors. Receptor-specific UniProt numbers are colored gray, and their Ballesteros-Weinstein residue number
appended by the corresponding GPCR class letter are shown in superscript. In addition to Ballesteros-Weinstein reference positions, cysteines in the
conserved disulfide bridge (C3.25a/f/C3.29b/c and C45.50) are indicated. Most conserved residues (at the X.50 position) are marked cyan, whereas
conserved residues (>45%) between GPCR families that are not considered conserved reference residues for a specific family are marked green.
Receptors where the most conserved residues (at the X.50 position) are not conserved are listed in the last column
Márton Vass et al.
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 79
helix had more than one fully conserved position, the one closest to
the class A BW numbering was used by Wang et al. as the reference
position. Since these numbering schemes share the same format-
ting, it was proposed to use the class designation as a lower case
letter after the residue number if there is possible ambiguity [16].
Different GPCR classes share reference positions in TM1
1.50b
(S /G1.50c), TM3 (R3.50a/W3.50f, E3.50b/K3.50c), TM4
4.50a50b50f
(W ), TM5 (P5.50a/L5.50c), and TM7 (P7.50a/I7.50f), as
shown in Table 1. The most conserved residue in TM3 in class B
GPCRs, for example, is E3.50b that structurally aligns with the con-
served K3.50c in class C GPCRs and corresponds to positions 3.46a
and 3.46f in class A and class F GPCRs, respectively. For class F
GPCRs the most conserved residue in TM3 is W3.50f, which struc-
turally overlaps with the class A R3.50a. Consequently, the conserved
cysteine in the TM3-ECL2 cysteine bridge gets the number C3.25a/
C3.25f in class A and F GPCRs, and C3.29b/C3.29c in class B and C
GPCRs. The most conserved residues in the seven transmembrane
helices are also often part of larger conserved motifs in the different
receptor classes and are implicated in signal transduction. Classes A
(CW6.48axP6.50a), B1 (W6.53b), and C (W6.50c) for example share a
conserved tryptophan residue that is part of the so-called toggle
switch that is implicated in the activation of class A GPCRs
[61]. The rearrangement of conserved hydrophobic contacts
between hydrophobic residues in TM3 (including I/L/M3.46a)
and TM6 (including L/V/I6.37a) connects the toggle switch with
the ionic lock between TM3 (D[E]R3.50aY) and TM6 (D/E6.30a)
and the intracellular end of TM7 (NP7.50axxY7.53a) along the activa-
tion pathways of class A GPCRs [62]. Motifs with a different com-
position but possibly a similar function have been identified in
class B, C, and F receptors as well and are shown in Fig. 2. The
ionic locks in Class B (H2.50b and E3.50b) and class C (K3.50c and
E6.35c) GPCRs for example form H-bond networks with conserved
residues in TM7 (FQG7.50bxxVxxxY7.75b, FxP7.50cKxY7.53c) that
have been proposed to facilitate conformational changes of TM7
associated with receptor activation in these GPCR classes [16].
2.3 From Gapless to Although the sequence conservation between the different GPCR
Structure-Based GPCR classes is low, the structural fold is well conserved and the elucida-
Sequence Numbering tion of multiple crystal structures from all the major classes has
made it possible to construct structure-based cross-class sequence
alignments. Such alignments are currently easily available in an
interactive manner in GPCRdb [66, 67]. Although TM helices
are known to deviate laterally, and by their tilt angles and kinks in
the helices, local helix alignments are still possible and do not
complicate generic numbering attempts. However, the former
assumption that sequences should always be aligned without gaps
within the TM helices is no longer valid. Bulges and constrictions
have been identified that are localized to one π-helical (additional
80 Márton Vass et al.
Fig. 2 Conserved structural motifs in class A, B, C, and F GPCRs: β1 (PDB: 2Y00 [23]), GCGR (PDB: 4L6R [28]
for TMD, 4ERS [63] for ECD, 5EE7 [29] for alternative W4.50b rotamer), mGlu1 (PDB: 4OR2 [32] for TMD, 1EWK
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 81
Fig. 2 (continued) [64] for VFD, 2E4U [65] for CRD from mGlu3), SMO (PDB: 5L7D [37]). TMD transmembrane
domain, ECD extracellular domain, CRD cysteine-rich domain, VFD Venus flytrap domain, LD linker domain
82 Márton Vass et al.
Fig. 3 Bulges and constrictions in GPCR crystal structures determining the structure of ligand binding sites: H1
(PDB: 3RZE [25]), CXCR4 (PDB: 3ODU [26]), β1 (PDB: 2Y00 [23]), SMO (PDB: 4N4W [19]), mGlu1 (PDB: 4OR2
[32]), CRF1 (PDB: 4Z9G [31]), mGlu5 (PDB: 5CGD [34]). Class specific continuous and gapped structure-based
generic numbers are indicated by colored/gray and black numbers, respectively
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 83
2.4 Residue On top of the numbering of the transmembrane helices now helix
Numbering in Loops 8 and ICL1/2 and ECL1/2—which contain conserved secondary
and Helix 8 structure elements—are also numbered in GPCRdb denoting the
most conserved residue with 50 and upstream and downstream
residues by continuously decreasing and increasing numbers. For
example, the conserved cysteine bridge in ECL2 gets the number
45x50 (45 for the loop between TM4 and TM5) and the well-
conserved phenylalanine in H8 gets the number 8x50. ICL1 often
features a single-turn helix, ICL2 a double-turn helix, and ECL1 a
bend (aromatic-proline-hydrophobic). However, amino acids out-
side these conserved motifs can still only be referred to by their
UniProt sequence numbers. The generic GPCR numbering
scheme has also inspired the definition of numbering schemes for
other transmembrane protein families [68, 69].
2.5 Assigning and All of the aforementioned numbering schemes are available in
Comparing Different GPCRdb [66, 67] through the web interface or the GPCRdb
Residue Numbering REST API. GPCRdb also provides a service to assign generic
Schemes numbers to GPCR structures uploaded by the user. Furthermore,
the various numbering schemes returned by the GPCRdb REST
API are easily retrieved and utilized in chemogenomics workflows
in KNIME [70] using the 3D-e-Chem GPCRdb KNIME nodes
[71, 72] which are discussed in more detail in Subheading 3.6.
3.1 Consensus After the elucidation of the first rhodopsin crystal structure in 2000
Binding Site there was a surge of GPCR chemogenomics studies primarily aimed
Definitions and Ligand at comparative modeling and binding site characterization of other
Repurposing GPCRs and defining common motifs or motifs conveying selectiv-
ity in the receptors. The identification of the common binding site
84 Márton Vass et al.
They also gave a numbering conversion table for the 22 amino acids
constituting the consensus binding site [75]. Using the same phy-
sicogenetics method the MCHR1 receptor was identified to pos-
sess similar features in its binding site as the dopamine D2 and D3
receptors and therefore dopamine antagonist scaffolds were utilized
in identifying novel MCHR1 ligands with D3.32a hypothesized to
interact with the basic ligand moieties similarly to aminergic recep-
tors [75, 78]. Finally, CCR2 was found to have similar features in its
binding site to serotonin receptors with E7.39x38a anchoring the
positively charged ligands, which was verified by the recently pub-
lished CCR2 crystal structure.
The consensus binding pocket approach was extended to class
C receptors in a similar analysis as the previous ones but using a
robust alignment algorithm based on functional amino acid con-
servation indices, able to cope with the low sequence similarities
between GPCR classes [79, 80]. Using this method an alignment
between bovine rhodopsin and rat mGlu1 and mGlu5 and human
CaSR TM helices was possible and a consensus binding pocket of
35 residues given by their class A BW numbers. Converting the
residue maps of the consensus binding pocket to pharmacophore
models allowed the prediction of ligand binding modes and the
identification of key interacting residues for mutational studies. The
authors correctly predicted that ligands like EM-TBPC (such as the
cocrystallized FITM) interact with T7.32x33c in a more extracellular
pocket in mGlu1 than the acetylene ligands MPEP (such as the
cocrystallized Mavoglurant, PDB: 4OO9 [33], Fig. 4) deep in the
TM bundle in mGlu5 contacted by e.g., P3.40c, Y3.44c, L5.44c,
W6.50c, and F6.53c. Although the ligands that have been later
cocrystallized with the human mGlu1 and mGlu5 are not exactly
the ones studied there, they are structurally similar and the identi-
fied interacting residues are also in contact with the cocrystallized
ligands (except for N5.37c).
Surgand et al. provided a systematic and detailed overview of
the TM sequence alignments of all non-olfactory receptors and
compared binding sites based clustering into 22 clusters to the full
sequence-based phylogenetic tree for all the GPCR classes
[136]. They analyzed the composition of binding sites for all the
GPCR clusters and related it to the physico-chemical parameters
of their known ligands and receptor mutagenesis studies. Further-
more, one of the first attempts was made to relate orphan GPCRs
to similar, well-studied GPCRs and to propose ligand repurposing
for orphans (this approach is further discussed in the following
section). GPR88, for example, was identified to be close to dopa-
mine D1 and D5 receptors when considering the TM domain, but
clustered with class C GPCRs based on the 30 residues designated
by the authors to form the binding site. The binding site
definition was used by the authors to construct a fixed-length
protein-ligand fingerprint (PLFP) consisting of 240 bits
86
Márton Vass et al.
Fig. 4 (a–d) Co-crystallized ligands in GPCR X-ray structures [19, 21, 23–27, 29, 30, 32–37, 76, 77, 81–135]. Polar and covalent interactions with binding pocket
residues are indicated. H-bonds conserved within receptor subfamilies are indicated with colored atoms (red, blue, magenta)
Fig. 4 (continued)
Fig. 4 (continued)
Fig. 4 (continued)
90 Márton Vass et al.
3.2 Binding Site A similar large-scale analysis of sequence alignments and meta-
Comparison Aids Tool analysis of the previously reported binding site definitions was
Discovery for Orphan performed by Gloriam et al. [47]. In this review seven previously
Receptors published binding site definitions were compared and analyzed in
light of the available rhodopsin, β1/2 and A2A structures and muta-
tional data, and a new consensus binding pocket residue superset
was proposed using the BW numbering scheme consisting of
44 amino acids contacting ligands in any known complexes at the
time. Furthermore, clustering was also performed based on the
conservation or these 44 residues. In this clustering for example,
lipid receptors were grouped into larger clusters than in previous
phylogenetic analyses and also several orphan receptors were pro-
posed to be activated by lipid ligands. For example, the orphan
receptors GPR3, GPR6, and GPR12 had been proposed to bind
sphingosine 1-phosphate and were grouped to the lysophospholi-
pid receptors. GPR23 and GPR92 had been proposed to be acti-
vated by lysophosphatidic acids and grouped close to lipid receptors
with similar ligands. GPR37 had been proposed to be activated by
the neuropeptide head activator and was grouped adjacent to
endothelin receptors in a large peptide binding receptor cluster. A
binding site similarity analysis was also performed for the GPR139
orphan receptor over the 44 identified contact residues
[138]. Besides other orphan receptors, the human MC2/4 and
TRH1 receptors were found to possess the highest similarity in
their binding pockets and therefore peptide ligands of these recep-
tors and related peptides were tested against GPR139 (Fig. 5). The
peptide hormones β-MSH and ACTH and several truncated pro-
ducts of the latter (α-MSH, α-MSH1–9, α-MSH1–10, and the core
tetrapeptide α-MSH6–9 ¼ HFRW) were indeed found to activate
GPR139 with 0.3–6 μM EC50. Furthermore, α-MSH1–9 was pre-
dicted to originate from the pre-pro-protein POMC via a putative
new cleavage site.
The class C GPRC6A receptor was recently discovered and
deorphanized and found to be activated by basic L-α-amino acids
L-Arg, L-Lys, and L-ornithine [139]. Another ligand repurposing
study from the closely related CaSR receptor identified Calindol
and NPS2143 as nonselective negative allosteric modulators of
GPRC6A binding in the TM domain anchored by E7.32x33c
[140]. Chemogenomics studies revealed that while the similarity
of the GPRC6A receptor to class A receptors based on the full TM
region is low, it is substantially similar in its binding site. This
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 91
Fig. 5 Selected examples of ligands used in, or identified by structural chemogenomics studies as discussed in
Subheading 3. Where available the affinities or potencies of the ligands for the targeted GPCRs are provided
Table 2
Consensus transmembrane binding pocket definitions for class A receptors. The number of crystal
structures in which amino acids at the specific positions (based on the GPCRdb structure-based
numbers) are contacting the cocrystallized small molecule are indicated out of a total of 134 class A
GPCR crystal structures (not including extrahelical and intracellular binding pockets or structures
with peptide/protein ligands; contacts defined by GPCRdb). Positions defined as comprising the
consensus transmembrane binding pocket in previous studies are marked with an X (data taken from
Refs. 24 and 77)
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 95
Table 3
Ligand contacting residues of noncanonical binding pockets in class A GPCRs and all class B, C, and
F GPCR crystal structures. The number of crystal structures in which amino acids at the specific
positions (based on the GPCRdb structure-based numbers) are contacting the cocrystallized small
molecule are indicated (contacts defined by GPCRdb)
3.4 Structural Not only the prediction of ligand binding but also of the functional
Determinants of effects of specific ligands is of great interest for drug discovery.
Ligand Functional Chemogenomics methods were also used to uncover specific
Effects GPCR features responsible for the agonistic and antagonistic
effects. Wichard et al. used mutual information analysis of coupled
GPCR sequence and ligand descriptor data to extract features in
agonist and antagonist ligands responsible for their specific func-
tional effects, significant molecular features in GPCRs for recogniz-
ing these ligands, and furthermore for their interactions with
specific G protein coupling partners [158]. Positions extracted for
selective agonistic effects in the helices were mainly located between
TM1, TM2, and TM3 (e.g., 1.31a, 1.36a, 2.40a, 2.44a, 3.33a),
while selective antagonistic sensitive positions were located mainly
between TM5 and TM6 (e.g., 5.36x37a, 5.40x41a, 5.57a). Ligand
descriptors were not so sensitive for separating antagonists and
agonists but presence of alcohols and phenols, and larger polar
surface area were related to agonists while, for example, a larger
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 97
Fig. 6 (a) General chemogenomics workflow scheme and (b) a specific workflow designed using the KNIME
analytics platform [70] that exploits and integrates heterogeneous data sources for the prediction of GPCR-
ligand interactions. The KNIME analytical workflow makes use of the 3D-e-Chem GPCRdb KNIME nodes
[71, 72] to collect phylogenetic and sequence information from GPCRdb on all class A GPCRs, then uses the
structure-based generic numbering scheme to construct a sequence alignment (Pivoting node), and performs
an ss-TEA analysis using the 3D-e-Chem ss-TEA score KNIME node for the prediction of hot spots in the
C3AR1 receptor. Finally, the top 15 predicted hot spot residues are selected for sequence comparison
(Similarity Search node) and a list of related receptors is returned of which the top 20 are shown, including
the crystallized AT1 receptor also identified to be similar in terms of binding pocket composition to C3AR1 in
Ref. 53. (c) The AT1 receptor binding pocket with co-crystallized Olmesartan (PDB: 4ZUD [76]). (d) Bioactivities
of the co-crystallized Olmesartan, the most potent C3AR1 ligand identified in Ref. 53 and the most similar AT1
ligand from ChEMBL. (e) Alignment of binding pocket residues of AT1 and C3AR1 from GPCRdb based on the
structure-based numbering scheme
98 Márton Vass et al.
3.5 GPCR Class-Wide From the recent literature it is evident that integrated use of differ-
Chemogenomics ent types of data in chemogenomics applications—protein
Studies sequence and structural data, ligand structural and biochemical
data, mutational effect data, etc.—leads to a performance improve-
ment of such methods. Several reviews have focused on gathering
and integrating these data for the different GPCR classes. A review
on aminergic GPCRs combined ligand affinity data, receptor muta-
genesis studies, amino acid sequence, and high-resolution struc-
tural analyses of GPCR-ligand interactions to highlight correlations
and differences between ligand similarity and ligand binding site
similarity of different aminergic receptors [48]. The study analyzes
the composition of the major bioamine and the minor allosteric
binding site, the latter of which is exploited by appendages of
dualsteric ligands and allosteric ligands experimentally determined
for the muscarinic M2 receptor but postulated for many other
aminergic receptors as well. The authors review homology model-
ing and virtual screening efforts against aminergic receptors and
collected a large body of mutational effect data (1420 single-point
mutations for 128 individual amino acid positions given by their
BW numbering) for the histamine receptor subfamily and the
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 99
4 Conclusions
Acknowledgments
References
1. Pierce KL, Premont RT, Lefkowitz RJ (2002) recommendations for new pairings with cog-
Seven-transmembrane receptors. Nat Rev nate ligands. Pharmacol Rev 65(3):967–986.
Mol Cell Biol 3(9):639–650. https://doi. https://doi.org/10.1124/pr.112.007179
org/10.1038/nrm908 11. Attwood TK, Findlay JB (1994) Fingerprint-
2. Stevens RC, Cherezov V, Katritch V, ing G-protein-coupled receptors. Protein Eng
Abagyan R, Kuhn P, Rosen H, Wuthrich K 7(2):195–203
(2013) The GPCR network: a large-scale col- 12. Kolakowski LF Jr (1994) GCRDb: a G-
laboration to determine human GPCR struc- protein-coupled receptor database. Receptors
ture and function. Nat Rev Drug Discov 12 Channels 2(1):1–7
(1):25–34. https://doi.org/10.1038/ 13. Fredriksson R, Lagerstrom MC, Lundin LG,
nrd3859 Schioth HB (2003) The G-protein-coupled
3. Overington JP, Al-Lazikani B, Hopkins AL receptors in the human genome form five
(2006) How many drug targets are there? main families. Phylogenetic analysis, paralo-
Nat Rev Drug Discov 5(12):993–996. gon groups, and fingerprints. Mol Pharmacol
https://doi.org/10.1038/nrd2199 63(6):1256–1272. https://doi.org/10.
4. Rask-Andersen M, Masuram S, Schioth HB 1124/mol.63.6.1256
(2014) The druggable genome: evaluation of 14. Nordstrom KJ, Sallman Almen M, Edstam
drug targets in clinical trials suggests major MM, Fredriksson R, Schioth HB (2011)
shifts in molecular class and indication. Annu Independent HHsearch, Needleman--
Rev Pharmacol Toxicol 54:9–26. https://doi. Wunsch-based, and motif analyses reveal the
org/10.1146/annurev-pharmtox-011613- overall hierarchy for most of the G protein-
135943 coupled receptor families. Mol Biol Evol
5. Garland SL (2013) Are GPCRs still a source 28 (9):2471–2480. doi:https://doi.org/10.
of new targets? J Biomol Screen 18 1093/molbev/msr061
(9):947–966. https://doi.org/10.1177/ 15. Tautermann CS (2014) GPCR structures in
1087057113498418 drug design, emerging opportunities with
6. Hauser AS, Attwood MM, Rask-Andersen M, new structures. Bioorg Med Chem Lett 24
Schiöth HB, Gloriam DE (2017) Trends in (17):4073–4079. https://doi.org/10.1016/
GPCR drug discovery: new agents, targets j.bmcl.2014.07.009
and indications. Nat Rev Drug Discov. In 16. Hollenstein K, de Graaf C, Bortolato A, Wang
press MW, Marshall FH, Stevens RC (2014)
7. Lv X, Liu J, Shi Q, Tan Q, Wu D, Skinner JJ, Insights into the structure of class B GPCRs.
Walker AL, Zhao L, Gu X, Chen N, Xue L, Si P, Trends Pharmacol Sci 35(1):12–22. https://
Zhang L, Wang Z, Katritch V, Liu ZJ, Stevens doi.org/10.1016/j.tips.2013.11.001
RC (2016) In vitro expression and analysis of 17. Leach K, Gregory KJ (2016) Molecular
the 826 human G protein-coupled receptors. insights into allosteric modulation of class C
Protein Cell 7(5):325–337. https://doi.org/ G protein-coupled receptors. Pharmacol Res.
10.1007/s13238-016-0263-8 https://doi.org/10.1016/j.phrs.2016.12.
8. Chung S, Funakoshi T, Civelli O (2008) 006
Orphan GPCR research. Br J Pharmacol 153 18. Harpsoe K, Boesgaard MW, Munk C,
(Suppl 1):S339–S346. https://doi.org/10. Brauner-Osborne H, Gloriam DE (2016)
1038/sj.bjp.0707606 Structural insight to mutation effects uncover
9. Roth BL, Kroeze WK (2015) Integrated a common allosteric site in class C GPCRs.
approaches for genome-wide interrogation Bioinformatics. https://doi.org/10.1093/
of the Druggable non-olfactory G protein- bioinformatics/btw784
coupled receptor superfamily. J Biol Chem 19. Wang C, Wu H, Evron T, Vardy E, Han GW,
290(32):19471–19477. https://doi.org/10. Huang XP, Hufeisen SJ, Mangano TJ, Urban
1074/jbc.R115.654764 DJ, Katritch V, Cherezov V, Caron MG, Roth
10. Davenport AP, Alexander SP, Sharman JL, BL, Stevens RC (2014) Structural basis for
Pawson AJ, Benson HE, Monaghan AE, smoothened receptor modulation and che-
Liew WC, Mpamhanga CP, Bonner TI, Neu- moresistance to anticancer drugs. Nat Com-
big RR, Pin JP, Spedding M, Harmar AJ mun 5:4355. https://doi.org/10.1038/
(2013) International Union of Basic and ncomms5355
Clinical Pharmacology. LXXXVIII. G 20. McCabe JM, Leahy DJ (2015) Smoothened
protein-coupled receptor list: goes molecular: new pieces in the hedgehog
104 Márton Vass et al.
signaling puzzle. J Biol Chem 290 chemokine receptor 2 with orthosteric and
(6):3500–3507. https://doi.org/10.1074/ allosteric antagonists. Nature 540
jbc.R114.617936 (7633):458–461. https://doi.org/10.1038/
21. Palczewski K, Kumasaka T, Hori T, Behnke nature20605
CA, Motoshima H, Fox BA, Le Trong I, 28. Siu FY, He M, de Graaf C, Han GW, Yang D,
Teller DC, Okada T, Stenkamp RE, Zhang Z, Zhou C, Xu Q, Wacker D, Joseph
Yamamoto M, Miyano M (2000) Crystal JS, Liu W, Lau J, Cherezov V, Katritch V,
structure of rhodopsin: a G protein-coupled Wang MW, Stevens RC (2013) Structure of
receptor. Science 289(5480):739–745 the human glucagon class B G-protein-cou-
22. Zhou XE, Gao X, Barty A, Kang Y, He Y, pled receptor. Nature 499(7459):444–449.
Liu W, Ishchenko A, White TA, Yefanov O, https://doi.org/10.1038/nature12393
Han GW, Xu Q, de Waal PW, Suino-Powell 29. Jazayeri A, Dore AS, Lamb D,
KM, Boutet S, Williams GJ, Wang M, Li D, Krishnamurthy H, Southall SM, Baig AH,
Caffrey M, Chapman HN, Spence JC, Bortolato A, Koglin M, Robertson NJ, Errey
Fromme P, Weierstall U, Stevens RC, JC, Andrews SP, Teobald I, Brown AJ, Cooke
Cherezov V, Melcher K, HE X (2016) X-ray RM, Weir M, Marshall FH (2016) Extra-
laser diffraction for structure determination of helical binding site of a glucagon receptor
the rhodopsin-arrestin complex. Sci Data antagonist. Nature 533(7602):274–277.
3:160021. https://doi.org/10.1038/sdata. https://doi.org/10.1038/nature17414
2016.21 30. Hollenstein K, Kean J, Bortolato A, Cheng
23. Warne T, Moukhametzianov R, Baker JG, RK, Dore AS, Jazayeri A, Cooke RM,
Nehme R, Edwards PC, Leslie AG, Schertler Weir M, Marshall FH (2013) Structure of
GF, Tate CG (2011) The structural basis for class B GPCR corticotropin-releasing factor
agonist and partial agonist action on a beta receptor 1. Nature 499(7459):438–443.
(1)-adrenergic receptor. Nature 469 https://doi.org/10.1038/nature12357
(7329):241–244. https://doi.org/10.1038/ 31. Dore AS, Bortolato A, Hollenstein K, Cheng
nature09746 RK, Read RJ, Marshall FH (2017) Decoding
24. Rasmussen SG, DeVree BT, Zou Y, Kruse Corticotropin-releasing factor receptor type
AC, Chung KY, Kobilka TS, Thian FS, Chae 1 crystal structures. Curr Mol Pharmacol.
PS, Pardon E, Calinski D, Mathiesen JM, https://doi.org/10.2174/1874467210666
Shah ST, Lyons JA, Caffrey M, Gellman SH, 170110114727
Steyaert J, Skiniotis G, Weis WI, Sunahara 32. Wu H, Wang C, Gregory KJ, Han GW, Cho
RK, Kobilka BK (2011) Crystal structure of HP, Xia Y, Niswender CM, Katritch V,
the beta2 adrenergic receptor-Gs protein Meiler J, Cherezov V, Conn PJ, Stevens RC
complex. Nature 477(7366):549–555. (2014) Structure of a class C GPCR metabo-
https://doi.org/10.1038/nature10361 tropic glutamate receptor 1 bound to an allo-
25. Shimamura T, Shiroishi M, Weyand S, steric modulator. Science 344(6179):58–64.
Tsujimoto H, Winter G, Katritch V, https://doi.org/10.1126/science.1249489
Abagyan R, Cherezov V, Liu W, Han GW, 33. Dore AS, Okrasa K, Patel JC, Serrano-
Kobayashi T, Stevens RC, Iwata S (2011) Vega M, Bennett K, Cooke RM, Errey JC,
Structure of the human histamine H1 recep- Jazayeri A, Khan S, Tehan B, Weir M, Wiggin
tor complex with doxepin. Nature 475 GR, Marshall FH (2014) Structure of class C
(7354):65–70. https://doi.org/10.1038/ GPCR metabotropic glutamate receptor
nature10236 5 transmembrane domain. Nature 511
26. Wu B, Chien EY, Mol CD, Fenalti G, Liu W, (7511):557–562. https://doi.org/10.1038/
Katritch V, Abagyan R, Brooun A, Wells P, Bi nature13396
FC, Hamel DJ, Kuhn P, Handel TM, 34. Christopher JA, Aves SJ, Bennett KA, Dore
Cherezov V, Stevens RC (2010) Structures AS, Errey JC, Jazayeri A, Marshall FH,
of the CXCR4 chemokine GPCR with small- Okrasa K, Serrano-Vega MJ, Tehan BG, Wig-
molecule and cyclic peptide antagonists. Sci- gin GR, Congreve M (2015) Fragment and
ence 330(6007):1066–1071. https://doi. structure-based drug discovery for a class C
org/10.1126/science.1194396 GPCR: discovery of the mGlu5 negative allo-
27. Zheng Y, Qin L, Zacarias NV, de Vries H, steric modulator HTL14242 (3-Chloro-5-
Han GW, Gustavsson M, Dabros M, [6-(5-fluoropyridin-2-yl)pyrimidin-4-yl]ben-
Zhao C, Cherney RJ, Carter P, Stamos D, zonitrile). J Med Chem 58(16):6653–6664.
Abagyan R, Cherezov V, Stevens RC, Ijzer- https://doi.org/10.1021/acs.jmedchem.5b
man AP, Heitman LH, Tebben A, Kufareva I, 00892
Handel TM (2016) Structure of CC
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 105
54. Schwartz TW, Gether U, Schambye HT, 64. Kunishima N, Shimada Y, Tsuji Y, Sato T,
Hjorth SA (1995) Molecular mechanism of Yamamoto M, Kumasaka T, Nakanishi S,
action of non-peptide ligands for peptide Jingami H, Morikawa K (2000) Structural
receptors. Curr Pharm Des 1(3):325–342 basis of glutamate recognition by a dimeric
55. Henderson R, Baldwin JM, Ceska TA, metabotropic glutamate receptor. Nature
Zemlin F, Beckmann E, Downing KH 407(6807):971–977. https://doi.org/10.
(1990) Model for the structure of bacterio- 1038/35039564
rhodopsin based on high-resolution electron 65. Muto T, Tsuchiya D, Morikawa K, Jingami H
cryo-microscopy. J Mol Biol 213 (2007) Structures of the extracellular regions
(4):899–929. https://doi.org/10.1016/ of the group II/III metabotropic glutamate
S0022-2836(05)80271-2 receptors. Proc Natl Acad Sci U S A 104
56. Schertler GF, Villa C, Henderson R (1993) (10):3759–3764. https://doi.org/10.1073/
Projection structure of rhodopsin. Nature pnas.0611577104
362(6422):770–772. https://doi.org/10. 66. Isberg V, Mordalski S, Munk C, Rataj K,
1038/362770a0 Harpsoe K, Hauser AS, Vroling B, Bojarski
57. Unger VM, Hargrave PA, Baldwin JM, Scher- AJ, Vriend G, Gloriam DE (2016) GPCRdb:
tler GF (1997) Arrangement of rhodopsin an information system for G protein-coupled
transmembrane alpha-helices. Nature 389 receptors. Nucleic Acids Res 44(D1):
(6647):203–206. https://doi.org/10.1038/ D356–D364. https://doi.org/10.1093/
38316 nar/gkv1178
58. Wootten D, Simms J, Miller LJ, 67. Munk C, Isberg V, Mordalski S, Harpsoe K,
Christopoulos A, Sexton PM (2013) Polar Rataj K, Hauser AS, Kolb P, Bojarski AJ,
transmembrane interactions drive formation Vriend G, Gloriam DE (2016) GPCRdb: the
of ligand-specific and signal pathway-biased G protein-coupled receptor database – an
family B G protein-coupled receptor confor- introduction. Br J Pharmacol 173
mations. Proc Natl Acad Sci U S A 110 (14):2195–2207. https://doi.org/10.1111/
(13):5211–5216. https://doi.org/10.1073/ bph.13509
pnas.1221585110 68. Lee J, Sands ZA, Biggin PC (2016) A num-
59. Pin JP, Galvez T, Prezeau L (2003) Evolution, bering system for MFS transporter proteins.
structure, and activation mechanism of family Front Mol Biosci 3:21. https://doi.org/10.
3/C G-protein-coupled receptors. Pharmacol 3389/fmolb.2016.00021
Ther 98(3):325–354 69. Randolph AL, Mokrab Y, Bennett AL, San-
60. de Graaf C, Nijmeijer S, Wolf S, Ernst OP som MS, Ramsey IS (2016) Proton currents
(2016) 7TM Domain structure of adhesion constrain structural models of voltage sensor
GPCRs. Handb Exp Pharmacol 234:43–66. activation. elife 5. https://doi.org/10.7554/
https://doi.org/10.1007/978-3-319- eLife.18017
41523-9_3 70. Berthod M, Cebron N, Dill F, Gabriel T,
61. Trzaskowski B, Latek D, Yuan S, Kötter T, Meinl T, Ohl P, Sieb C, Thiel K,
Ghoshdastider U, Debinski A, Filipek S Wiswedel B (2007) KNIME: the Konstanz
(2012) Action of molecular switches in information miner. Studies in classification,
GPCRs – theoretical and experimental stud- data analysis, and knowledge organization.
ies. Curr Med Chem 19(8):1090–1109 Springer, Berlin, Heidelberg
62. Venkatakrishnan AJ, Deupi X, Lebon G, Hey- 71. Verhoeven S, Kooistra AJ, Vass M, McGuire
denreich FM, Flock T, Miljus T, Balaji S, R, Ritschel T, de Graaf C (2017) 3D-e-
Bouvier M, Veprintsev DB, Tate CG, Scher- Chem/knime-gpcrdb: v1.1.0. Zenodo.
tler GF, Babu MM (2016) Diverse activation http://doi.org/10.5281/zenodo.240491
pathways in class a GPCRs converge near the 72. McGuire R, Verhoeven S, Vass M, Vriend G,
G-protein-coupling region. Nature 536 De Esch IJ, Lusher SJ, Leurs R, Ridder L,
(7617):484–487. https://doi.org/10.1038/ Kooistra AJ, Ritschel T, de Graaf C (2017)
nature19107 3D-E-Chem-VM: structural cheminformatics
63. Koth CM, Murray JM, Mukund S, Madjidi A, research infrastructure in a freely available vir-
Minn A, Clarke HJ, Wong T, Chiang V, tual machine. J Chem Inf Model. https://doi.
Luis E, Estevez A, Rondon J, Zhang Y, org/10.1021/acs.jcim.6b00686
Hotzel I, Allan BB (2012) Molecular basis 73. Bondensgaard K, Ankersen M, Thogersen H,
for negative regulation of the glucagon recep- Hansen BS, Wulff BS, Bywater RP (2004)
tor. Proc Natl Acad Sci U S A 109 Recognition of privileged structures by
(36):14393–14398. https://doi.org/10. G-protein coupled receptors. J Med Chem
1073/pnas.1206734109
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 107
RC, Cherezov V (2015) Structural basis for AP, Stevens RC (2008) The 2.6 Angstrom
bifunctional peptide recognition at human crystal structure of a human A2A adenosine
delta-opioid receptor. Nat Struct Mol Biol receptor bound to an antagonist. Science 322
22(3):265–268. https://doi.org/10.1038/ (5905):1211–1217. https://doi.org/10.
nsmb.2965 1126/science.1164772
88. Glukhova A, Thal DM, Nguyen AT, Vecchio 96. Kruse AC, Hu J, Pan AC, Arlow DH, Rosen-
EA, Jorg M, Scammells PJ, May LT, Sexton baum DM, Rosemond E, Green HF, Liu T,
PM, Christopoulos A (2017) Structure of the Chae PS, Dror RO, Shaw DE, Weis WI,
adenosine A1 receptor reveals the basis for Wess J, Kobilka BK (2012) Structure and
subtype selectivity. Cell 168(5):867–877. dynamics of the M3 muscarinic acetylcholine
e813. https://doi.org/10.1016/j.cell.2017. receptor. Nature 482(7386):552–556.
01.042 https://doi.org/10.1038/nature10867
89. Granier S, Manglik A, Kruse AC, Kobilka TS, 97. Kruse AC, Ring AM, Manglik A, Hu J, Hu K,
Thian FS, Weis WI, Kobilka BK (2012) Struc- Eitel K, Hubner H, Pardon E, Valant C, Sex-
ture of the delta-opioid receptor bound to ton PM, Christopoulos A, Felder CC,
naltrindole. Nature 485(7398):400–404. Gmeiner P, Steyaert J, Weis WI, Garcia KC,
https://doi.org/10.1038/nature11111 Wess J, Kobilka BK (2013) Activation and
90. Haga K, Kruse AC, Asada H, Yurugi- allosteric modulation of a muscarinic acetyl-
Kobayashi T, Shiroishi M, Zhang C, Weis choline receptor. Nature 504
WI, Okada T, Kobilka BK, Haga T, Kobayashi (7478):101–106. https://doi.org/10.1038/
T (2012) Structure of the human M2 musca- nature12735
rinic acetylcholine receptor bound to an 98. Lebon G, Edwards PC, Leslie AG, Tate CG
antagonist. Nature 482(7386):547–551. (2015) Molecular determinants of
https://doi.org/10.1038/nature10753 CGS21680 binding to the human adenosine
91. Hanson MA, Cherezov V, Griffith MT, Roth A2A receptor. Mol Pharmacol 87
CB, Jaakola VP, Chien EY, Velasquez J, (6):907–915. https://doi.org/10.1124/
Kuhn P, Stevens RC (2008) A specific choles- mol.114.097360
terol binding site is established by the 2.8 A 99. Lebon G, Warne T, Edwards PC, Bennett K,
structure of the human beta2-adrenergic Langmead CJ, Leslie AG, Tate CG (2011)
receptor. Structure 16(6):897–905. https:// Agonist-bound adenosine A2A receptor
doi.org/10.1016/j.str.2008.05.001 structures reveal common features of GPCR
92. Hanson MA, Roth CB, Jo E, Griffith MT, activation. Nature 474(7352):521–525.
Scott FL, Reinhart G, Desale H, Clemons B, https://doi.org/10.1038/nature10136
Cahalan SM, Schuerer SC, Sanna MG, Han 100. Manglik A, Kruse AC, Kobilka TS, Thian FS,
GW, Kuhn P, Rosen H, Stevens RC (2012) Mathiesen JM, Sunahara RK, Pardo L, Weis
Crystal structure of a lipid G protein-coupled WI, Kobilka BK, Granier S (2012) Crystal
receptor. Science 335(6070):851–855. structure of the micro-opioid receptor
https://doi.org/10.1126/science.1215904 bound to a morphinan antagonist. Nature
93. Hua T, Vemuri K, Pu M, Qu L, Han GW, 485(7398):321–326. https://doi.org/10.
Wu Y, Zhao S, Shui W, Li S, Korde A, 1038/nature10954
Laprairie RB, Stahl EL, Ho JH, Zvonok N, 101. Miller RL, Thompson AA, Trapella C,
Zhou H, Kufareva I, Wu B, Zhao Q, Hanson Guerrini R, Malfacini D, Patel N, Han GW,
MA, Bohn LM, Makriyannis A, Stevens RC, Cherezov V, Calo G, Katritch V, Stevens RC
Liu ZJ (2016) Crystal structure of the human (2015) The importance of ligand-receptor
cannabinoid receptor CB1. Cell 167 conformational pairs in stabilization: spot-
(3):750–762.e714. https://doi.org/10. light on the N/OFQ G protein-coupled
1016/j.cell.2016.10.004 receptor. Structure 23(12):2291–2299.
94. Huang W, Manglik A, Venkatakrishnan AJ, https://doi.org/10.1016/j.str.2015.07.024
Laeremans T, Feinberg EN, Sanborn AL, 102. Moukhametzianov R, Warne T, Edwards PC,
Kato HE, Livingston KE, Thorsen TS, Kling Serrano-Vega MJ, Leslie AG, Tate CG, Scher-
RC, Granier S, Gmeiner P, Husbands SM, tler GF (2011) Two distinct conformations of
Traynor JR, Weis WI, Steyaert J, Dror RO, helix 6 observed in antagonist-bound struc-
Kobilka BK (2015) Structural insights into tures of a beta1-adrenergic receptor. Proc
micro-opioid receptor activation. Nature 524 Natl Acad Sci U S A 108(20):8228–8232.
(7565):315–321. https://doi.org/10.1038/ https://doi.org/10.1073/pnas.
nature14886 1100185108
95. Jaakola VP, Griffith MT, Hanson MA, 103. Oswald C, Rappas M, Kean J, Dore AS, Errey
Cherezov V, Chien EY, Lane JR, Ijzerman JC, Bennett K, Deflorian F, Christopher JA,
A Structural Framework for GPCR Chemogenomics: What’s In a Residue Number? 109
Jazayeri A, Mason JS, Congreve M, Cooke Weis WI, Bachhawat P, Kobilka TS, Sexton
RM, Marshall FH (2016) Intracellular alloste- PM, Kobilka BK, Christopoulos A (2016)
ric antagonism of the CCR9 receptor. Nature Crystal structures of the M1 and M4 musca-
540(7633):462–465. https://doi.org/10. rinic acetylcholine receptors. Nature 531
1038/nature20606 (7594):335–340. https://doi.org/10.1038/
104. Ring AM, Manglik A, Kruse AC, Enos MD, nature17188
Weis WI, Garcia KC, Kobilka BK (2013) 112. Thompson AA, Liu W, Chun E, Katritch V,
Adrenaline-activated structure of beta2- Wu H, Vardy E, Huang XP, Trapella C,
adrenoceptor stabilized by an engineered Guerrini R, Calo G, Roth BL, Cherezov V,
nanobody. Nature 502(7472):575–579. Stevens RC (2012) Structure of the nocicep-
https://doi.org/10.1038/nature12572 tin/orphanin FQ receptor in complex with a
105. Rosenbaum DM, Zhang C, Lyons JA, peptide mimetic. Nature 485
Holl R, Aragao D, Arlow DH, Rasmussen (7398):395–399. https://doi.org/10.1038/
SG, Choi HJ, Devree BT, Sunahara RK, nature11085
Chae PS, Gellman SH, Dror RO, Shaw DE, 113. Thorsen TS, Matt R, Weis WI, Kobilka BK
Weis WI, Caffrey M, Gmeiner P, Kobilka BK (2014) Modified T4 lysozyme fusion proteins
(2011) Structure and function of an irrevers- facilitate G protein-coupled receptor crystal-
ible agonist-beta(2) adrenoceptor complex. logenesis. Structure 22(11):1657–1664.
Nature 469(7329):236–240. https://doi. https://doi.org/10.1016/j.str.2014.08.022
org/10.1038/nature09665 114. Wacker D, Fenalti G, Brown MA, Katritch V,
106. Sato T, Baker J, Warne T, Brown GA, Leslie Abagyan R, Cherezov V, Stevens RC (2010)
AG, Congreve M, Tate CG (2015) Pharma- Conserved binding mode of human beta2
cological analysis and structure determination adrenergic receptor inverse agonists and
of 7-Methylcyanopindolol-bound beta1- antagonist revealed by X-ray crystallography.
adrenergic receptor. Mol Pharmacol 88 J Am Chem Soc 132(33):11443–11445.
(6):1024–1034. https://doi.org/10.1124/ https://doi.org/10.1021/ja105108q
mol.115.101030 115. Wacker D, Wang S, McCorvy JD, Betz RM,
107. Segala E, Guo D, Cheng RK, Bortolato A, Venkatakrishnan AJ, Levit A, Lansu K,
Deflorian F, Dore AS, Errey JC, Heitman Schools ZL, Che T, Nichols DE, Shoichet
LH, Ijzerman AP, Marshall FH, Cooke RM BK, Dror RO, Roth BL (2017) Crystal struc-
(2016) Controlling the dissociation of ligands ture of an LSD-bound human serotonin
from the adenosine A2A receptor through receptor. Cell 168(3):377–389. e312.
modulation of salt bridge strength. J Med https://doi.org/10.1016/j.cell.2016.12.
Chem 59(13):6470–6479. https://doi.org/ 033
10.1021/acs.jmedchem.6b00653 116. Wang C, Jiang Y, Ma J, Wu H, Wacker D,
108. Shao Z, Yin J, Chapman K, Grzemska M, Katritch V, Han GW, Liu W, Huang XP,
Clark L, Wang J, Rosenbaum DM (2016) Vardy E, McCorvy JD, Gao X, Zhou XE,
High-resolution crystal structure of the Melcher K, Zhang C, Bai F, Yang H,
human CB1 cannabinoid receptor. Nature. Yang L, Jiang H, Roth BL, Cherezov V, Ste-
https://doi.org/10.1038/nature20613 vens RC, HE X (2013) Structural basis for
109. Srivastava A, Yano J, Hirozane Y, Kefala G, molecular recognition at serotonin receptors.
Gruswitz F, Snell G, Lane W, Ivetac A, Science 340(6132):610–614. https://doi.
Aertgeerts K, Nguyen J, Jennings A, Okada org/10.1126/science.1232807
K (2014) High-resolution structure of the 117. Warne T, Edwards PC, Leslie AG, Tate CG
human GPR40 receptor bound to allosteric (2012) Crystal structures of a stabilized
agonist TAK-875. Nature 513 beta1-adrenoceptor bound to the biased ago-
(7516):124–127. https://doi.org/10.1038/ nists bucindolol and carvedilol. Structure 20
nature13494 (5):841–849. https://doi.org/10.1016/j.
110. Tan Q, Zhu Y, Li J, Chen Z, Han GW, str.2012.03.014
Kufareva I, Li T, Ma L, Fenalti G, Li J, 118. Warne T, Serrano-Vega MJ, Baker JG,
Zhang W, Xie X, Yang H, Jiang H, Moukhametzianov R, Edwards PC,
Cherezov V, Liu H, Stevens RC, Zhao Q, Henderson R, Leslie AG, Tate CG, Schertler
Wu B (2013) Structure of the CCR5 chemo- GF (2008) Structure of a beta1-adrenergic G-
kine receptor-HIV entry inhibitor maraviroc protein-coupled receptor. Nature 454
complex. Science 341(6152):1387–1390. (7203):486–491. https://doi.org/10.1038/
https://doi.org/10.1126/science.1241475 nature07101
111. Thal DM, Sun B, Feng D, Nawaratne V, 119. Weichert D, Kruse AC, Manglik A, Hiller C,
Leach K, Felder CC, Bures MG, Evans DA, Zhang C, Hubner H, Kobilka BK, Gmeiner P
110 Márton Vass et al.
The protein data bank. Nucleic Acids Res Mons A, Packer AL, Persson B, Rocca-Serra P,
28:235–242 Roos M, van Schaik R, Sansone SA,
164. Wilkinson MD, Dumontier M, Aalbersberg Schultes E, Sengstag T, Slater T, Strawn G,
IJ, Appleton G, Axton M, Baak A, Swertz MA, Thompson M, van der Lei J, van
Blomberg N, Boiten JW, da Silva Santos LB, Mulligen E, Velterop J, Waagmeester A,
Bourne PE, Bouwman J, Brookes AJ, Clark T, Wittenburg P, Wolstencroft K, Zhao J, Mons
Crosas M, Dillo I, Dumon O, Edmunds S, B (2016) The FAIR guiding principles for
Evelo CT, Finkers R, Gonzalez-Beltran A, scientific data management and stewardship.
Gray AJ, Groth P, Goble C, Grethe JS, Sci Data 3:160018. https://doi.org/10.
Heringa J, t Hoen PA, Hooft R, Kuhn T, 1038/sdata.2016.18
Kok R, Kok J, Lusher SJ, Martone ME,
Chapter 5
Abstract
The vast increase of recently solved GPCR X-ray structures forms the basis for GPCR homology modeling
to atomistic accuracy. Nowadays, homology models can be employed for GPCR-ligand optimization and
have been reported as invaluable tools for drug design in the last few years. Elucidation of the complex
GPCR pharmacology and the associated GPCR conformations made clear that different homology models
have to be constructed for different activation states of the GPCRs. Therefore, templates have to be chosen
accordingly to their sequence homology as well as to their activation state. The subsequent ligand
placement is nontrivial, as some recent X-ray structures show very unusual ligand binding sites and solvent
involvement, expanding the space of the putative ligand binding site from the generic retinal binding pocket
to the whole receptor. In the present study, a workflow is presented starting from the selection of the target
sequence, guiding through the GPCR modeling process, and finishing with ligand placement and pose
validation.
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_5, © Springer Science+Business Media LLC 2018
115
116 Christofer S. Tautermann
were not satisfying at all. Two more contests were held in 2010 and
2013 to predict the structures of CXCR4, D3 and SMO, 5-HT2B,
and 5-HT1B receptors respectively [6, 7]. In a nutshell, for the class
A receptors the overall topology and structure of the 7TM region
was predicted quite well. When it comes to the ligand binding pose
and the prediction of the structure of EL2 the performance was
much worse, unless a very close template (like β2 for D3) was
available. Recent quantitative investigations confirmed the strong
model quality dependence on the distance to the template [8]. Alto-
gether these three GPCR structure prediction exercises showed
that even the world-leading groups in GPCR modeling had a
hard time to predict a quantitatively correct ligand/receptor struc-
ture for a distant receptor.
Lead optimization (LO) is a late and decisive phase in preclini-
cal research of a drug. During LO the overall profile of a compound
class is optimized for multiple parameters, such as selectivity, phar-
macokinetics, potency, toxicity, and pharmacodynamics, to name a
few. Therefore the optimization of affinity, which is discussed as the
most essential parameter in most studies, is only one goal among
others within LO phases. The other parameters obviously depend
on the ligand structure as well and can directly be addressed by
ligand modifications. Therefore, the knowledge of the ligand/
receptor complex structure is of high interest, especially when
modifications of the ligand have to be performed while preserving
a high affinity to the receptor. One quite common goal is to
decrease the clogP of a ligand, which is in many cases directly
related to an increased metabolic stability and solubility [9]. If the
structure of the ligand/receptor complex is not known, it is not
clear which ligand positions allow higher polarity without being
detrimental to the affinity. Such optimization efforts often become
very demanding, because at the end drugs with a balanced profile
are required to be moved into clinical development.
Having said this, it is not surprising that LO support demands
high-quality ligand binding poses in a quite accurate binding site of
a receptor [10, 11]. However, it is not hopeless to get a decent
homology model for a GPCR target supported by the structure
revolution taking place over the last few years. Since 2012 every
year on average more than six new receptors have been structurally
solved and have been reported to the RSBC Protein Data Bank
[12] and the coverage of the GPCR phylogenetic tree increases
steadily. This means that for many GPCRs of interest at least one
appropriate template is available and the model generation may be
quite accurate in many cases. The very rich pharmacology of
GPCRs, however, adds another layer of complexity to the modeling
problem. It has been realized that often quite subtle differences in
the binding site of inactive and active state GPCRs are most impor-
tant for ligand binding [13]. In several cases agonists and inverse
agonists (or likewise PAMs and NAMs or ligands with different
GPCR Homology Model Generation for Lead Optimization 117
2 Methods
2.1 General The procedure described herein requires the presence of a high
Requirements performance computer environment, ideally based on a Linux
and Resources operating system. Shell scripting skills as well as basic programming
skills are advantageous, but not a prerequisite. The sound knowl-
2.1.1 Required edge of protein sequence and structure datatypes is highly
Computational Resources recommended.
and Programming Skills
2.1.2 GPCR Resources GPCR resources in the Internet have become crucial for the daily
in the Internet—Data life of researchers in the field—for sequences, structures, and phar-
and Web Services macology several well-curated databases exist which are well kept
up to date. In addition, for many steps in the procedures described
herein, Internet resources (web services) are available, which can
perform similar or identical tasks. The resources listed neither
provide an exhaustive overview, nor are only limited to GPCRs,
but most common tools are described. (For a more thorough
overview excellent reviews are available [25].) In many cases all
the databases cross-link to more detailed databases, but these are
often too detailed for usual GPCR modeling efforts.
1. UniProt [26] (http://www.uniprot.org/): “The mission of
UniProt is to provide the scientific community with a compre-
hensive, high-quality, and freely accessible resource of protein
sequence and functional information” is stated on the home-
page. This is the gold-standard of databases to retrieve the
correct protein sequence for a protein of interest.
2. GPCRdb [27] (http://gpcrdb.org/): The GPCRdb is a
resource which combines databases such as repositories of
GPCR sequences, structures, and mutagenesis data with tools
which enable the user to generate sequence alignments, phylo-
genetic trees, and snake plots, allows structure retrieval, tem-
plate selection, and enable the prediction of mutagenesis sites.
3. IUPHAR/BPS Guide to PHARMACOLOGY [28] (http://
www.guidetopharmacology.org/): This is a tertiary database of
expert curated data of pharmacological targets and the sub-
stances that act on them. This database is extremely useful to
get a very condensed overview about a target and its most
important ligands.
GPCR Homology Model Generation for Lead Optimization 119
2.2 Software The modeling process is a multi-step process and for every step a
specialized software tool is available. There are also companies
(such as Schrödinger inc.—https://www.schrodinger.com/) offer-
ing integrated software packages, which are able to perform every-
thing starting from the sequence alignment to the model
generation and ligand docking steps and the subsequent MD sim-
ulation within one environment. The huge advantage of such a
one-stop-shop solution is that the user does not need to worry
about file formats and input files and in addition these programs are
optimized for usability. However, there are reasons to keep the
multi-stage modeling process modular by using different tools for
different modeling steps. One important reason is the high degree
of specialization of various tools, where the expert user can choose
myriads of different settings, which may increase the result quality.
In the following various tools are presented for the different mod-
eling steps.
1. Tool for sequence alignment and modification: To get a first
good guess for an alignment the GPCRdb web-service [31] can
be used. For further refinement a tool should be used which
allows applying alignment position restraints and manually
modifying and moving residues. The molecular operating envi-
ronment (MOE) by Chemical Computing Group (https://
www.chemcomp.com/) can be used.
2. Generating homology models: A plethora of homology mod-
eling programs is available. One state-of-the-art standard pro-
gram is Modeller, [32] where homology models are built by
120 Christofer S. Tautermann
3 Methods
Fig. 1 Workflow to generate GPCR homology models useful for lead optimization
3.1 Generation The most common method to generate GPCR models is by homol-
and Preparation ogy modeling. In this procedure the target sequence is aligned to a
of Representative homologous protein, of which the structure is known. The main
Homology Models assumption of this approach is that the structure of a protein family
is more conserved than its sequence, which in turn means that
sequentially homologous proteins are of similar structure. The
so-called twilight zone, where this assumption starts to break
down is usually reported to be around 25–30% sequence identity
of target and template [39]. For GPCRs this threshold is even lower
because all so far reported crystal structures share a common fold;
however, the sequence conservation drops as low as 10% (see Note
1). What makes GPCRs so special is the presence of conserved
sequence motifs in the TM domains [22] and conserved packing
patterns between the helices. Based on these observations, the
sequence alignment and model assessment can be reliably done
for quite distantly related receptors still yielding good results.
122 Christofer S. Tautermann
3.1.1 Target Sequence It may sound trivial, but the retrieval of the correct target sequence
Selection/Modification is crucial. Usually, sequences of high quality are retrieved from
UniProt if the target sequence is annotated as “reviewed.” The
protein sequence is downloaded in fasta-format. In addition to
the sequence other important information, such as the location of
the TM-region, splice variants, and common SNPs are denoted in
UniProt as well. This information is crucial in order to modify the
downloaded sequence in a way that it fits the biological rationale
(splice variant, SNP) of the project. In addition to that it is advisable
to remove long intracellular regions, where no ligand binding is
expected, in order to allow better sequence alignments and there-
fore appropriate template selections. The generic steps of this
sequence modification and template selections are as follows:
1. Download the target sequence (ensure correct species) in fasta
format from UniProt.
2. Check on the UniProt entry page for SNPs, splice variants, and
long loops—as an example the long intracellular loop 3 (IL3)
from the human muscarinic acetylcholine receptor 3 (M3) is
shown in Fig. 2. In general, long loops (>30 amino acids)
should be removed because of two reasons: First, the template
selection can be misled by spurious alignments in these
regions (see Note 2), and second the modeling of such long
loops does not work reasonably anyway.
3.1.2 GPCR Template 1. Search for templates: The easiest method to select best tem-
Selection and Template/ plates is a web-service provided by GPCRdb [31]. Under
Target Alignment “Receptors” > “Template selection” the user pastes the Uni-
Prot identifier of the target protein and the most closely related
Fig. 2 Predicted topology for M3 in UniProt. The very long IL3 at positions 253–491 is easily to be spotted
GPCR Homology Model Generation for Lead Optimization 123
Fig. 3 T4L fused structure of the A2AR (pdb code: 3EML)—by sequence
alignment the T4L region can easily be identified (colored in red)
124 Christofer S. Tautermann
3.1.4 Water Placement Ligand binding to a protein causes the replacement of solvent
and Ligand Binding Site molecules by the ligand. This means that the ligand has to have a
Detection lower free energy of binding compared to the replaced water mole-
cules. It has been shown that water molecules in GPCR binding
sites have distinctly different free energies of binding, and ligands
usually displace patches of water which are in an unfavorable ener-
getic state, the sometimes called “unhappy” waters. Therefore, the
detection of patches of unhappy water will help to identify potential
locations of the ligand binding site. Different methods for water
placement and energy assessment have been reported, [17] herein
we refer to 3D–RISM, which is applied to a CCR3 model [42] and
the result is shown in Fig. 4. Alternatively to the energetic assess-
ment of water molecules in the binding site, plain methods for
126 Christofer S. Tautermann
Fig. 4 Homology model of CCR3 with docked lead compound [42]. Water placement by RISM as implemented
in MOE. Red spheres indicate energetically unfavorable water positions
3.2.1 Ligand Retrieval The goal of this paragraph is to derive a bioactive conformation of
and Generation of Bioactive the ligands. The best starting points are highly rigid and potent
Conformations ligands, where only few conformations can be adopted. To generate
the bioactive conformations for all chemical classes potent repre-
sentatives are overlaid with the first guess of the bioactive confor-
mation. Tools to do such overlays are included in all major
modeling packages. Importantly, the overlay must not induce strain
in any of the structures (see Note 5).
3.2.2 Generation Once the bioactive conformation is generated, more ligands span-
of Pharmacophores ning a large affinity range are overlaid to this geometry. Based on
this overlay, a common pharmacophore is generated, which also
takes the affinity values into account. The tool Forge (http://www.
cresset-group.com/forge/) builds QSAR models based on the
overlay of ligands employing pharmacophore field points. The
output shows exactly which parts around the common scaffold
should be decorated in order to increase/decrease affinity. This
information is also very useful later, for docking mode validation.
GPCR Homology Model Generation for Lead Optimization 127
3.3 Ligand Docking The prerequisite for ligand docking is that high-quality homology
and Final Model models are available and the bioactive conformation of the ligands
Selection has been generated. Now the overlaid ligands have to be docked
into the model regions with high-energy waters and the ligand-
derived pharmacophore has to match with the cavity residues.
3.3.1 Rigid Ligand Docking programs are designed to generate a large ensemble of
Docking ligand conformations and to place them into the binding site of a
protein followed by an energy scoring of the complex. In the
present case the bioactive conformation has already been generated,
and therefore rigid docking of the ligands into the top scoring
homology models has to be performed. Most docking programs,
such as Gold, allow the setting that the ligand has to be docked in
its input conformation. Ideally, several different docking poses for
the rigid ligand in each homology model are generated. If the
binding cleft is narrow or if sidechains obstruct the putative binding
site it is advisable to allow side-chain flexibility during docking. In
this case, the procedure allows the binding site residues to adopt
various accessible rotamers and the binding site adapts to the ligand
to a certain degree (see Note 7).
3.3.2 Docking Pose Two parameters are important for the assessment of the ligand pose
Assessment in a homology model. First, the ligand interactions must agree with
experimental findings. In the best case single-point mutagenesis
results are available and certain interactions are found to be crucial.
All poses that do not show these interactions can be deleted. And
second, the pharmacophore that has been derived by the overlay of
the ligands has to be compatible with the docking pose. If there are
only few pose/model combinations left, this check can be done
manually by overlaying the superimposed bunch of ligands on the
docking pose. Clashes of potent ligands with the receptor are a clear
sign for a problem of the pose/model combination. This step needs
a thorough knowledge of the SAR of a compound class, because
only if the existing SAR can be satisfyingly explained, the model and
the pose are suitable to make predictions for ligand modifications.
3.3.3 Postprocessing The best way to check the reliability of a docking pose is to perform
and Stability Assessment molecular dynamics (MD) simulations and observe if the ligand
changes its orientation or if it even moves out of the binding site.
MD simulations should be done for at least 100 ns in triplicate
(with different random seeds) but these calculations are computa-
tionally very expensive. Therefore, only the best poses should
undergo simulation as final means to assess the stability of different
docking poses. The setup of an MD simulation goes beyond the
scope of this chapter; however, few modeling suites such as Maestro
allow the setup through an intuitive graphics interface and MD
simulations can also be run by non-experts. For the analysis the
128 Christofer S. Tautermann
4 Notes
References
11. Levoin N, Calmels T, Poupardin-Olivier O, 20. Heifetz A, Morris GB, Biggin PC, Barker O,
Labeeuw O, Danvy D, Robert P, Berrebi- Fryatt T, Bentley J, Hallett D, Manikowski D,
Bertrand I, Ganellin CR, Schunack W, Pal S, Reifegerste R, Slack M, Law R (2012)
Stark H, Capet M (2008) Refined docking as Study of human orexin-1 and -2 G-protein-
a valuable tool for lead optimization: applica- coupled receptors with novel and published
tion to histamine H3 receptor antagonists. antagonists by modeling, molecular dynamics
Arch Pharm 341(10):610–623. https://doi. simulations, and site-directed mutagenesis.
org/10.1002/ardp.200800042 Biochemistry 51(15):3178–3197. https://
12. Berman HM, Westbrook J, Feng Z, doi.org/10.1021/bi300136h
Gilliland G, Bhat TN, Weissig H, Shindyalov 21. Heifetz A, Barker O, Morris GB, Law RJ,
IN, Bourne PE (2000) The protein data Bank. Slack M, Biggin PC (2013) Toward an under-
Nucleic Acids Res 28(1):235–242 standing of agonist binding to human Orexin-
13. Tautermann CS, Pautsch A (2011) The Impli- 1 and Orexin-2 receptors with G-protein-cou-
cation of the First Agonist Bound Activated pled receptor modeling and site-directed muta-
GPCR X-ray Structure on GPCR in Silico genesis. Biochemistry 52(46):8246–8260.
Modeling. ACS Med Chem Lett 2(6):414- https://doi.org/10.1021/bi401119m
418. https://doi.org/10.1021/ml100247s 22. Venkatakrishnan AJ, Deupi X, Lebon G, Tate
14. Dosa PI, Amin EA (2016) Tactical approaches CG, Schertler GF, Babu MM (2013) Molecu-
to interconverting GPCR agonists and antago- lar signatures of G-protein-coupled receptors.
nists. J Med Chem 59(3):810–840. https:// Nature 494(7436):185–194
doi.org/10.1021/acs.jmedchem.5b00982 23. Tautermann CS (2011) The use of G-protein
15. Köppen H (2009) Virtual screening - what coupled receptor models in lead optimization.
does it give us? Curr Opin Drug Discov Dev Future Med Chem 3(6):709–721. https://doi.
12(3):397–407 org/10.4155/fmc.11.24
16. Beuming T, Sherman W (2012) Current 24. Heifetz A, James T, Morao I, Bodkin MJ, Big-
assessment of docking into GPCR crystal struc- gin PC (2016) Guiding lead optimization with
tures and homology models: successes, chal- GPCR structure modeling and molecular
lenges, and guidelines. J Chem Inf Model 52 dynamics. Curr Opin Pharmacol 30:14–21.
(12):3263–3277. https://doi.org/10.1021/ https://doi.org/10.1016/j.coph.2016.06.
ci300411b 004
17. Bortolato A, Tehan BG, Bodnarchuk MS, 25. Kowalsman N, Niv MY (2014) GPCR & com-
Essex JW, Mason JS (2013) Water network pany: databases and servers for GPCRs and
perturbation in ligand binding: adenosine interacting partners. Adv Exp Med Biol
A2A antagonists as a case study. J Chem Inf 796:185–204. https://doi.org/10.1007/
Model 53(7):1700–1713. https://doi.org/ 978-94-7-7423-0_9
10.1021/ci4001458 26. UniProt Consortium (2014) UniProt: A hub
18. Storer RI, Brennan PE, Brown AD, Bungay PJ, for protein information. Nucleic Acids Res 43
Conlon KM, Corbett MS, DePianta RP, Fish (D1):D204–D212. https://doi.org/10.
PV, Heifetz A, Ho DKH, Jessiman AS, 1093/nar/gku989
McMurray G, de Oliveira CAF, Roberts LR, 27. Munk C, Isberg V, Mordalski S, Harpsøe K,
Root JA, Shanmugasundaram V, Shapiro MJ, Rataj K, Hauser AS, Kolb P, Bojarski AJ,
Skerten M, Westbrook D, Wheeler S, Whitlock Vriend G, Gloriam DE (2016) GPCRdb: the
GA, Wright J (2014) Multiparameter optimi- G protein-coupled receptor database – an
zation in CNS drug discovery: Design of introduction. Br J Pharmacol 173
Pyrimido[4,5-d]azepines as potent (14):2195–2207. https://doi.org/10.1111/
5-Hydroxytryptamine 2C (5-HT2C) receptor bph.13509
agonists with exquisite functional selectivity 28. Southan C, Sharman JL, Benson HE,
over 5-HT2A and 5-HT2B receptors. J Med Faccenda E, Pawson AJ, Alexander Stephen
Chem 57(12):5258–5269. https://doi.org/ PH, Buneman OP, Davenport AP, McGrath
10.1021/jm5003292 JC, Peters JA, Spedding M, Catterall WA,
19. Heifetz A, Storer RI, McMurray G, James T, Fabbro D, Davies JA (2015) The IUPHAR/
Morao I, Aldeghi M, Bodkin MJ, Biggin PC BPS guide to PHARMACOLOGY in 2016:
(2016) Application of an integrated GPCR towards curated quantitative interactions
SAR-modeling platform to explain the activa- between 1300 protein targets and 6000
tion selectivity of human 5-HT2C over ligands. Nucleic Acids Res 44(D1):
5-HT2B. ACS Chem Biol 11(5):1372–1382. D1054–D1068. https://doi.org/10.1093/
https://doi.org/10.1021/acschembio. nar/gkv1037
5b01045
GPCR Homology Model Generation for Lead Optimization 131
29. Bento AP, Gaulton A, Hersey A, Bellis LJ, 37. Morris GM, Huey R, Lindstrom W, Sanner
Chambers J, Davies M, Kr€ uger FA, Light Y, MF, Belew RK, Goodsell DS, Olson AJ
Mak L, McGlinchey S, Nowotka M, (2009) AutoDock4 and AutoDockTools4:
Papadatos G, Santos R, Overington JP (2014) automated docking with selective receptor flex-
The ChEMBL bioactivity database: an update. ibility. J Comput Chem 30(16):2785–2791.
Nucleic Acids Res 42(Database issue): https://doi.org/10.1002/jcc.21256
D1083–D1090. https://doi.org/10.1093/ 38. Adeniyi A, Ajibade P (2013) Comparing the
nar/gkt1031 suitability of autodock, gold and glide for the
30. Esguerra M, Siretskiy A, Bello X, Sallander J, docking and predicting the possible targets of
Gutiérrez-de-Terán H (2016) GPCR- Ru(II)-based complexes as anticancer agents.
ModSim: a comprehensive web based solution Molecules 18(4):3760
for modeling G-protein coupled receptors. 39. Chung SY, Subbiah S (1996) A structural
Nucleic Acids Res 44(Web Server issue): explanation for the twilight zone of protein
W455–W462. https://doi.org/10.1093/ sequence homology. Structure 4
nar/gkw403 (10):1123–1127. https://doi.org/10.1016/
31. Isberg V, de Graaf C, Bortolato A, Cherezov V, S0969-2126(96)00119-0
Katritch V, Marshall FH, Mordalski S, Pin J-P, 40. Kneissl B, Leonhardt B, Hildebrandt A, Tau-
Stevens RC, Vriend G, Gloriam DE (2015) termann CS (2009) Revisiting automated
Generic GPCR residue numbers – aligning G-protein coupled receptor modeling: the
topology maps while minding the gaps. Trends benefit of additional template structures for a
Pharmacol Sci 36(1):22–31. https://doi.org/ Neurokinin-1 receptor model. J Med Chem 52
10.1016/j.tips.2014.11.001 (10):3166–3173. https://doi.org/10.1021/
32. Eswar N, Webb B, Marti-Renom MA, Madhu- jm8014487
sudhan MS, Eramian D, Shen M-y, Pieper U, 41. Chun E, Thompson AA, Liu W, Roth CB,
Sali A (2001) Comparative protein structure Griffith MT, Katritch V, Kunken J, Xu F,
modeling using MODELLER. In: Current Cherezov V, Hanson MA, Stevens RC (2012)
protocols in protein science. John Wiley & Fusion partner Toolchest for the stabilization
Sons, Inc., Hoboken, NJ. https://doi.org/ and crystallization of G protein-coupled recep-
10.1002/0471140864.ps0209s50 tors. Structure(London, England:1993) 20
33. Breiten B, Lockett MR, Sherman W, Fujita S, (6):967–976. https://doi.org/10.1016/j.str.
Al-Sayah M, Lange H, Bowers CM, Heroux A, 2012.04.010
Krilov G, Whitesides GM (2013) Water net- 42. Tautermann CS, Seeliger D, Kriegl JM (2015)
works contribute to enthalpy/entropy com- What can we learn from molecular dynamics
pensation in protein–ligand binding. J Am simulations for GPCR drug design? Comput
Chem Soc 135(41):15579–15584. https:// Struct Biotechnol J 13:111–121. https://doi.
doi.org/10.1021/ja4075776 org/10.1016/j.csbj.2014.12.002
34. Truchon J-F, Pettitt BM, Labute P (2014) A 43. Weisel M, Proschak E, Schneider G (2007)
cavity corrected 3D-RISM functional for accu- PocketPicker: analysis of ligand binding-sites
rate solvation free energies. J Chem Theory with shape descriptors. Chem Cent J 1(1):7.
Comput 10(3):934–941. https://doi.org/10. https://doi.org/10.1186/1752-153x-1-7
1021/ct4009359 44. Worth CL, Kreuchwig A, Kleinau G, Krause G
35. Friesner RA, Banks JL, Murphy RB, Halgren (2011) GPCR-SSFE: a comprehensive data-
TA, Klicic JJ, Mainz DT, Repasky MP, Knoll base of G-protein-coupled receptor template
EH, Shelley M, Perry JK, Shaw DE, Francis P, predictions and homology models. BMC
Shenkin PS (2004) Glide: a new approach for Bioinform 12(1):185. https://doi.org/10.
rapid, accurate docking and scoring. 1. Method 1186/1471-2105-12-185
and assessment of docking accuracy. J Med 45. Congreve M, Dias JM, Marshall FH (2014)
Chem 47(7):1739–1749. https://doi.org/10. Chapter one - structure-based drug design for
1021/jm0306430 G protein-coupled receptors. In: Lawton G,
36. Jones G, Willett P, Glen RC, Leach AR, Taylor Witty DR (eds) Progress in medicinal chemis-
R (1997) Development and validation of a try, vol 53. Elsevier, Amsterdam, pp 1–63.
genetic algorithm for flexible docking1. J Mol https://doi.org/10.1016/B978-0-444-
Biol 267(3):727–748. https://doi.org/10. 63380-4.00001-9
1006/jmbi.1996.0897
Chapter 6
Abstract
Advances in the structural biology of G-protein Coupled Receptors have resulted in a significant step
forward in our understanding of how this important class of drug targets function at the molecular level.
However, it has also become apparent that they are very dynamic molecules, and moreover, that the
underlying dynamics is crucial in shaping the response to different ligands. Molecular dynamics simulations
can provide unique insight into the dynamic properties of GPCRs in a way that is complementary to many
experimental approaches. In this chapter, we describe progress in three distinct areas that are particularly
difficult to study with other techniques: atomic level investigation of the conformational changes that occur
when moving between the various states that GPCRs can exist in, the pathways that ligands adopt during
binding/unbinding events and finally, the influence of lipids on the conformational dynamics of GPCRs.
Key words Simulation, Ligand binding, Computational, Lipid, Metadynamics, Enhanced sampling
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_6, © Springer Science+Business Media LLC 2018
133
134 Naushad Velgy et al.
2 Methods
2.1 From Long-Time With the most recent advances in processing power, it has become
MD to Enhanced possible to carry out long-time scale (routinely over 100 ns) MD
Sampling simulations of GPCRs embedded in lipid bilayers. A variety of MD
software packages now offer efficient parallelisability providing
excellent performance [44]. The latest versions of popular MD
packages, such as GROMACS [45] and AMBER16 [46], are
equipped to efficiently distribute MD calculations to several CPU
cores, as well as enabling usage of GPU cores for calculations,
taking advantage of the performance boost obtained from integrat-
ing CUDA into the MD code [47]. Novel software packages, such
as Desmond [48], have previously been reported to achieve perfor-
mances of ~470 ns/day on commodity clusters (for a system of
~23,000 atoms on 1024 cores) [49]. In addition to parallelization,
performance can be boosted by utilizing specialized hardware as is
the case with Anton; a supercomputer designed for the purpose of
accelerating MD simulations [50] that can achieve performance of
up to 10 μs/day [49].
The advent of such performance boosts has led many research-
ers to simulate systems for longer time scales. Using Anton, Rose-
baum and colleagues reported the first long-time scale all-atom
MD simulation of the β2AR in a lipid bilayer. The researchers
used both experimental and computational methods to develop
an irreversible agonist for the β2AR, making full use of performance
boosting techniques to simulate ~30 μs of receptor/ligand activity.
Furthermore, Rosebaum and colleagues concluded that, in the
absence of either a G protein or a mimetic nanobody, the receptor
active state spontaneously destabilizes, transitioning to inactive
states [51].
Using a similar approach, and making full use of crystals struc-
tures of the β2AR in the active state, Dror and colleagues studied
the mechanisms by which GPCRs transition from inactive to active
states [52]. The researchers did so by simulating the spontaneous
deactivation of active structures and analyzing motion of key fea-
tures throughout the trajectories. In short, 92 simulations were
performed, totalling approximately 656 μs, of which 76 were based
on the coordinates from the active β2AR in complex with the G
protein mimetic nanobody Nb80 (PDB: 3P0G [53]), five were
based on the coordinates from the active β2AR in the complex
with a G protein (PDB: 3SN6 [28]), and 2 were based on the
coordinates from the inactive structure (PDB: 2RH1 [54]). In
this study, Dror and colleagues highlighted a key structural region
that connects the canonical binding site to the G-protein binding
site, termed the “connector region” (Fig. 2). Consisting of 2 hydro-
phobic residues (Ile3.40 and Phe6.44 that are part of the key struc-
tural PIF motif [55]), this region is one of several key motifs (see
138 Naushad Velgy et al.
Fig. 2 Examining the conformational state of β2AR during simulation (adapted from [52]). (a) Overview of the
allosteric network between the canonical binding site (orange), the connector region (green), and the G protein
binding site (purple). The receptor is represented by silver cartoon; ligand atoms are shown as spheres; key
residues in each region are shown as sticks (hydrogens excluded). (b) Structure of the aforementioned regions
in active and inactive conformations. (c) Metrics used during simulation to determine activity state of receptor
binding site to include S5.43 and F5.47. Using these metrics, the
study showed two interesting results; the receptor exhibits different
behavior based on the activity of the agonist, and mutual informa-
tion networks differ based on the ligand present [29].
In the absence of any ligand and in the presence of an inverse
agonist, the receptor remained in an inactive conformation
throughout 150 μs of aggregated simulation time. However, in
the presence of a full agonist, the receptor is capable of spontane-
ously transitioning to an active-like state (if only for a short time;
approximately 2.5 μs). Additionally, based on mutual information
networks, the researchers noted that agonists strengthen connec-
tions between the canonical binding site and the G protein binding
site, whereas inverse agonists discourage these connections, limit-
ing them to the intracellular G protein binding site [29].
Using a similar strategy, Schneider and colleagues performed
long-time scale MD simulations on the active state of the μ opioid
receptor (PDB entry 5C1M [27]) to study the differences in
mutual information networks generated in the presence of a full
agonist and in the presence of a biased agonist. With the aid of
performance boosts from Anton, the researchers performed a total
of 50 μs of simulation time, the bulk of which was dedicated to the
binding pathway of the biased agonist (discussed in more detail
below).
Using mutual information networks, Schneider and colleagues
[58] showed that the full agonist morphine produces a much larger
mutual information network compared to that produced by the
biased agonist TRV-130, particularly in key areas of interest, such as
the sodium allosteric site. Their results suggest that biased ligands
allosterically communicate with a smaller set of residues, making it
possible to design experiments to study the nature of the interac-
tions, as well as new drugs with increased therapeutic use that
exploit these contacts.
Long-time scale studies, such as the ones discussed above, have
profound implications for the design of better, more efficient
drugs. Unfortunately, they come at huge computational resource
cost. However, it is worth noting that there are alternatives to
running long-time MD, while enabling the exploration of the
same free energy surface. One of the main drawbacks of conven-
tional (or classical) MD is that simulations can only reliably explore
low-energy events, such as breaking or forming salt bridges, or
perhaps the equilibration of a ligand pose in a binding pocket.
High-energy events, such as a GPCR transitioning from an inactive
to an active conformation, are rarely sampled using conventional
MD techniques [59], unless one has the dedicated resources for
long simulations as described above. These high-energy events also
occur at time scales of milliseconds or more, making conventional
MD unsuitable as a conformational exploration tool [60].
140 Naushad Velgy et al.
2.2 Ligand Binding MD simulations can be used to study several aspects of ligand-
Pathways protein interactions. Ligand binding modes and the influence of
ligands on protein dynamics are some of the properties that can
easily be studied using MD simulations. One aspect of protein-
ligand interactions that is not very easily probed by experimental
techniques is what are the precise pathways a ligand takes to gain
access to its fully bound state? The growing interest in kinetic
properties of drugs means that this question is becoming increas-
ingly important, especially as the kinetics of drug binding are
intimately connected to therapeutic effects [91]. For example, it
has been suggested that slow unbinding may enhance therapeutic
effects [92–96].
Unfortunately, little is known about how the ligand moves
from bulk solvent into the canonical binding site (see Note 5).
One of the earliest studies used all-atom MD simulations of the
β1- and β2-adrenoceptor (β1AR and β2AR, based on PDB entries
2VT4 [97] and 2RH1 [54], respectively), each in complex with a
variety of ligands (Fig. 3a). The authors showed that there is a
dominant binding pathway for ligands in the adrenoceptors char-
acterized by 2 energetic barriers that hinder ligand binding from
the bulk solution. These barriers reflect a dewetting of the ligand as
it enters the vestibule region [91] (Fig. 3b).
Fig. 3 Identification of the critical “vestibule region” within the β2AR. (a) Ligands used by Dror and colleagues
[91]. (b) Ligand entry pathway from bulk solution. Receptor shown as tan ribbon and ligands shown as pins,
where the aromatic pharmacophore is represented by the round end and the positively charged nitrogen atom
is represented by the pin point (as per (a)). Ligands are colored based on the RMSD from the crystal structure
(red: in bulk solvent; green: in vestibule region; blue: in canonical binding site). Reproduced from [91] with
permission
GPCRs: What Can We Learn from Molecular Dynamics Simulations? 143
Fig. 4 Schematic representation of SuMD. Notice the decrease in time taken compared to previously reported
β2AR ligand entry times. The ligand, ZM241385, is shown as spheres, and A2AAR is shown as tan ribbons.
Reproduced from [98] with permission
Fig. 5 Possible allosteric mechanisms of LUF6000. (a) Conformation changes in EL2 induced by LUF6000
(orange sticks) resulting in more favorable interactions between adenosine (tan sticks) and A3AR (silver
ribbons). (b) LUF6000 working as an “Orthosteric pocket cap,” shielding adenosine from bulk solvent.
Reproduced with permission from Deganutti et al. [102]
conformational selection
A I
6 7
not evaluated
A or I∗
I
I* I induced fit
Fig. 6 Schematic of the proposed “foot-in-door” mechanism to explain receptor modulation by phospholipids.
Only helices 6 and 7 are shown for simplicity. The top pathway depicts the classical view of GPCR activity; an
agonist (represented by a star) binds to the receptor in the canonical active site, resulting in TM6 moving from
an inactive (I) to an active (A) conformation, then binding to the G protein (or another partner protein, such as a
nanobody, shown as a dark green blob). The bottom pathway depicts the receptor undergoing conformations
that are hard to capture via crystallography (I*), to then be partnered with an intracellular signaller and
undergoing further conformational changes to reach the active state (A). The work by Neale and colleagues is
depicted and summarized by the central pathway, upon ligand binding, where the structure stabilized by a
phospholipid (red circle with blue tails) acts as a precursor to intracellular binding. It is worth noting that this
effect might also be possible without the presence of an extracellular ligand. Reproduced from [108] with
permission
C1 GLN
C3
LYS
Fig. 7 Schematic of the MARTINI mapping protocol. (a) Examples of lipid (in this case, DPPC), water, and
protein secondary structure (in this case, an alpha helix) mapping. In all cases, the atomistic representation is
shown as a ball-and-stick model, while the coarse-grained representation is shown as van der Waals with
underlying bonds as black sticks. In the helical fragment, the red spheres represent the backbone. Bead types
are shown in transparent gray next to the corresponding bead. (b) Rhodopsin model showing the full atomistic
structure as ribbons (left), and the corresponding CG representation. The bead color represents the property of
the atoms incorporated into it. Adapted from [111] with permission
Fig. 8 Oligomerization of S1P1 receptors (PDB: 3V2W [120]) within a complex lipid bilayer over 10 μs of CG
simulation. The lipid composition mimics that of a mammalian plasma membrane. The receptors are shown in
pink (144 in total). Lipid color code: blue—POPC; purple—POPE; dark gray—Sphingomyelin; light blue—
monosialodihexosylganglioside (GM3); green—cholesterol; light grey—phosphatidylserine (PS); and
orange—phosphatidylinositol-4,5-bisphosphate (PIP2) (Based on [119] with permission)
3 Notes
Acknowledgments
References
1. Adcock SA, Mccammon JA (2006) Molecular 7. Ciancetta A, Sabbadin D, Federico S, Spal-
dynamics: survey of methods for simulating luto G, Moro S (2015) Advances in compu-
the activity of proteins. Chem Rev tational techniques to study GPCR–ligand
106:1589–1615 recognition. Trends Pharm Sci 36
2. Karplus M, McCammon JA (2002) Molecular (12):878–890. https://doi.org/10.1016/j.
dynamics simulations of biomolecules. Nat tips.2015.08.006
Struct Biol 9:646–652 8. Johnston JM, Filizola M (2011) Showcasing
3. McRobb FM, Negri A, Beuming T, Sherman modern molecular dynamics simulations of
W (2016) Molecular dynamics techniques for membrane proteins through G protein-cou-
modeling G protein-coupled receptors. Curr pled receptors. Curr Opin Struc Biol
Opin Pharm 30:69–75. https://doi.org/10. 21:552–558. https://doi.org/10.1016/j.
1016/j.coph.2016.07.001 sbi.2011.06.008
4. Filmore D (2004) It’s a GPCR world. J Mod- 9. Fredriksson R, Lagerström MC, Lundin L-G,
ern D Discov 7:24–27 Schiöth HB (2003) The G-protein-coupled
5. Salon JA, Lodowski DT, Palczewski K (2011) receptors in the human genome form five
The significance of G protein-coupled recep- main families. Phylogenetic analysis, paralo-
tor crystallography for drug discovery. Pharm gon groups, and fingerprints. Mol Endocrinol
Rev 63:901–937. https://doi.org/10.1124/ 63:1256–1272. https://doi.org/10.1124/
pr.110.003350.901 mol.63.6.1256
6. Martins SMA, Trabuco JRG, Monteiro GA, 10. Hill SJ (2006) G-protein-coupled receptors:
Prazeres DM (2012) GPCR screening and past, present and future. Brit J Pharm 147:
drug discovery: challenges and latest trends. S27–S37. https://doi.org/10.1038/sj.bjp.
Eur Pharm Rev 17 0706455
GPCRs: What Can We Learn from Molecular Dynamics Simulations? 153
11. Xiang J, Chun E, Liu C, Jing L, Al-Sahouri Z, 22. Huang X, Shen J, Cui M, Shen L, Luo X, Ling
Zhu L, Liu W (2016) Successful strategies to K, Pei G, Jiang H, Chen K (2003) Molecular
determine high-resolution structures of dynamics simulations on SDF-1α: binding
GPCRs. Trends Pharm Sci (in press). https:// with CXCR4 receptor. Biophys J
doi.org/10.1016/j.tips.2016.09.009. 84:171–184. https://doi.org/10.1016/
12. Strahs D, Weinstein H (1997) Comparative S0006-3495(03)74840-1
modeling and molecular dynamics studies of 23. Zhang Y, Sham YY, Rajamani R, Gao J, Por-
the delta, kappa and mu opioid receptors. toguese PS (2005) Homology modeling and
Protein Eng 10(9):1019–1038 molecular dynamics simulations of the mu
13. Scheer A, Fanelli F, Costa T, Benedetti PGD, opioid receptor in a membrane – aqueous
Cotecchia S (1996) Constitutively active system. Chem Bio Chem 6:853–859.
mutants of the a1B-adrenergic receptor: role https://doi.org/10.1002/cbic.200400207
of highly conserved polar amino acids in 24. Iadanza M, Holtje M, Ronsisvalle G, Holtje
receptor activation. EMBO J 15:3566–3578 H-D (2002) k-Opioid receptor model in a
14. Czaplewski C, Kazmierkiewicz R, Ciarkowski phospholipid bilayer: molecular dynamics
J (1998) Molecular modeling of the human simulation. J Med Chem 45:4838–4846
vasopressin V2 receptor/agonist complex. J 25. Fenalti G, Giguere PM, Katritch V, Huang X-
Comput Aided Mol Des 12:275–287 P, Thompson AA, Cherezov V, Roth BL, Ste-
15. Sansom MSP, Weinstein H (2000) Hinges, vens RC (2014) Molecular control of [dgr]-
swivels and switches: the role of prolines in opioid receptor signalling. Nature 506
signalling via transmembrane alpha helices. (7487):191–196. https://doi.org/10.1038/
TIPS 21:445–451 nature12944
16. Palczewski K, Kumasaka T, Hori T, Behnke 26. Kang Y, Zhou XE, Gao X, He Y, Liu W,
CA, Motoshima H, Fox BA, Le Trong I, Ishchenko A, Barty A, White TA, Yefanov O,
Teller DC, Okada T, Stenkamp RE, Yama- Han GW, Xu Q, Waal PWD, Ke J, Tan MHE,
moto M, Miyano M (2000) Crystal structure Zhang C, Moeller A, West GM, Pascal BD,
of rhodopsin: a G protein-coupled receptor. Eps NV, Caro LN, Vishnivetskiy SA, Lee RJ
Science 289:739–745 (2015) Crystal structure of rhodopsin bound
17. Rohrig UF, Guidoni L, Rothlisberger U to arrestin by femtosecond X-ray laser. Nature
(2002) Early steps of the intramolecular signal 523:561–567. https://doi.org/10.1038/
transduction in rhodopsin explored by molec- nature14656
ular dynamics simulations. Biochemistry 27. Huang W, Manglik A, Venkatakrishnan AJ,
41:10799–10809 Laeremans T, Feinberg EN, Sanborn AL,
18. Crozier PS, Stevens MJ, Forrest LR, Woolf Kato HE, Livingston KE, Thorsen TS, Kling
TB (2003) Molecular dynamics simulation of RC, Granier S, Gmeiner P, Husbands SM,
dark-adapted rhodopsin in an explicit mem- Traynor JR, Weis WI, Steyaert J, Dror RO,
brane bilayer: coupling between local retinal Kobilka BK (2015) Structural insights into μ-
and larger scale conformational change. J Mol opioid receptor activation. Nature 524
Biol 333:493–514. https://doi.org/10. (7565):315–321. https://doi.org/10.1038/
1016/j.jmb.2003.08.045 nature14886
19. Huber T, Botelho AV, Beyer K, Brown MF 28. Rasmussen SGF, DeVree BT, Zou Y, Kruse
(2004) Membrane model for the G-protein- AC, Chung KY, Kobilka TS, Thian FS, Chae
coupled receptor rhodopsin : hydrophobic PS, Pardon E, Calinski D, Mathiesen JM,
interface and dynamical structure. Biophys J Shah STA, Lyons JA, Caffrey M, Gellman
86:2078–2100. https://doi.org/10.1016/ SH, Steyaert J, Skiniotis G, Weis WI, Suna-
S0006-3495(04)74268-X hara RK, Kobilka BK (2011) Crystal structure
of the β2 adrenergic receptor-Gs protein com-
20. Pitman MC, Grossfield A, Suits F, Feller SE plex. Nature 477(7366):549–555
(2005) Role of cholesterol and polyunsatu-
rated chains in lipid - protein interactions: 29. Kohlhoff KJ, Shukla D, Lawrenz M, Bowman
molecular dynamics simulation of rhodopsin GR, Konerding DE, Belov D, Altman RB,
in a realistic membrane environment. J Am Pande VS (2014) Cloud-based simulations
Chem Soc 127:4576–4577 on Google Exacycle reveal ligand modulation
of GPCR activation pathways. Nat Chem 6
21. Seeber M, Benedetti PGD, Fanelli F (2003) (1):15–21. https://doi.org/10.1038/
Molecular dynamics simulations of the ligand- nchem.1821
induced chemical information transfer in the
5-HT1A receptor. J Chem Inf Comp Sci 30. Prioleau C, Visiers I, Ebersole BJ, Weinstein
43:1520–1531 H, Sealfon SC (2002) Conserved helix 7 tyro-
sine acts as a multistate conformational switch
154 Naushad Velgy et al.
in the 5HT2C receptor. Identification of a 41. Chen YC (2015) Beware of docking! Trends
novel "locked-on" phenotype and double Pharmacol Sci 36(2):78–95. https://doi.org/
revertant mutations. J Biol Chem 10.1016/j.tips.2014.12.001
277:36577–36584. https://doi.org/10. 42. Amaro RE et al (2008) An improved relaxed
1074/jbc.M206223200 complex scheme for receptor flexibility in
31. Sealfon SC, Chi L, Ebersole BJ, Rodic V, computer-aided drug design. J Comput
Zhang D, Ballesteros J, Weinstein H (1995) Aided Mol Des 22(9):693–705. https://doi.
Related contribution of specific heix 2 and 7 org/10.1007/s10822-007-9159-2
residues to conformational activation of the 43. Gater DL, Saurel O, Iordanov I, Liu W, Cher-
serotonin 5-HT2A receptor. J Bio Chem ezov V, Milon A (2014) Two classes of cho-
270:16683–16688. https://doi.org/10. lesterol binding sites for the β2AR revealed by
1074/jbc.270.28.16683 thermostability and NMR. Biophys J
32. Tiburu EK, Bowman AL, Struppe JO, Janero 107:2305–2312. https://doi.org/10.1016/
DR, Avraham HK, Makriyannis A (2009) j.bpj.2014.10.011
Solid-state NMR and molecular dynamics 44. Harvey MJ, De Fabritiis G (2012) High-
characterization of cannabinoid receptor-1 throughput molecular dynamics: the powerful
(CB1) helix 7 conformational plasticity in new tool for drug discovery. Drug Discov
model membranes. Biochim Biophys Acta Today 17:1059–1062. https://doi.org/10.
1788:1159–1167. https://doi.org/10. 1016/j.drudis.2012.03.017
1016/j.bbamem.2009.02.002 45. Abraham MJ, Murtola T, Schulz R, Páll S,
33. Venkatakrishnan AJ, Deupi X, Lebon G, Tate Smith JC, Hess B, Lindahl E (2015) GRO-
CG, Schertler GF, Babu MM (2013) Molec- MACS: high performance molecular simula-
ular signatures of G-protein-coupled recep- tions through multi-level parallelism from
tors. Nature 494(7436):185–194 laptops to supercomputers. SoftwareX
34. Negri A et al (2013) Discovery of a novel 1–2:19–25. https://doi.org/10.1016/j.
selective kappa-opioid receptor agonist using softx.2015.06.001
crystal structure-based virtual screening. J 46. Case DA, Betz RM, Cerutti DS, Cheatham
Chem Inf Model 53(3):521–526. https:// TE III, Darden TA, Duke RE, Giese TJ,
doi.org/10.1021/ci400019t Gohlke H, Goetz AW, Homeyer N, Izadi S,
35. Weiss DR et al (2013) Conformation guides Janowski P, Kaus J, Kovalenko A, Lee TS,
molecular efficacy in docking screens of acti- LeGrand S, Li P, Lin C, Luchko T, Luo R,
vated β-2 adrenergic G protein coupled recep- Madej BD, Mermelstein D, Merz KM, Mon-
tor. ACS Chem Biol 8(5):1018–1026. ard G, Nguyen H, Nguyen HT, Omelyan I,
https://doi.org/10.1021/cb400103f Onufriev A, Roe DR, Roitberg A, Sagui C,
36. Manglik A et al (2016) Structure-based dis- Simmerling CL, Botello-Smith WM, Swails J,
covery of opioid analgesics with reduced side Walker RC, Wang J, Wolf RM, Wu X, Xiao L,
effects. Nature 537(7619):185–190. https:// Kollman PA (2016) AMBER 2016. Univer-
doi.org/10.1038/nature19112 sity of California, San Francisco
37. Lebon G et al (2012) Agonist-bound struc- 47. Liu W, Schmidt B, Voss G, M€ uller-Wittig W
tures of G protein-coupled receptors. Curr (2008) Accelerating molecular dynamics
Opin Struct Biol 22(4):482–490. https:// simulations using graphics processing units
doi.org/10.1016/j.sbi.2012.03.007 with CUDA. Compu Phys Comm
38. Verdonk ML et al (2003) Improved protein- 179:634–641. https://doi.org/10.1016/j.
ligand docking using GOLD. Proteins 52 cpc.2008.05.008
(4):609–623. https://doi.org/10.1002/ 48. Bowers KJ, Chow E, Xu H, Dror RO, East-
prot.10465 wood MP, Gregersen BA, Klepeis JL, Koloss-
39. Trott O, Olson AJ (2010) AutoDock Vina: vary I, Moraes MA, Sacerdoti FD, Salmon JK,
improving the speed and accuracy of docking Shan Y, Shaw DE (2006) Scalable algorithms
with a new scoring function, efficient optimi- for molecular dynamics simulations on com-
zation, and multithreading. J Comput Chem modity clusters. In: Proceedings of the 2006
31(2):455–461. https://doi.org/10.1002/ ACMI/IEEE conference on supercomput-
jcc.21334. ing. ACM Press, New york
40. Friesner RA et al (2006) Extra precision glide: 49. Klepeis JL, Lindorff-Larsen K, Dror RO,
docking and scoring incorporating a model of Shaw DE (2009) Long-timescale molecular
hydrophobic enclosure for proteinligand dynamics simulations of protein structure
complexes. J Med Chem 49 and function. Curr Opin Struct Biol 19
(21):6177–6196. https://doi.org/10.1021/ (2):120–127
jm051256o
GPCRs: What Can We Learn from Molecular Dynamics Simulations? 155
50. Shaw DE et al (2008) Anton, a special-pur- 59. Rodrı́guez-Espigares I, Kaczor AA, Selent J
pose machine for molecular dynamics simula- (2016) In silico exploration of the conforma-
tion. Comm ACM 51(7):91–97. https://doi. tional universe of GPCRs. Mol Inform
org/10.1145/1364782.1364802 35:227–237. https://doi.org/10.1002/
51. Rosenbaum DM, Zhang C, Lyons JA, Holl R, minf.201600012
Aragao D, Arlow DH, Rasmussen SGF, Choi 60. Pierce LCT, Salomon-Ferrer R, De Oliveira C
H-j, Devree BT, Sunahara RK, Chae PS, Gell- AF, JA MC, Walker RC (2012) Routine access
man SH, Dror RO, Shaw DE, Weis WI, Caf- to millisecond time scale events with acceler-
frey M, Gmeiner P, Kobilka BK (2011) ated molecular dynamics. J Chem Theory
Structure and function of an irreversible ago- Comput 8:2997–3002
nist-β2 adrenoceptor complex. Nature 61. Bussi G, Laio A, Parrinello M (2006) Equilib-
469:236–240. https://doi.org/10.1038/ rium free energies from nonequilibrium meta-
nature09665 dynamics. Phys Rev Lett 96(9):090601
52. Dror RO, Arlow DH, Maragakis P, Mildorf 62. Leone V, Marinelli F, Carloni P, Parrinello M
TJ, Pan AC, Xu H, Borhani DW, Shaw DE (2010) Targeting biomolecular flexibility with
(2011) Activation mechanism of the β2- metadynamics. Curr Opin Struc Biol
adrenergic receptor. Proc Natl Acad Sci U S 20:148–154. https://doi.org/10.1016/j.
A 108(46):18684–18689 sbi.2010.01.011
53. Rasmussen SGF, Choi H-J, Fung JJ, Pardon 63. Schlitter J, Engels M, Kr€ uger P, Jacoby E,
E, Casarosa P, Chae PS, Devree BT, Rosen- Wollmer A (1993) Targeted molecular
baum DM, Thian FS, Kobilka TS, Schnapp A, dynamics simulation of conformational
Konetzki I, Sunahara RK, Gellman SH, change-application to the T $ R transition
Pautsch A, Steyaert J, Weis WI, Kobilka BK in insulin. Mol Sim 10:291–308. https://
(2011) Structure of a nanobody-stabilized doi.org/10.1080/08927029308022170
active state of the β(2) adrenoceptor. Nature 64. Schlitter J, Engels M, Krueger P (1994) Tar-
469:175–180. https://doi.org/10.1038/ geted molecular dynamics: a new approach for
nature09648 searching pathways of conformational transi-
54. Cherezov V, Rosenbaum DM, Hanson MA, tions. J Mol Graph 1994:84–89
Rasmussen SGF, Thian FS, Kobilka TS, Choi 65. Huang H, Ozkirimli E, Post CB (2009)
H-J, Kuhn P, Weis WI, Kobilka BK, Stevens Comparison of three perturbation molecular
RC (2007) High-resolution crystal structure dynamics methods for modeling conforma-
of an engineered human β2-adrenergic G pro- tional transitions. J Chem Theor Comput
tein–coupled receptor. Science 318 5:1304–1314. https://doi.org/10.1021/
(5854):1258–1265 ct9000153
55. Marti-Solano M, Sanz F, Pastor M, Selent J 66. Grubmuller H, Heymann B, Tavan P (1996)
(2014) A dynamic view of molecular switch Ligand binding: molecular mechanics calcula-
behavior at serotonin receptors: implications tion of the streptavidin-biotin rupture force.
for functional selectivity. PLoS One 9: Science 271:997–999
e109312. https://doi.org/10.1371/journal.
pone.0109312 67. Marchi M, Ballone P (1999) Adiabatic bias
molecular dynamics : a method to navigate
56. Hellerstein JL, Kohlhoff KJ, Konerding DE the conformational space of complex molecu-
(2012) Science in the cloud: accelerating dis- lar systems. J Chem Phys 110:3697–3702.
covery in the 21st century. IEEE Internet https://doi.org/10.1063/1.478259
Comput 16(4):64–68. https://doi.org/10.
1109/MIC.2012.87 68. Paci E, Karplus M (1999) Forced unfolding of
fibronectin type 3 modules: an analysis by
57. Nygaard R, Frimurer TM, Holst B, Rosen- biased molecular dynamics simulations. J
kilde MM, Schwartz TW (2009) Ligand bind- Mol Bio 288:441–459
ing and micro-switches in 7TM receptor
structures. Trends Pharm Sci 30:249–259. 69. Hamelberg D, De Oliveira CAF, McCammon
https://doi.org/10.1016/j.tips.2009.02. JA (2007) Sampling of slow diffusive confor-
006 mational transitions with accelerated molecu-
lar dynamics. J Chem Phys 127:155102.
58. Schneider S, Provasi D, Filizola M (2016) https://doi.org/10.1063/1.2789432
How Oliceridine (TRV-130) binds and stabi-
lizes a μ-opioid receptor conformational state 70. Markwick PRL, McCammon JA (2011)
that selectively triggers G protein-signaling Studying functional dynamics in bio-mole-
pathways. Biochemistry 55:6456–6466. cules using accelerated molecular dynamics.
https://doi.org/10.1021/acs.biochem. Phys Chem Chem Phys 13:20053–20065.
6b00948 https://doi.org/10.1039/c1cp22100k
156 Naushad Velgy et al.
71. Miao Y, Nichols SE, Gasper PM, Metzger VT, Chem Theor Comput 12:6049–6061.
McCammon JA (2013) Activation and https://doi.org/10.1021/acs.jctc.6b00475
dynamic network of the M2 muscarinic recep- 81. Liu W, Chun E, Thompson AA, Chubukov P,
tor. Proc Natl Acad Sci U S A 110 Xu F, Katritch V, Han GW, Roth CB, Heit-
(27):10982–10987. https://doi.org/10. man LH, Ijzerman AP, Cherezov V, Stevens
1073/pnas.1309755110 RC (2012) Structural basis for allosteric regu-
72. Bonomi M, Branduardi D, Bussi G, Camilloni lation of GPCRs by sodium ions. Science 337
C, Provasi D, Raiteri P, Donadio D, Marinelli (6091):232–236
F, Pietrucci F, Broglia RA, Parrinello M 82. Angel TE, Chance MR, Palczewski K (2009)
(2009) PLUMED: a portable plugin for Conserved waters mediate structural and
free-energy calculations with molecular functional activation of family a (rhodopsin-
dynamics. Comput Phys Comm 180 like) G protein-coupled receptors. Proc Natl
(10):1961–1972. https://doi.org/10.1016/ Acad Sci U S A 106:8555–8560
j.cpc.2009.05.011 83. Kaszuba K, Róg T, Bryl K, Vattulainen I,
73. Provasi D, Artacho MC, Negri A, Mobarec Karttunen M (2010) Molecular dynamics
JC, Filizola M (2011) Ligand-induced modu- simulations reveal fundamental role of water
lation of the free-energy landscape of G pro- as factor determining affinity of binding of β-
tein-coupled receptors explored by adaptive blocker nebivolol to β-adrenergic receptor. J
biasing techniques. PLoS Comput Biol 7: Phys Chem B 114:8374–8386. https://doi.
e1002193. https://doi.org/10.1371/jour org/10.1021/jp909971f
nal.pcbi.1002193 84. Ross GA, Morris GM, Biggin PC (2012)
74. Bonomi M, Barducci A, Parrinello M (2009) Rapid and accurate prediction and scoring of
Reconstructing the equilibrium boltzmann water molecules in protein binding sites.
distribution from well-tempered metady- PLoS One 7(3):e32036
namics. J Comput Chem 30:1615–1621. 85. Ross GA, Bodnarchuk MS, Essex JW (2015)
https://doi.org/10.1002/jcc Water sites, networks, and free energies with
75. Provasi D, Filizola M (2010) Putative active grand canonical Monte Carlo. J Am Chem
states of a prototypic g-protein-coupled Soc 137(47):14930–14943. https://doi.
receptor from biased molecular dynamics. org/10.1021/jacs.5b07940
Biophys J 98:2347–2355. https://doi.org/ 86. Gerogiokas G, Southey MWY, Mazanetz MP,
10.1016/j.bpj.2010.01.047 Hefeitz A, Bodkin M, Law RJ, Michel J
76. Barducci A, Bussi G, Parrinello M (2008) (2015) Evaluation of water displacement
Well-tempered metadynamics: a smoothly energetics in protein binding sites with grid
converging and tunable free-energy method. cell theory. Phys Chem Chem Phys
Phys Rev Lett 100(2):020603 17:8416–8426. https://doi.org/10.1039/
77. Ballesteros JA, Jensen AD, Liapakis G, Ras- C4CP05572A
mussen SGF, Shi L, Gether U, Javitch JA 87. Gerogiokas G, Southey MWY, Mazanetz MP,
(2001) Activation of the β2 -adrenergic recep- Heifetz A, Bodkin M, Law RJ, Henchman
tor involves disruption of an ionic lock RH, Michel J (2016) Assessment of hydration
between the cytoplasmic ends of transmem- thermodynamics at protein interfaces with
brane segments 3 and 6. J Biol Chem grid cell theory. J Phys Chem B
276:29171–29177. https://doi.org/10. 120:10442–10452. https://doi.org/10.
1074/jbc.M103747200 1021/acs.jpcb.6b07993
78. Shi L, Liapakis G, Xu R, Guarnieri F, Balles- 88. Michel J, Tirado-Rives J, Jorgensen WL
teros JA, Javitch JA (2002) β2 adrenergic (2009) Prediction of the water content in
receptor activation: modulation of the proline protein binding sites. J Phys Chem
kink in transmembrane 6 by a rotamer toggle 113:13337–13346. https://doi.org/10.
switch. J Biol Chem 277:40989–40996. 1021/jp9047456
https://doi.org/10.1074/jbc.M206801200 89. Sciabola S, Stanton RV, Mills JE, Flocco MM,
79. Li J, Jonsson AL, Beuming T, Shelley JC, Baroni M, Cruciani G, Perruccio F, Mason JS
Voth GA (2013) Ligand-dependent activa- (2010) High-throughput virtual screening of
tion and deactivation of the human adenosine proteins using GRID molecular interaction
A2A receptor. J Am Chem Soc fields. J Chem Inf Model 50:155–169
135:8749–8759 90. Uehara S, Tanaka S (2016) AutoDock-GIST:
80. Zia SR, Gaspari R, Decherchi S, Rocchia W incorporating thermodynamics of active-site
(2016) Probing hydration patterns in class-a water into scoring function for accurate
GPCRs via biased MD: the A2A receptor. J protein-ligand docking. Molecules 21:
GPCRs: What Can We Learn from Molecular Dynamics Simulations? 157
Abstract
We present a number of techniques to analyze protein–ligand interactions in the context of medicinal
chemistry: crystal Contract Preferences, Electrostatic Maps and pharmacophore screening using H€ uckel
Theory. Contact Preferences is a statistical technique to predict hydrophobic and hydrophilic geometry in
receptor active sites. Electrostatic Maps use the Poisson-Boltzmann Equation to model solvation effects and
are particularly useful for predicting hydrophobic regions. Pharmacophore annotation with H€ uckel Theory
provides finer detail of hydrogen bonding interactions, including CH..O interactions. Applications to
AblK:Gleevec and CDK2 virtual screening are presented.
Key words Molecular interactions, Contact statistics, Electrostatic maps, Pharmacophore annotation
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_7, © Springer Science+Business Media LLC 2018
159
160 Paul Labute
2 Contact Preferences
The x-ray crystal structures in the Protein Databank and the Cam-
bridge Structural Database [3] are a good source of non-bonded
contact information from which statistics can be derived. Meth-
odologies such as X-Site [4] and SuperStar [5] are knowledge-
based techniques that use statistical distributions derived from
crystallographic data to describe or predict non-bonded contacts
between ligands and proteins. The main idea is to describe (statisti-
cally) the geometry of non-bonded interactions and use the statis-
tical descriptions to predict the likelihood of interactions in a
specific protein active site. Knowledge-based methods are appeal-
ing because they rely on experimental data and not molecular
mechanics, precise hydrogen coordinates, or other approximations;
however, they do rely on sufficient experimental data and appropri-
ate a priori classification of interacting atom types (e.g., sp2 donor
vs. sp3 acceptor).
We will describe one example of a statistical method, Contact
Preferences [6], for determining geometric preferences for polar and
hydrophobic atoms given the 3D coordinates of a protein receptor.
Fundamentally, Contact Preference maps are contours of probabil-
ity densities indicating a percentage likelihood of a non-bonded
contact between a protein receptor and a particular ligand atom
type; in other words, the likelihood that a given contact geometry
would be observed in the crystallographic databases. Interactions in
high-probability regions (e.g., donor and acceptor pair at ideal
geometry) are considered good and interactions in low probability
Methods of Exploring Protein–Ligand Interactions to Guide Medicinal. . . 161
Pr ðl; x j s Þ ¼ Pr ðx j l; s ÞPr ðl j s Þ
Pr ðx j l; t i Þ Pr ðr j l; t i Þ Pr ða j l; t i Þ Pr ðp j l; t i Þ
Fig. 1 Two vectors u and v centered on a receptor atom (green) define a local coordinate system; the
directions of these vectors depend on the receptor atom’s hybridization and heavy coordination number
Fig. 2 Distributions of non-bonded contact coordinates between ligand atom types polar (POL in red) and
hydrophobic (HYD in green) and a receptor atom of type “oQ1”, sp2 oxygen with one heavy neighbor. The
dashed lines are the histograms collection from sidechain-sidechain contacts in the PDB and the solid lines
are analytical fitted distributions. The top distribution is for the inter-atom distance, the middle the in-plane
angle, and the bottom is the out-of-plane angle (see the text)
Fig. 3 95% probability contour levels for interactions with a receptor atom type and ligand atom types POL
(red) and HYD (green)
3 Electrostatic Maps
Fig. 4 (Left) Electrostatic and van der Waals energy contour plots of an anionic small molecule calculated by
solving the Poisson equation in a polar medium (ε ¼ 80). Positive preference is indicated in blue and negative
preference is indicated in red. Notice that the carboxylate dominates the entire region and no red contour is
visible. (Right) Electrostatic with van der Waals contour plots of the same small molecule calculated by solving
the nonlinear PBE with “O” and “H” mobile screening particles (see the text). Notice that the screening effects
are much stronger and that more localized positive and negative preferences are visible
His Ile
293 Phe Gly
361
Val 317 321
299
Ile Met
360 Ala Leu 318
269 370
N
Thr
+ 315
NH O H N
H H
HN N N
Asp
381
Glu N
Ala
286 H
380
Val H
289 Phe
382 Lys H Tyr
Met 271 253
290 Leu
248
Val
256
Ile
313
Fig. 5 A diagram of the interactions of Gleevec with Abl kinase in PDB:1IEP. Residues are represented by discs
with polar residues in pink (acidic residues with a red contour and basic residues with a blue contour) and
hydrophobic residues in green. Dotted arrows indicate hydrogen bonding to sidechain (green) and backbone
(blue) atoms respectively. Blue “clouds” on ligand atoms indicate the solvent-exposed surface area of ligand
atoms (larger means more exposure). Light-blue “halos” around residues indicate the degree of surface area
contact with ligand atoms (larger means more contact). The dotted contour reflects steric room for methyl
substitution.
Fig. 6 The Electrostatic Map for the active site of AblK:Gleevec (1IEP) calculated from receptor atoms only;
positive preference is indicated in blue, negative in red, and neutral in green. The yellow interaction surface
shows the steric boundary of the pocket. A and B denote map densities not filled by Gleevec (see the text)
Map (see Fig. 6) agrees well with clear positive and negative charge
densities corresponding to all of the important hydrogen bonding
interactions of Gleevec. The predicted hydrophobic regions overlap
well with both the methyl group attached to the phenyl linker as
well as the pyridine ring fragment indicating strong favorable
hydrophobic interactions.
There are two significant regions in the AblK Electrostatic Map
that are not filled by Gleevec and therefore are potential regions of
ligand optimization. The unfilled hydrophobic density (Fig. 6
region A) suggests that a small hydrophobic group such as a halo-
gen, CH3, or CF3 would have favorable interactions with AblK and
could be a location for optimization. This is in fact the case; Asaki
et al. [18] reported biological activity data for a series of
3-substituted benzamide derivatives as Bcr-AblK inhibitors repro-
duced in Table 1; these compounds differ from Gleevec only by the
phenyl ring substituent in the hydrophobic subpocket (created by
Ile293, Leu298, Leu354 and Val379). The IC50 data of Table 1
shows that small hydrophobic substituents improve activity, in
particular, the 3-trifluromethylated benzamide. The same
3-trifluoromethyl moiety is also present in NS-187 [20], a recently
proposed Gleevec analog that not only binds more strongly to AblK
than Gleevec, but maintains potency in the presence of many
known point mutations. It is interesting that the gain in potency
of approximately 2.1 kcal/mol ¼ kT ln (IC50(CF3)/IC50(Gle-
evec) of the CF3 substituent is in rough agreement with the
3 kcal/mol hydrophobic contour value of the Electrostatic
Map. This is most likely due to the fact that the Electrostatic Map
(free) energies estimate the solvation effects that largely determine
differences in affinity in this highly homologous series.
170 Paul Labute
Table 1
Activity of Gleevec analogs against K562 cells
N N R
NH2 N
N
O N
N
H
4 Pharmacophore Screening
N+
O
O
are not deemed acceptors, along with other similar cases that
normally would have to be treated as special case exceptions in
rule-based systems, while the carbon atoms in isonitrile and carbon
monoxide were deemed acceptors (e.g., in metal ligation). Con-
ventional alcohols, phenols, alphatic amines, etc. are properly anno-
tated. Generally, there is very good agreement with hand curated
acceptor rules. Using the same principle for the εdon cutoff, we find
very good agreement with hand curated rules. Alcohols, phenols,
conjugated amines, conjugated thiols were deemed donors, while
neutral aliphatic amines and aliphatic thiols were not deemed
donors unless sufficient electron withdrawing groups were present
(e.g., FCH2SH)
Unfortunately, the strength threshold scheme does not pro-
duce satisfactory separation for CH donors: there does not appear
to be any single a priori cutoff value that satisfactorily separates CH
donors from non-CH donors, especially in substituted hetero-
cycles. This is due to the fact that CH hydrogen bonds tend to be
weak and have a rather continuous strength distribution. In fact a
similar issue exists for borderline acceptors; for example, the fol-
lowing structures
Methods of Exploring Protein–Ligand Interactions to Guide Medicinal. . . 173
O O
N N N
straddle the εacc > 0.83 cutoff line, which in any case is somewhat
arbitrary. These borderline examples highlight that what is required
is to model the interaction between the small molecule and a
hypothetical receptor in the pharmacophore query itself rather
than an isolated small-molecule feature without context. In other
words, the pharmacophore query should contain (hypothesized)
information about the receptor’s hydrogen bonding partner atom.
For example, a strong acceptor in the receptor could match strong
or weak donors in the ligand while a weak acceptor in the receptor
should only match strong donors in the ligand.
NH2 NH2
N N
H N H N
Ph
O O
Fig. 7 The augmented pharmacophore query for CDK2 hinge binders with CH donors; the magenta sphere is a
query feature with an encoded hydrogen bond acceptor strength of 2.1 of a hypothesized receptor atom. The
small spheres represent potential pharmacophore features calculated from the ligand
Fig. 8 Left: pyrazolo[4,3-d]pyrimidine cocrystallized with CDK2 (PDB:3PJ8) along with the four feature
pharmacophore queries used in a scaffold replacement experiment. Right: top ranking CH donor imidazopyr-
imidine scaffold with attached substituents in a calculated binding mode with CDK2
N N
H N H N H N
N N
N N N
pyrazolopyridine pyrazolopyridine pyrazolopyrimidine
(6,67) (6.69) (6.88)
H N H H N
N N N
H C H C H C
N N
N N N
imidazopyridine imidazopyridin e imidazopyrimidine
(1.25) (1.21) (1.34)
5 Conclusion
References
1. Berstein FC, Koetzle TF, Williams GJB, Meyer Favorable interaction regions in the binding
EF Jr, Brice MD, Rodgers JR, Kennard O, sites of proteins. J Mol Biol 259:175–201
Shimanouchi T, Tasumi M (1977) The protein 5. Nissink JWM, Verdonk ML, Klebe G (2000)
data bank: a computer-based archival file for Simple knowledge-based descriptors to predict
macromolecular structures. J Mol Biol protein-ligand interactions. Methodology and
112:535–542 validation. J Comput Aided Mol Des
2. Connolly ML (1983) Solvent-accessible sur- 14:787–803
faces of proteins and nucleic acids. Science 6. Labute P (2001) Contact preference maps.
221:709–713 Molecular operating environment version
3. Groom CR, Bruno IJ, Lightfoot MP, Ward SC 2001.01, Chemical Computing Group Inc.,
(2016) The Cambridge structural database. 1010 Sherbrooke St. W. #910, Montreal, QC,
Acta Cryst B72:171–179 Canada H3A 2R7
4. Laskowski RA, Thornton JM, Humblet C, 7. Goodford PJ (1985) A computational proce-
Singh J (1998) X-SITE: use of empirically dure for determining energetically favorable
derived atomic packing preferences to identify
Methods of Exploring Protein–Ligand Interactions to Guide Medicinal. . . 177
Abstract
The understanding of binding interactions between any protein and a small molecule plays a key role in the
rationalization of affinity and selectivity. It is essential for an efficient structure-based drug design (SBDD)
process. FMO enables ab initio approaches to be applied to systems that conventional quantum-mechanical
(QM) methods would find challenging. The key advantage of the Fragment Molecular Orbital Method
(FMO) is that it can reveal atomistic details about the individual contributions and chemical nature of each
residue and water molecule toward ligand binding which would otherwise be difficult to detect without
using QM methods. In this chapter, we demonstrate the typical use of FMO to analyze 19 crystal structures
of β1 and β2 adrenergic receptors with their corresponding agonists and antagonists.
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_8, © Springer Science+Business Media LLC 2018
179
180 Ewa I. Chudyk et al.
ßAR
Frag.1
Frag.2
Ligand
Frag.3
- + δ+ δ- δ+ δ-
Fig. 1 Workflow for FMO calculations and details on each of PIE terms that are computed [20]. The
electrostatic component arises from the Coulomb interaction between polarized charge distributions of
fragments. The exchange repulsion term is derived from the interaction between fragments situated in
close proximity and is always repulsive; it is due to the Pauli repulsion and is related to the overlap of the
two occupied orbitals. The charge transfer term arises from the interaction between the occupied orbitals of a
donor and the unoccupied orbitals of an acceptor. The dispersion arises as the interaction between instanta-
neous dipole moments of two fragments, it is hydrophobic (non-polar) in nature and is obtained in PIEDA from
the correlation energy of electrons
182 Ewa I. Chudyk et al.
2 Methods
ΔΔE lig1
int
, lig2 ¼ ΔΔE lig1, lig2 þ ΔΔE lig1, lig2 þ ΔΔE lig1, lig2
es ex ct
þ ΔΔE lig1
di
, lig2 ð2Þ
Exploring GPCR-Ligand Interactions with the Fragment Molecular. . . 185
3 Notes
Table 1
Overview of βAR complexes
N3297.39
S2115.42
A2085.39 F3066.51
W3036.48
S2125.43
Energy (kcal/mol)
N3106.55 F3076.52 0 -37
b HOH2010 D1213.32
V3267.36
F201ECL2
V1223.33
Y3337.43
N3297.39
N3106.55
6.52
F307
S2155.46 Energy (kcal/mol)
S2125.43 0 -35
c T203ECL2 F201ECL2
A2085.39
V3267.36
S2115.42
I2095.40
N3106.55
S2155.46 S2125.43
Energy (kcal/mol)
I2135.44 -12 0 +10
Fig. 2 Comparison of interactions between an antagonist and an agonist binding to β1AR. (a) Turkey β1AR in
complex with antagonist cyanopindolol (PDB entry 4BVN). (b) Turkey β1AR complex with agonist carmoterol
(PDB entry 2Y02). The carbon atoms of the ligands are shown in light orange and for the receptor are colored
according to PIE values calculated by FMO. Nitrogen atoms are shown in blue, oxygen in red, sulfur in yellow,
and chlorine in light green. The classical hydrogen bonds formed between the receptor and the ligand are
marked as yellow dashed line. The bar charts on the left show the sorted PIE for the residues interacting with
energies larger than 3 kcal/mol, and chart on the right describe the PIEDA of these interactions. PIE terms:
electrostatics, dispersion, charge-transfer and exchange repulsion are colored coded yellow, blue, red and
green respectively. (c) Difference of shared interactions between cyanopindolol and carmoterol-β1AR com-
plexes. In this case, cyanopindolol is shown in light blue and carmoterol in salmon pink, with the residues
interacting more strongly with cyanopindolol shown on a white to light blue spectrum, and residues interacting
more strongly with carmoterol on a white to salmon spectrum, where white means equal interaction energy for
both ligands. Accordingly, on the bar chart on the right, negative ΔΔE values represent a stronger interaction
with carmoterol, while negative ΔΔE values a stronger interaction with cyanopindolol
Exploring GPCR-Ligand Interactions with the Fragment Molecular. . . 189
100%
disp
dobutamine (pAGO)
carmoterol (fAGO)
isoprenaline (fAGO)
salbutamol (pAGO)
carazolol (iAGO)
ß1
arylpiperazine 19 (ANT)
arylpiperazine 20 (ANT)
bucindolol (ANT)
carvedilol (iAGO)
cyanopindolol (ANT)
carazolol (iAGO)
timolol (iAGO)
ICI-118,551 (iAGO)
VS hit (iAGO)
ß2 alprenolol (ANT)
BI-167107 (fAGO)
HBI (fAGO)
epinephrine (fAGO)
FAUC37 (cAGO)
100%
elec+ct
Fig. 3 Overview of all significant interactions for each βAR complex. Each row represents a structure, for a
total of 19 rows, where the PDB-IDs are shown on the left of each row. The name and action of the ligands are
shown on the right side of each row. Columns represent the residues interacting with the ligands, identified
through their Ballesteros–Weinstein numbers. In the matrix, the presence of a contact between the ligand and
the residue is illustrated as a colored cell, and the absence of a contact is illustrated as gray cell. Cells
representing a contact are colored according to their PIEDA signature: from dark blue (100% dispersion) to
yellow (100% electrostatic and charge-transfer). A mixed contribution (e.g., 50% dispersion, and 50%
electrostatic and charge-transfer) therefore results in a cell being colored in green to light blue, as indicated
by the spectrum bar on the right. The percentage of consensus for any ligand-residue interaction is shown at
the top of the figure as a histogram, with each bar color-coded according to average PIEDA signature,
following the same scheme as for the individual residue-ligand interactions (blue to yellow)
a F45.52 c e
F201/193ECL2
V3.33
F6.52
Y7.43
F6.51
F6.52
b d f
F6.51
V3.33
Y7.43
Fig. 4 Conserved hydrophobic interactions. (a) Superposition of all 19 βAR complexes showing the residues
(purple) interacting largely through dispersion forces with the ligands (light orange). Oxygen atoms are shown
in red, nitrogen in blue, sulfur in yellow. (b) Detail of the conformations of residue V3.33, (c) F201/193ECL2, (d)
F6.51, (e) F6.52, and (f) Y7.43
100%
elec+ct
100%
disp
ß2-carazolol (iAGO)
ß1-carazolol (iAGO)
ß2-timolol (iAGO)
ß2-IC-118,551 (iAGO)
ß2-VS hit (iAGO)
ß2-alprenolol (ANT)
ß1-arylpiperazine 19 (ANT)
ß1-arylpiperazine 20 (ANT)
ß1-bucindolol (ANT)
ß1-carvedilol (iAGO)
ß1-cyanopindolol (ANT)
100%
elec+ct
100%
disp
ß1-dobutamine (pAGO)
ß1-carmoterol (fAGO)
ß1-isoprenaline (fAGO)
ß1-salbutamol (pAGO)
ß2-BI-167107 (fAGO)
ß2-HBI (fAGO)
ß2-epineprhine (fAGO)
ß2-FAUC37 (cAGO)
100%
elec+ct
Fig. 5 (a) Histograms showing the consensus of interactions across the complexes containing agonists (AGO)
and antagonists (ANT). The height of each bar represents the percentage of structures in which a strong (larger
than 3 kcal/mol) interaction is present, while its color summarizes the chemical nature of the interaction
(yellow for mainly electrostatic and blue for mainly hydrophobic). (b) Overview heat map for βARs in complex
with an antagonist and (c) with an agonist
192 Ewa I. Chudyk et al.
Fig. 6 Conformations of residues S5.46 and W6.48 in the active and inactive structures of βAR. (a) Superposition
of all 19 complexes, where the ligands are in light orange, the receptors in an active state in pink, and in an
inactive state in white. The residue P6.50 (green) is where helix 6 opens when the receptor is activated. βAR
structures are considered to be in an active state (light pink) if with an agonist bound or in an inactive state
(white) if antagonist is bound. (b) Position of residues S5.46 and W6.48 when the receptors are in an active (light
pink) and inactive (white) states. On the right side of the figure are the zoomed-in views of residues (c) S5.46
and (d) W6.48
Acknowledgments
References
1. Rask-Andersen M, Masuram S, Schioth HB 13. Ozawa T, Okazaki K, Kitaura K (2011) CH/pi
(2014) The druggable genome: evaluation of hydrogen bonds play a role in ligand recogni-
drug targets in clinical trials suggests major tion and equilibrium between active and inac-
shifts in molecular class and indication. Annu tive states of the beta2 adrenergic receptor: an
Rev Pharmacol Toxicol 54:9–26 ab initio fragment molecular orbital (FMO)
2. Wise A, Gearing K, Rees S (2002) Target vali- study. Bioorg Med Chem 19:5231–5237
dation of G-protein coupled receptors. Drug 14. Fedorov DG, Nagata T, Kitaura K (2012)
Discov Today 7:235–246 Exploring chemistry with the fragment molec-
3. Overington JP, Al-Lazikani B, Hopkins AL ular orbital method. Phys Chem Chem Phys
(2006) How many drug targets are there? Nat 14:7562–7577
Rev Drug Discov 5:993–996 15. Lu Y-X, Zou J-W, Wang Y-H, Yu Q-S (2007)
4. Heifetz A, Schertler GF, Seifert R, Tate CG, Substituent effects on noncovalent halogen/π
Sexton PM, Gurevich VV, Fourmy D, interactions: theoretical study. Int J Quantum
Cherezov V, Marshall FH, Storer RI, Chem 107:1479–1486
Moraes I, Tikhonova IG, Tautermann CS, 16. Gallivan JP, Dougherty DA (1999) Cation-pi
Hunt P, Ceska T, Hodgson S, Bodkin MJ, interactions in structural biology. Proc Natl
Singh S, Law RJ, Biggin PC (2015) GPCR Acad Sci U S A 96:9459–9464
structure, function, drug discovery and crystal- 17. Johnston RC, Cheong PH (2013) C-H...O
lography: report from Academia-Industry non-classical hydrogen bonding in the stereo-
International Conference (UK Royal Society) mechanics of organic transformations: theory
Chicheley Hall, 1–2 September 2014. Naunyn and recognition. Org Biomol Chem
Schmiedebergs Arch Pharmacol 388 11:5057–5064
(8):883–903 18. Yu N, Li X, Cui G, Hayik SA, Merz KM 2nd
5. Dohlman HG (2015) Thematic minireview (2006) Critical assessment of quantum
series: new directions in G protein-coupled mechanics based energy restraints in protein
receptor pharmacology. J Biol Chem crystal structure refinement. Protein Sci
290:19469–19470 15:2773–2784
6. Tautermann CS (2014) GPCR structures in 19. Fedorov DG, Kitaura K (2007) Extending the
drug design, emerging opportunities with power of quantum chemistry to large systems
new structures. Bioorg Med Chem Lett with the fragment molecular orbital method. J
24:4073–4079 Phys Chem A 111:6904–6914
7. Shonberg J, Kling RC, Gmeiner P, Lober S 20. Phipps MJ, Fox T, Tautermann CS, Skylaris CK
(2015) GPCR crystal structures: medicinal (2015) Energy decomposition analysis
chemistry in the pocket. Bioorg Med Chem approaches and their evaluation on prototypi-
23:3880–3906 cal protein-drug interaction patterns. Chem
8. Jazayeri A, Dias JM, Marshall FH (2015) From Soc Rev 44:3177–3211
G protein-coupled receptor structure resolu- 21. Kitaura K, Ikeo E, Asada T, Nakano T,
tion to rational drug design. J Biol Chem Uebayasi M (1999) Fragment molecular
290:19489–19495 orbital method: an approximate computational
9. Bissantz C, Kuhn B, Stahl M (2010) A medici- method for large molecules. Chem Phys Lett
nal chemist’s guide to molecular interactions. J 313:701–706
Med Chem 53:5061–5084 22. Alexeev Y, Mazanetz MP, Ichihara O, Fedorov
10. Tong Y, Mei Y, Li YL, Ji CG, Zhang JZ (2010) DG (2012) GAMESS as a free quantum-
Electrostatic polarization makes a substantial mechanical platform for drug research. Curr
contribution to the free energy of avidin-biotin Top Med Chem 12:2013–2033
binding. J Am Chem Soc 132:5137–5142 23. Fedorov DG, Kitaura K (2007) Pair interaction
11. Raha K, Peters MB, Wang B, Yu N, Wollacott energy decomposition analysis. J Comput
AM, Westerhoff LM, Merz KM Jr (2007) The Chem 28:222–237
role of quantum mechanics in structure-based 24. Fedorov DG, Kitaura K (2012) Energy decom-
drug design. Drug Discov Today 12:725–731 position analysis in solution based on the frag-
12. Beratan DN, Liu C, Migliore A, Polizzi NF, ment molecular orbital method. J Phys Chem
Skourtis SS, Zhang P, Zhang Y (2015) Charge A 116:704–719
transfer in dynamical biosystems, or the treach- 25. El Kerdawy A, Murray JS, Politzer P,
ery of (static) images. Acc Chem Res Bleiziffer P, Hesselmann A, Gorling A, Clark
48:474–481 T (2013) Directional noncovalent interactions:
194 Ewa I. Chudyk et al.
Abstract
G protein-coupled receptors (GPCRs) are integral membrane proteins and represent the largest class of
drug targets. During the past decades progress in structural biology has enabled the crystallographic
elucidation of the architecture of these important macromolecules. It also provided atomic-level visualiza-
tion of ligand-receptor interactions, dramatically boosting the impact of structure-based approaches in drug
discovery. However, knowledge obtained through crystallography is limited to static structural informa-
tion. Less information is available showing how a ligand associates with or dissociates from a given receptor,
whose importance is in fact increasingly recognized by the drug research community. Owing to recent
advances in computer power and algorithms, molecular dynamics stimulations have become feasible that
help in analyzing the kinetics of the ligand binding process. Here, we review what is currently known about
the dynamics of GPCRs in the context of ligand association and dissociation, as determined through both
crystallography and computer simulations. We particularly focus on the molecular basis of ligand dissocia-
tion from GPCRs and provide case studies that predict ligand dissociation pathways and residence time.
Key words Binding kinetics, Molecular dynamics simulations, G protein-coupled receptor, Dissocia-
tion rate, Dissociation pathway
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_9, © Springer Science+Business Media LLC 2018
197
198 Dong Guo and Adriaan P. IJzerman
Fig. 1 The structure of tiotropium in the complex with the rat M3 receptor and an illustrative dissociation
process of the ligand from its binding pocket. This figure was generated with ICM Browser v3.8 (Molsoft) from
PDB code: 4DAJ [17]. Tiotropium (orange) binds within the pocket. Three tyrosine residues, Y1483.33,
Y5066.51, and Y5297.39, together prevent the ligand from moving out of the receptor. N5076.52 interacts
with the carbonyl and hydroxyl groups through H-bonds, while the ligand’s typical quaternary ammonium
group interacts with D1473.32. The movement of the three residues (red arrows) clears a path for tiotropium’s
dissociation from the orthosteric site to the extracellular vestibule and finally from the receptor
3 Case Study 2: The Dissociation of ZM241385 from the Adenosine Receptor and Its
Residence Time
Fig. 2 The egress of ZM241385 from the human adenosine A2A receptor. This figure was generated with ICM
Browser v3.8 (Molsoft) from PDB code: 4EIY [6]. The ligand appears to follow a multistep pathway, first
breaking the hydrogen bond network formed by the triad of E169ECL2, T2566.58, and H2647.29 and transiently
contacting the quite hydrophobic pocket above Y2717.36 consisting of I662.63, S672.64, and L2677.32 before
moving further away from the binding pocket into the extracellular domain and bulk solvent
4 Conclusion
Acknowledgments
References
1. Bjarnadottir TK, Gloriam DE, Hellstrand SH, for G protein-coupled receptors: a novel strat-
Kristiansson H, Fredriksson R, Schioth HB egy with attractive therapeutic opportunities.
(2006) Comprehensive repertoire and phylo- Med Res Rev 30:463–549
genetic analysis of the G protein-coupled 3. Santos R, Ursu O, Gaulton A, Bento AP,
receptors in human and mouse. Genomics Donadi RS, Bologa CG, Karlsson A,
88:263–273 Al-Lazikani B, Hersey A, Oprea TI, Overing-
2. De Amici M, Dallanoce C, Holzgrabe U, ton JP (2017) A comprehensive map of
Trankle C, Mohr K (2010) Allosteric ligands
Ligand Unbinding from G Protein-Coupled Receptor 205
molecular drug targets. Nat Rev Drug Discov 16. Dror RO, Pan AC, Arlow DH, Borhani DW,
16(1):19–34 Maragakis P, Shan Y, Xu H, Shaw DE (2011)
4. Cooke RM, Brown AJH, Marshall FH, Mason Pathway and mechanism of drug binding to G-
JS (2015) Structures of G protein-coupled protein-coupled receptors. Proc Natl Acad Sci
receptors reveal new opportunities for drug U S A 108:13118–13123
discovery. Drug Discov Today 20:1355–1364 17. Kruse AC, Hu J, Pan AC, Arlow DH, Rosen-
5. Tan Q, Zhu Y, Li J, Chen Z, Han GW, baum DM, Rosemond E, Green HF, Liu T,
Kufareva I, Li T, Ma L, Fenalti G, Li J, Chae PS, Dror RO, Shaw DE, Weis WI,
Zhang W, Xie X, Yang H, Jiang H, Wess J, Kobilka BK (2012) Structure and
Cherezov V, Liu H, Stevens RC, Zhao Q, Wu dynamics of the M3 muscarinic acetylcholine
B (2013) Structure of the CCR5 chemokine receptor. Nature 482:552–556
receptor-HIV entry inhibitor maraviroc com- 18. Kappel K, Miao Y, McCammon JA (2015)
plex. Science 341:1387–1390 Accelerated molecular dynamics simulations
6. Liu W, Chun E, Thompson AA, Chubukov P, of ligand binding to a muscarinic G-protein-
Xu F, Katritch V, Han GW, Roth CB, Heitman coupled receptor. Q Rev Biophys 48:479–487
LH, IJzerman AP, Cherezov V, Stevens RC 19. Mollica L, Decherchi S, Zia SR, Gaspari R,
(2012) Structural basis for allosteric regulation Cavalli A, Rocchia W (2015) Kinetics of
of GPCRs by sodium ions. Science protein-ligand unbinding via smoothed poten-
337:232–236 tial molecular dynamics simulations. Sci Rep
7. Andres M, Buil MA, Calbet M, Casado O, 5:11539
Castro J, Eastwood PR, Eichhorn P, 20. Zuckerman DM (2011) Equilibrium sampling
Ferrer M, Forns P, Moreno I, Petit S, Roberts in biomolecular simulations. Annu Rev Bio-
RS (2014) Structure-activity relationships phys 40:41–62
(SAR) and structure-kinetic relationships 21. McRobb FM, Negri A, Beuming T, Sherman
(SKR) of pyrrolopiperidinone acetic acids as W (2016) Molecular dynamics techniques for
CRTh2 antagonists. Bioorg Med Chem Lett modeling G protein-coupled receptors. Curr
24:5111–5117 Opin Pharmacol 30:69–75
8. Andersson K, Karlsson R, Lofas S, Franklin G, 22. Casarosa P, Bouyssou T, Germeyer S,
Hamalainen MD (2006) Label-free kinetic Schnapp A, Gantner F, Pieper M (2009) Pre-
binding data as a decisive element in drug dis- clinical evaluation of long-acting muscarinic
covery. Expert Opin Drug Dis 1:439–446 antagonists: comparison of tiotropium and
9. Guo D, Heitman LH, IJzerman AP (2015) investigational drugs. J Pharmacol Exp Ther
The role of target binding kinetics in drug 330:660–668
discovery. ChemMedChem 10:1793–1796 23. Dowling MR, Charlton SJ (2006) Quantifying
10. Copeland RA (2016) The drug-target resi- the association and dissociation rates of unla-
dence time model: a 10-year retrospective. belled antagonists at the muscarinic M3 recep-
Nat Rev Drug Discov 15:87–95 tor. Br J Pharmacol 148:927–937
11. Swinney DC, Haubrich BA, Liefde IV, Vauque- 24. Ballesteros J, Weinstein H (1995) Integrated
lin G (2015) The role of binding kinetics in methods for the construction of three-
GPCR drug discovery. Curr Top Med Chem dimensional models and computational prob-
15:2504–2522 ing of structure-function relations in G
12. Nunez S, Venhorst J, Kruse CG (2012) Target- protein-coupled receptors. In: Methods Neu-
drug interactions: first principles and their rosci, vol 25. Elsevier, Amsterdam, pp
application to drug discovery. Drug Discov 366–428. doi:citeulike-article-id:7694060.
Today 17:10–22 https://doi.org/10.1016/s1043-9471(05)
13. Hoffmann C, Castro M, Rinken A, Leurs R, 80049-7
Hill SJ, Vischer HF (2015) Ligand residence 25. Disse B, Speck GA, Rominger KL, Witek TJ Jr,
time at G-protein-coupled receptors-why we Hammer R (1999) Tiotropium (Spiriva):
should take our time to study it. Mol Pharma- mechanistical considerations and clinical profile
col 88:552–560 in obstructive lung disease. Life Sci
14. Latorraca NR, Venkatakrishnan AJ, Dror RO 64:457–464
(2017) GPCR dynamics: structures in motion. 26. Tautermann CS, Kiechle T, Seeliger D, Diehl S,
Chem Rev 117(1):139–155 Wex E, Banholzer R, Gantner F, Pieper MP,
15. Dror RO, Dirks RM, Grossman JP, Xu H, Casarosa P (2013) Molecular basis for the long
Shaw DE (2012) Biomolecular simulation: a duration of action and kinetic selectivity of tio-
computational microscope for molecular biol- tropium for the muscarinic m3 receptor. J Med
ogy. Annu Rev Biophys 41:429–452 Chem 56:8746–8756
206 Dong Guo and Adriaan P. IJzerman
27. Guo D, Pan AC, Dror RO, Mocking T, Liu R, recognition in the human A2a adenosine recep-
Heitman LH, Shaw DE, IJzerman AP (2016) tor. J Biol Chem 270:13987–13997
Molecular basis of ligand dissociation from the 30. Segala E, Guo D, Cheng RK, Bortolato A,
adenosine A2A receptor. Mol Pharmacol Deflorian F, Dore AS, Errey JC, Heitman LH,
89:485–491 IJzerman AP, Marshall FH, Cooke RM (2016)
28. Kim J, Jiang Q, Glashofer M, Yehle S, Wess J, Controlling the dissociation of ligands from
Jacobson KA (1996) Glutamate residues in the the adenosine A2A receptor through modula-
second extracellular loop of the human A2a tion of salt bridge strength. J Med Chem
adenosine receptor are required for ligand rec- 59:6470–6479
ognition. Mol Pharmacol 49:683–691 31. Guo D, Xia L, van Veldhoven JP, Hazeu M,
29. Kim J, Wess J, van Rhee AM, Schoneberg T, Mocking T, Brussee J, IJzerman AP, Heitman
Jacobson KA (1995) Site-directed mutagenesis LH (2014) Binding kinetics of ZM241385
identifies residues involved in ligand derivatives at the human adenosine A2A recep-
tor. ChemMedChem 9:752–761
Chapter 10
Abstract
The following chapter examines some of the current “state-of-the-art” tools for predicting, scoring, and
examining explicit water molecules in proteins and protein/ligand complexes, highlighting some of the
ways information can be readily examined in a manner that is useful in a drug discovery process.
Key words Water, WaterFLAP, Molecular dynamics, WaterMap, Water energetics, Water perturbation
1 Introduction
1.1 Waters and Drug Water molecules and their networks are now realized to have crucial
Discovery functions for both protein function and ligand binding. In terms of
protein function they affect protein plasticity, allosterism, protein-
protein interactions and the mediation of ligand binding, the focus
of this chapter [1–3]. In terms of ligand binding, waters play a key
role in potency, with displacement of “unhappy” (relative to bulk
solvent) waters from lipophilic regions a key driver, but also in the
modulation of selectivity and kinetics. It has been found important
to take into account the perturbation of the remaining water net-
work as well as the displacement of waters. With the richness of new
GPCR structures the importance of waters has been shown com-
putationally, enabled and supported by X-ray structural informa-
tion [4–6]. Water network energetics can explain trends in off-rate
kinetics, with for example trapped “unhappy” waters predicted to
occur in members of a series of adenosine A2A antagonists with fast
off-rates [7]. Waters are a key component of molecular dynamics
(MD) simulations, which enable a physics-based method to predict
binding affinities etc. using FEP (Free Energy Perturbation), a very
exciting method that with the FEPþ software (Schrödinger LLC)
on GPUs can now be done routinely in a timely fashion. MD and
water dynamics have been used for kinetic off-rate prediction,
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_10, © Springer Science+Business Media LLC 2018
207
208 Andrea Bortolato et al.
2 Materials
2.1 WaterFLAP MD 1. WaterFLAP is used for the initial placement of the water
Method molecules.
2. Optimization of the water network utilizes GROMACS.
3. Ligand topology is generated using the GAFF force field [16].
4. GROMACS used for pseudo apo and receptor/ligand complex
water refinement.
Methodologies for the Examination of Water in GPCRs 209
3 Methods
3.1 WaterFLAP MD WaterFLAP allows the prediction of the location of water molecules
Method and the evaluation of their free energy [5, 7]. It is based on GRID
[10] a software to probe a protein binding site using a range of
3.1.1 Coupling
different functional groups, including water, to identify areas of
WaterFLAP with Molecular
attraction (hotspots). The water probe is used to detect favorable
Dynamics
locations for water molecules in a ligand-protein complex. The
energy of the waters is then evaluated combing different probes:
OH2 to evaluate the hydrophilic character of the pocket, CRY
(a combination of DRY and the carbon sp2 C1 ¼ probe) to evaluate
its hydrophobic/apolar components. Positional entropy of waters
is estimated evaluating the energy landscape around its location.
Trapped (low entropy) water molecules are located in a deep and
narrow energy well, while bulk-like (high entropy) waters corre-
spond to shallow energy basins. Since GRID is based on a united-
atom force field, we introduced a short molecular dynamics step to
generate an all-atoms system including a hydrogen bond network
useful to understand the water network role in the stability of
ligand docked poses.
The final protocol called HepWaterFlap.py is an easy-to-use
python script requiring as input a protein and a docked ligand. It
consists of three steps:
1. Calculation of the water network using WaterFLAP (apo or
protein ligand complex).
2. Short optimization of the water network using a short MD in
GROMACS.
3. Refinement and rescoring of the water network using
WaterFLAP.
210 Andrea Bortolato et al.
1. def main():
2. # read the input files and flags
3. protein, ligand, cpu, mode = readinput()
4. print time.strftime("%c")
5. # create working directory whit unique name
6. # This directory is called with the protein and ligand name and an unique number
7. # this unique number will allow to run the same ligand protein several times without over
writing the results
8. proteinbasename = os.path.splitext(protein)[0]
9. ligandbasename = os.path.splitext(ligand)[0]
Methodologies for the Examination of Water in GPCRs 211
10. n=1
11. while os.path.isdir(proteinbasename + "_" + ligandbasename + "_" + str(n)) or os.path.exis
ts(
12. proteinbasename + "_" + ligandbasename + "_" + str(n) + ".tar.g
z"):
13. n += 1
14. os.system('mkdir ' + proteinbasename + "_" + ligandbasename + "_" + str(n))
15. workdir = proteinbasename + "_" + ligandbasename + "_" + str(n)
16. fixbenpdb(protein)
17. # copy the files to the working directory and go there
18. os.system("mv protein.pdb " + workdir + "/protein.pdb")
19. os.system("cp " + ligand + " " + workdir + "/ligand.mol2")
20. print " working directory: " + workdir
21. os.chdir(workdir)
22. # create starting network
23. print "creating starting water network"
24. createwaternetwork(mode)
25. # run md
26. print "equilibrating water network"
27. # we check for the output, in case we try again (max 12 times)
28. t=0
29. while t < 12 and not os.path.isfile('emFinal.gro'):
30. fixchains()
31. if mode == "complex":
32. prepareligand()
33. createproteintop()
34. if mode == "apo":
35. createproteintopAPO()
36. solvatebox()
37. runmin(cpu, mode)
38. runmd(cpu)
39. t += 1
40. # we align the translated system after MD to the original frame of reference
41. alignpdb(mode)
42. # rescore waters
43. print "rescoring water network"
44. rescorewaters(mode)
45. # create output
46. createoutput(mode, ligandbasename, workdir)
47.
48.
49. if __name__ == "__main__":
50. main()
212 Andrea Bortolato et al.
1. def readinput():
2. usage = "usage: %prog -p protein.pdb -l ligand.mol2 -c CPUnumber -
m apo/complex\nhelp: %prog -h"
3. parser = OptionParser(usage,
4. version="%prog 1.0, March 2015\nAndrea Bortolato\nandrea.bortolato@hep
tares.com\nHeptares Therapeutics - All rights reserved")
5. parser.add_option("-p", "--protein", dest="protein",
6. help="protein pdb alone with H prepared by Maestro")
7. parser.add_option("-l", "--ligand", dest="ligand",
8. help="ligand as mol2 with H")
9. parser.add_option("-c", "--cpu", dest="cpu",
10. help="cpu: number of CPUs")
11. parser.add_option("-m", "--mode", dest="mode",
12. help="mode: apo or complex")
13. (options, args) = parser.parse_args()
14. if len(args) != 0:
15. parser.error("incorrect number of arguments")
16. if str(options.protein) == 'None' or str(options.ligand) == 'None' or str(options.cpu) == 'No
ne' or str(
17. options.mode) == 'None':
18. if str(options.protein) == 'None':
19. parser.error("-p protein.pdb missing in the input")
20. if str(options.bound) == 'None':
21. parser.error("-l ligand.mol2 missing in the input")
22. if str(options.cpu) == 'None':
23. parser.error("-c CPU Number missing in the input")
24. if str(options.mode) == 'None':
25. parser.error("-m apo/complex missing in the input")
26. if str(options.mode) != 'apo' and str(options.mode) != 'complex':
27. parser.error("-m select mode to use: choose apo or complex")
28. return str(options.protein), str(options.ligand), str(options.cpu), str(options.mode)
Methodologies for the Examination of Water in GPCRs 213
The next steps create the water network using WaterFLAP. Please
note the path to WaterFLAP executable is hardcoded for Heptares’
cluster and it will need to be changed. The version of WaterFLAP
used is from January 2015, but it should be possible to use newer
versions (please discuss directly with Molecular Discovery).
1. def createwaternetwork(mode):
2. # create a pdb with only the ATOM lines for WaterFLAP
3. os.system("grep ATOM protein.pdb | grep -v ' H' > proteinNoH.pdb")
4. # if the mode is apo, generate the apo network and use the ligand only to define the bindi
ng site around the ligand
5. if mode == "apo":
6. os.system(
7. "/apps/WaterFLAP/20150122/flapwater -w -i proteinNoH.pdb -o flapWaters.pdb -
gl ligand.mol2 -gr 8 -ms 3 -se -8 -fe -1 -p CRY -cp 0 -sm 0 -rf 1 -O0 -iw 50 -it 5 -wn")
8. # if the mode is complex, generate the water network around the ligand
9. elif mode == "complex":
10. os.system('/apps/WaterFLAP/20150122/flapwater -
lp ligand.mol2 proteinNoH.pdb complex4waterFlap.pdb ')
11. os.system(
12. "/apps/WaterFLAP/20150122/flapwater -w -i complex4waterFlap.pdb -
o flapWaters.pdb -gl ligand.mol2 -gr 8 -ms 3 -se -8 -fe -1 -p CRY -cp 0 -sm 0 -rf 1 -O0 -iw 50 -
it 5 -wn")
13. flap = open('newWaters.pdb', 'w')
14. # write the pdb in a format usable by GROMACS and remove low density waters
15. with open('flapWaters_H2O.pdb', 'r') as w:
16. for i in w:
17. if len(i) > 40:
18. if i.split()[0] == 'HETATM':
19. if float(i[54:60]) <= -8.0: # filter low density waters
20. flap.writelines('ATOM ' + i[6:11] + ' O SOL ' + i[23:54] + ' 1.00 0.00 O\n
')
21. flap.close()
3.1.2 Protein/Ligand The ligand topology is generated using the GAFF force field
Complex exploiting the acpype.py script [16] (https://github.com/t-/
acpype). This script requires the net charge of the ligand in the
input to calculate the partial charges correctly. The net charge is
automatically calculated summing atoms partial charges.
1. # prepare ligand topology
2. def prepareligand():
3. # create standard names
4. mol2standard = open('Ligand.mol2', 'w')
5. atoms = False
6. totalcharge = 0.0
7. with open('ligand.mol2', 'r') as mol2:
8. for i in mol2:
9. if i == '@<TRIPOS>BOND\n':
10. atoms = False
11. if atoms:
12. mol2standard.writelines(i[:59] + 'LIG' + i[62:])
13. # get total charge summing partial charges in the mol2
14. totalcharge += float(i.split()[-1])
15. else:
16. mol2standard.writelines(i)
17. if i == '@<TRIPOS>ATOM\n':
18. atoms = True
19. mol2standard.close()
20. # ligand topology
21. print 'preparing ligand topology'
22. os.system("acpype.py -i Ligand.mol2 -c bcc -n " + str(int(round(totalcharge))))
1. def createproteintop():
2. print 'creating protein-waters topology'
3. os.system("pdb2gmx -f ProteinAmber.pdb -ff amber99sb-ildn -water spc -ignh -
o Protein2.pdb -p Protein.top")
4. # Merge Protein2.pdb + updated Ligand_NEW.pdb -> Complex.pdb
5. os.system('grep ATOM Protein2.pdb | grep -v HOH > Protein2only.pdb')
6. os.system('grep HOH Protein2.pdb > Protein2wateronly.pdb')
7. os.system('cat Protein2only.pdb Ligand.acpype/Ligand_NEW.pdb Protein2wateronly.pdb
> Complex.pdb')
216 Andrea Bortolato et al.
3.1.3 Pseudo Apo The code required for the apo protein is instead simple:
1. # protein topology
2. def createproteintopAPO():
3. print 'creating protein-waters topology'
4. os.system("pdb2gmx -f ProteinAmber.pdb -ff amber99sb-ildn -water spc -ignh -
o Protein2.pdb -p Protein.top")
5. os.system("cp Protein.top Complex.top")
6. os.system("cp Protein2.pdb Complex.pdb")
1. def solvatebox():
2. os.system('editconf -bt triclinic -f Complex.pdb -o ComplexBox.gro -d 1.0')
3. os.system('genbox -cp ComplexBox.gro -cs spc216.gro -o Complex_b4ion.gro -
p Complex.top')
4.
5.
6. def runmin(cpu, mode):
7. # create minimization file
8. os.system('cp Complex.top Complex.top_bkup')
9. minimization = open('em0.mdp', 'w')
10. em = ['define = -DPOSRES\n', 'integrator = steep\n',
11. 'nsteps = 1000\n', 'constraints = none\n', 'emtol = 1.0\n',
12. 'emstep = 0.01 ; used with steep\n', 'nstcomm = 1\n',
13. 'coulombtype = PME\n', 'ns_type = grid\n', 'rlist = 1.0\n',
14. 'rcoulomb = 1.0\n', 'rvdw = 1.0\n', 'Tcoupl = no\n',
15. 'Pcoupl = no\n', 'gen_vel = no\n',
16. 'nstxout = 0 ; write coords every # step\n', 'cutoff-scheme = Verlet\n']
17. for i in em:
18. minimization.writelines(i)
19. minimization.close()
20. # Run minimizaton
21. print "initial minimization"
22. os.system('grompp -f em0.mdp -c Complex_b4ion.gro -p Complex.top -o em.tpr -
maxwarn 10')
23. # check that the number of ions is correct
24. if mode == "complex":
25. os.system('echo 15| genion -s em.tpr -o ComplexIons.gro -neutral -p Complex.top -
conc 0.001')
26. elif mode == "apo":
27. os.system('echo 13| genion -s em.tpr -o ComplexIons.gro -neutral -p Complex.top -
conc 0.001')
28. if not os.path.isfile('ComplexIons.gro'):
29. ('editconf -f Complex.pdb -o ComplexIons.gro')
30. # create posre for the ligand
31. os.system('echo 0 | genrestr -f Ligand.acpype/Ligand_GMX.gro -o Ligandposre')
32. itplig = open('Ligand.itp', 'a')
33. itplig.writelines('\n; Include Position restraint file\n#ifdef POSRES\n#include "Ligandposre.
itp"\n#endif\n')
34. itplig.close()
35. os.system('grompp -f em0.mdp -c ComplexIons.gro -p Complex.top -o em.tpr -
maxwarn 10')
36. os.system('mdrun -v -ntomp ' + cpu + ' -deffnm em -pin auto')
218 Andrea Bortolato et al.
1. def runmd(cpu):
2. # Create md.mdp file
3. mdfile = open('md.mdp', 'w')
4. md = ['integrator = md\n',
5. 'define = -DPOSRES\n',
6. 'nsteps = 10000; 20ps\n',
7. 'dt = 0.002\n',
8. 'constraints = all-bonds\n',
9. 'ns_type = grid\n',
10. 'rlist = 1.1\n',
11. 'rcoulomb = 1.1\n',
12. 'rvdw = 1.1\n',
13. 'vdwtype = Cut-off\n',
14. 'rvdw-switch = 0.9\n',
15. 'coulombtype = PME\n',
16. 'Tcoupl = v-rescale\n',
17. 'tau_t = 0.1 0.1\n',
18. 'tc-grps = protein non-protein\n',
19. 'ref_t = 300 300\n',
20. 'Pcoupl = Berendsen\n',
21. 'Pcoupltype = isotropic\n',
22. 'tau_p = 0.5\n',
23. 'compressibility = 4.5e-5\n',
24. 'ref_p = 1.0\n',
25. 'gen_vel = yes ;;;\n',
26. 'nstxout = 500 ; write coords every # step\n',
27. 'lincs-iter = 2\n',
28. 'DispCorr = EnerPres\n',
29. 'optimize_fft = yes\n',
30. 'refcoord-scaling = com\n',
31. 'cutoff-scheme = Verlet']
32. for i in md:
33. mdfile.writelines(i)
34. mdfile.close()
35. # Run a short simulation
36. print "short MD"
37. os.system('grompp -f md.mdp -c em.gro -p Complex.top -o md.tpr -maxwarn 10')
38. os.system('mdrun -v -ntomp ' + cpu + ' -deffnm md -pin auto')
39. print "run final minimization"
40. os.system('grompp -f em0.mdp -c md.gro -p Complex.top -o emFinal.tpr -maxwarn 10')
41. os.system('mdrun -v -ntomp ' + cpu + ' -deffnm emFinal -pin auto')
Methodologies for the Examination of Water in GPCRs 219
The final output is then generated. This includes a pdb with the
optimized MD water network and another pdb with these waters
after refinement from WaterFLAP. This pdb is coded to include
additional information:
l The waters are classified using the element from unhappy (oxy-
gen: red; sulfur: yellow) to bulk-like (carbon: gray) and happy
(nitrogen: blue). The rules for the different classes are shown in
the function dahliawaterscore shown below.
l The total ΔG in kcal/mol is multiplied by ten (to remove the
decimal) and included after the element.
Methodologies for the Examination of Water in GPCRs 221
41. print "you can remove now the working directory: " + workdir
42.
43.
44. def dahliawaterscore(CRY, OH2, ENT, mode):
45. if CRY > 0.0 and mode == "complex":
46. DG = OH2 + 14 + ENT + 1.5
47. # DG = OH2 + 5
48. elif CRY <= 0.0 and mode == "complex":
49. DG = OH2 + 14 + ENT + 1.5 - 1.5 * CRY
50. # DG = OH2 + 5 - CRY
51. elif CRY > 0.0 and mode == "apo":
52. DG = OH2 + 14 + ENT + 3.0
53. # DG = OH2 + 5
54. elif CRY <= 0.0 and mode == "apo":
55. DG = OH2 + 14 + ENT + 3.0 - 1.5 * CRY
56. # DG = OH2 + 5 - CRY
57. if ENT <= -3.0:
58. element = "C"
59. elif DG >= 3.5:
60. element = "O"
61. elif DG < 3.5 and DG >= 2:
62. element = "S"
63. elif DG < 2 and DG >= -2:
64. element = "C"
65. elif DG < -2:
66. element = "N"
67. return element, DG
3.2.2 Running WaterMap The default parameters in the WaterMap setup work well in most
cases, and in most pseudo apo simulations these will suffice. Unfor-
tunately in many GPCR structures we often find numerous water-
mediated interactions from the ligand to the protein in addition to
many ligand occluded regions that the grand canonical Monte
Carlo (GCMC) water placement method can sometimes struggle
to hydrate in a manner that is consistent with our in-house crystal
structures, see Fig. 1. Although in the most recent update to the
Schrodinger force field, OPLS3, the number of waters more closely
resembles that seen in our crystal structures.
It should be noted that crystal structures are snapshots of the
protein at temperatures close to absolute zero, and thus may not be
real representations of what is actually happening. Unfortunately,
this is all we have to work with and thus must be pragmatic in our
approach and perhaps not absolutely theoretically correct.
To overcome the issues associated with the GCMC placement
of waters, we have utilized the water placement within WaterFLAP
[9, 10] to place the waters around the ligand. The water placements
around the ligand were generated using the function “createwater-
network” discussed previously in the “3.1.0 WaterFLAP MD
Fig. 1 The round spheres show the waters predicted by the Grand Canonical Monte Carlo (GCMC) method
using the OPLS2005 force field within WaterMap, the red crosses are the location of the crystallographic
waters seen within our structure
224 Andrea Bortolato et al.
XXX.msj
.
.
.
solvate_pocket {
backend ¼ {
buffer ¼ 10.0
ligand_proximity ¼ 10.0
protein_proximity ¼ 5.0
proximity_resolution ¼ 0.5
}
ligand_file ¼ ?
num_output ¼ 1
should_skip ¼ true
}
.
.
.
3.2.3 Processing To ensure comparable results are obtained for this method as have
WaterMap been obtained previously, the WaterMap results are analyzed and
the csv file of the energies, from “Export to CSV. . .” in “WaterMap
– Examine Results” (see Fig. 2), in combination with the placement
of the waters, “XXX-watermap.pdb”, are combined.
The following script with a simplified colouring scheme to what
had been discussed earlier in the function “dahliawaterscore,” in
the previous section, is then applied.
Methodologies for the Examination of Water in GPCRs 225
Fig. 2 Tab within maestro for examining the results from a WaterMap calculation, the “Export to CSV. . .”
button is located on this tab
1. #!/usr/bin/python
2.
3. import os,sys
4.
5. def print_help():
6. print ""
7. print " prepareWM.py v0.1"
8. print ""
9. print " python prepareWM.py <wm.pdb> <energy.csv>"
10. print ""
226 Andrea Bortolato et al.
The resultant pdb file has the waters that are classified using the
element from unhappy (oxygen: red; sulphur: yellow) to bulk-like
(carbon: gray) and happy (nitrogen: blue).
3.3 WaterFLAP- Typically, we generate the GRID [10] interaction fields for each
Based Method protein we dock ligands to, in order to identify hotspots and
understand the energetics of the water molecules and ligand within
3.3.1 Protein GRID
the receptor site. To generate the GRID interaction fields, we use
Generation
WaterFLAP [9], and execute it using the following command line
option:
(Path to WaterFLAP)/flapvs -d TEMP -gg 0.75 -pp 4 C1¼ C3 H
O -gr 6 -cpu 8 -gl ligand.mol2 protein.pdb
The key command line options we employ are:
-d which defines the directory for FLAP to use (TEMP in the
above case).
-gg which defines the spacing between the GRID points.
-pp which defines the number of probes (4 in the above case),
followed by the probes we wish to run (C1¼, C3, H, O in
the above case).
-gr which defines the distance from the ligand to explore
using GRID.
-cpu which defines how many CPU cores to use for generating the
GRID (maximum of 8).
-gl which defines the ligand around which we want to centre
the GRID.
228 Andrea Bortolato et al.
3.3.2 APO Water Network Prior to running WaterFLAP on a protein, we first take it through
Generation the Protein Preparation Wizard within Maestro (by Schrodinger).
After the preparation, we save the protein as protein.pdb, and the
ligand as ligand.mol2.
A new automated flag has been introduced by Molecular Dis-
covery, which captures many of the key options we had previously
set within our Python scripts, making them redundant. For the
more recent versions of WaterFLAP (released during 2016), to
generate an apo water network, we run the following command line:
(Path to WaterFLAP)/flapwater -w-auto -i protein.pdb -o WAT_-
PRED_OCT.pdb -gl ligand.mol2 -gr 6 -cpu 8 >apowaterflap. log
2>apowaterflap.log2
The key command line options we employ are:
-w-auto which runs the automated water protocol, with the default
settings.
-i which defines the protein file.
-o which defines where we want the output to be saved.
-gl which defines the ligand that was present within the pocket.
-gr which defines the distance from the ligand to explore using
GRID (and the resulting waters).
-cpu which defines how many CPU cores to use for generating the
water network (maximum of 8).
Methodologies for the Examination of Water in GPCRs 229
Fig. 3 WaterFLAP pseudo apo water network predictions with (a) showing the protein with the predicted
waters from the WAT_PRED_OCT_DG_WAT_H2O_ele.pdb file. The waters are colored gray (depicted as iron)
for bulk waters, red for high-energy waters (depicted as oxygen), yellow for mid energy waters (depicted as
sulfur), and blue for low-energy waters (depicted as nitrogen). The energy of the waters is given in the b-factor
column within the pdb. And (b) showing the WAT_PRED_OCT_DG_WAT_COMPLEX.pdb file which is utilized in
the generation of the protein/ligand complex water network
3.3.3 Complex Water Alongside apo water network prediction, WaterFLAP also has the
Network Generation ability to optimize and score a water network around a docked
ligand. Generally in this process the apo waters overlapping the
ligand are displaced, and several iterations of optimization on the
remaining water network are carried out.
To re-score or convert the apo water network to a complex
water network, we copy the WAT_PRED_OCT_DG_WAT_COM-
PLEX.pdb (generated previously), the protein.pdb file and the
docked ligand (saved as a mol2 file) into a new directory and after
changing to that directory, run the following command:
(Path to WaterFLAP)/flapdock -mol2 ligand.mol2 -gl ligand.mol2
-pdb protein.pdb -wat WAT_PRED_OCT_DG_WAT_COM-
PLEX.pdb -score_wat -refine_wat -wat_iter 20
The key command line options we employ are:
-mol2 which defines the docked ligand we want to optimise the
water network around.
-gl which defines the docked ligand we want to optimise the water
network around.
-pdb which defines the protein pdb we have docked ligand.
mol2 into.
-wat which defines the apo water network with the receptor pdb file
(the WAT_PRED_OCT_DG_WAT_COMPLEX.pdb gener-
ated during the apo prediction).
-score_wat which informs WaterFLAP that we want to score the
waters, post refinement.
-refine_wat which informs WaterFLAP that we want to refine the
waters present within the –wat pdb file.
-wat_iter which defines the number of iterations WaterFLAP
employs when optimising the water network around the
docked ligand.
As with the apo water network generation, this generates a
number of files for output, but the key file we use is WATER-
FLAP_Delta_DG_DG_WAT_H2O_ele.pdb.
The WATERFLAP_Delta_DG_DG_WAT_H2O_ele.pdb file
(Fig. 4) returned contains waters in their perturbed positions relative
to the input apo state from WAT_PRED_OCT_DG_WAT_COMP
LEX.pdb. The element type in the output file gives an indication as to
whether the water molecule has been stabilized by the ligands presence
in the receptor, or destabilized. In this file, you can have waters heavily
stabilized by the ligand (depicted as nitrogen atoms), somewhat desta-
bilized by the ligand (depicted as sulfur atoms), destabilized by the
ligand (depicted as oxygen atoms), or unaffected by the ligand
(depicted as iron atoms).
Methodologies for the Examination of Water in GPCRs 231
Fig. 4 WaterFLAP perturbed complex water network prediction from the WATERFLAP_Delta_DG_DG_WAT_H2O_
ele.pdb file showing waters perturbed from the apo state (Fig. 3a) under the influence of the ligand. Waters shown:
blue (nitrogen) are stabilized, gray (iron) are unaffected, yellow (sulfur) partially destabilized, and red (oxygen)
significantly destabilized
3.3.4 Final Output The output is then combined into a multi molecule SD file, which
contains the docked ligand, key interactions between the docked
ligand and the protein, a minimized form of the ligand and the
output from WaterFLAP. This combined multi molecule file allows
us to review whether the docked ligand is in a relatively high energy
conformation, if there are a significant number of unfavorable
interactions, and whether the ligand results in a more energetically
favorable water network.
To retrieve the key interactions, we use the poseviewer_interac-
tions.py script supplied within a default Schrodinger install, and this
can be run using the following.
$SCHRODINGER/run poseviewer_interactions.py protein.
pdb ligand.pdb
The output from this command is a file called protein_pv_in-
teractions.txt, which contains details of interactions between the
residues and the ligand atoms.
References
1. Ball P (2008) Water as an active constituent in 3. Ball P (2008) Water as a biomolecule. Chem-
cell biology. Chem Rev 108(1):74–108. PhysChem 9(18):2677–2685. https://doi.
https://doi.org/10.1021/cr068037a org/10.1002/cphc.200800515
2. Chaplin M (2006) Do we underestimate the 4. Mason JS, Bortolato A, Congreve M et al
importance of water in cell biology? Nat Rev (2012) New insights from structural biology
Mol Cell Biol 7(11):861–866. https://doi. into the druggability of G protein-coupled
org/10.1038/nrm2021 receptors. Trends Pharmacol Sci 33
232 Andrea Bortolato et al.
Abstract
Virtual screening (VS) has become an integral part of the drug discovery process and is a valuable tool for
finding novel chemical starting points for GPCR targets. Ligand-based VS makes use of biochemical data
for known, active compounds and has been applied successfully to many diverse GPCRs. Recent progress in
GPCR X-ray crystallography has made it possible to incorporate detailed structural information into the VS
process. This chapter outlines the latest VS techniques along with examples that highlight successful
applications of these methods. Best practices for increasing the likelihood of VS success, as well as ongoing
challenges, are also discussed.
Key words Virtual screening, G protein-coupled receptor, Molecular docking, Data fusion, Data
mining, Shape search, Pharmacophore search, Homology modeling, Fingerprint similarity, Machine
learning
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_11, © Springer Science+Business Media LLC 2018
233
234 Jason B. Cross
400
300
250
200
150
100
50
0
1995 2000 2005 2010 2015
Year
Fig. 1 Results of Google Scholar search for “virtual screening” in journal article
titles, broken down by year (search conducted 1/4/2017)
Fig. 2 Streamlined VS workflow, including collection of input data (data mining and compound databases),
ligand and/or structure-based database searching, combination of output from different search methods and
compound selection (data fusion), and procurement of compounds for experimental testing
2 Materials
3 Methods
3.1 Data Mining 1. The success of any VS campaign, as well as the selection of
techniques utilized, is strongly dependent on the quantity,
quality, and type of data available to computational chemist at
its outset. Regardless of the availability of protein structural
information, whether from structural biology or protein mod-
eling, curation of a dataset of known active compounds for the
target of interest, as well as other closely related targets, is a key
first step in enabling VS. This data can be used directly as input
for ligand-based approaches, as a validation set for structure-
based methods, and as a platform for the enumeration of
enriched virtual libraries.
2. Sources of this data depend on the resources available to the
computational chemist. Those in large pharmaceutical compa-
nies may have access to a wealth of proprietary data from
previous HTS campaigns and earlier drug discovery projects.
While researchers in smaller companies or academia may not
have this luxury, public databases are available for compiling
comprehensive databases of bioactive compounds.
3. Privileged structures, or scaffolds that show activity on two or
more receptors yet can be rendered selective using specific
substitution patterns, are powerful tools for drug discovery.
Evans et al. [64] introduced this concept for a benzodiazepine
scaffold that had previously been optimized for CCK1 receptor
antagonism, but could be tuned for activity against CCK2
receptor with certain substitutions. The identification and
application of these privileged structures can be quite useful
within GPCR families. A sampling of these scaffolds, as well as
their substructures (obtained via methods such as RECAP
[65]), can provide starting points not only for 2D searches,
but also for virtual library enumeration in advance of VS.
Table 1
Properties of orally administered “drug-like” molecules (Rule of 5) [74], “lead-like” molecules [73],
and molecules able to cross the blood-brain barrier [79]
3.3 Ligand-Based 1. LBVS has shown immense value in identifying novel chemical
Methods matter, including as a means for scaffold hopping [80]. This
technique requires knowledge of compounds that have the
desired bioactivity, since these serve directly as search queries
or are used to build models that serve this purpose. Many
techniques fall into this category, including fingerprint (FP)
methods, pharmacophores, shape searching, molecular fields
and surface-based methods, and machine learning. Each of
these methods will be explored in this section.
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 241
3.4 Structure-Based 1. Although the X-ray crystal structure of bovine rhodopsin was
Methods solved in 2000 [94], it was not until structures of the human
β2-adrenoceptor were released in 2007 [95] that SBVS of
GPCRs became a more productive path for lead identification.
The reason for this delay in truly successful application of SBVS
was due to the presence of key structural differences between
the rhodopsin structure and other Class A GPCRs, particularly
in the second extracellular loop (ECL2), leading to models
with a distorted orthosteric binding site. Since that time,
many additional X-ray crystal structures that cover an ever-
widening region of the GPCR phylogenetic tree have been
solved, making it possible to perform SBVS directly on the
target of interest or by using a high-quality homology model.
In addition, the activated form of β2-adrenoceptor was solved
[96], giving insights into shifts in transmembrane helix
6 (TM6) and rearrangements in TM5 and TM7 that are asso-
ciated with activation. To date, there are more than 100 GPCR
X-ray structures in the Protein Data Bank [97], including those
from pharmaceutically important groups such as chemokine
receptors [98–101], biogenic amine binding receptors
[95, 102–105], and opioid receptors [106–109], among
others. Though fewer in number, there are now several struc-
tures that cover Class B [110], C [111], and F [112] GPCRs.
This recent wealth of structural data has enabled the applica-
tion of structure-based methods to GPCR VS.
2. Molecular docking is the primary engine driving structure-
based drug discovery, but additional methods, such as molecu-
lar dynamics (MD) simulations, solvation analysis, and
advanced scoring methodologies, are finding increased appli-
cation [113]. When docking to GPCR X-ray structures or
homology models, for which there are numerous successful
applications to SBDD in the literature [114, 115], the avail-
ability of mutagenesis data or ligand pharmacophore models
can be extremely helpful in improving docked pose accuracy
[116]. One of the primary issues that still remains for molecular
docking is the quality and predictability of scoring functions.
While modern scoring functions are generally adequate for
selecting low-energy ligand poses, there is still room for
improvement in affinity prediction and ligand ranking, which
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 243
Fig. 3 Generalized SBVS workflow. This process begins with model selection, which can include X-ray
structures or homology models, single models or ensembles from MD snapshots. Docking site definition
delimits the search space within the protein and involves optimization of residue position and protonation, as
well as location of critical water molecules. A retrospective VS can be run to validate the model, if sufficient
data regarding active compounds is available. Screening of the compound database via molecular docking is
followed by a hit selection procedure, often involving ranking by docking score, IFPs, visual inspection, and
consideration of compound diversity. Selected compounds are then obtained and tested experimentally
244 Jason B. Cross
3.5 Data Fusion 1. Data fusion procedures link data sources to improve the overall
quality of data points, and have shown utility in drug reposi-
tioning [133] as well as polypharmacology and safety profile
analysis [134]. Any of the VS methods described in previous
sections can be used in isolation; however, combining these
techniques can lead to better overall enrichment and a wider
diversity of hit structures. In the VS context, there are two
primary ways data fusion is implemented: sequentially and in
parallel (see Fig. 4). Additionally, there are many alternative
ways of combining methods, especially when hybrid
approaches and machine learning are incorporated [135, 136].
2. Sequential data fusion is commonly used to increase the
throughput of a VS protocol by searching a compound data-
base using a computationally inexpensive technique (e.g., FP
similarity) and progressing the best hits as the input for more
computationally intensive techniques (e.g., docking). This is
particularly useful when computer hardware resources are lim-
ited or when downstream VS methods truly become a
246 Jason B. Cross
a b
Compound Compound
Database Database
3D Ligand-based
Fig. 4 Generalized data fusion workflows. (a) Sequential data fusion starts with computationally inexpensive
methods, such as 2D similarity search, and progresses the best scoring compounds to more computationally
costly methods, such as docking. Several methods may be threaded together in this manner to reduce overall
resource cost and improve enrichment. (b) Parallel data fusion takes the output of several independent VS
techniques, or multiple queries from a single technique, and combines them using fusion algorithms to
improve enrichment and diversity. These two paradigms can also be combined into hybrid methods or
modified using machine learning
4 Notes
4.1 Data Mining 1. Additional examples of the privileged structure concept for
GPCRs and other targets have been described
previously [148].
2. There are a number of promiscuous scaffolds that interact with
members of the chemokine receptor family, such as CCR2/
CCR5 aryl sulfonamide antagonists [149], and CCR2/CCR9
antagonists such as PF-4178903 [150] and cencriviroc [151];
since these compounds interact with multiple family members
they may qualify as privileged structures.
248 Jason B. Cross
4.3 Structure-Based 1. There are now a growing number of success stories based on
Methods the SBVS of GPCRs [158, 159]. One recent publication out-
lined a retrospective and prospective VS of A2A receptor
[160]. In the end, 9 of 20 predicted agonists turned out to
bind the receptor, which is an excellent result, but the hits
lacked the desired ability to activate A2A receptor. The authors’
conclusion was that it is still difficult to accurately model func-
tional states, though compound database composition may
also play an important role in success or failure.
2. Weiss et al. [161] were able to identify two novel β2-adreno-
ceptor binders with a similar signaling profile to that of the
co-crystallized ligand, illustrating that it is possible to find
compounds with specific functional activity. However, when
this structure was used to build an active form D2 receptor
homology model, VS resulted in only a few marginal hits, once
again demonstrating the difficulty of accurately describing
active states without X-ray structures.
3. A VS of rhodopsin R* focused on the intracellular loop region
rather than the orthosteric site, aimed at interfering with trans-
ducin binding, was able to identify molecules that modulated
signal transduction [162], showing that targeting allosteric or
protein-protein interaction sites is a viable strategy given
enough structural information.
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 249
4.4 Data Fusion 1. Tömöri et al. [184] describe a recent large-scale VS success
against PDE5 that used sequential data fusion, starting with FP
similarity on 5 million compounds followed by docking of
~2000 compounds, resulting in 48 hits with >55% inhibition
or IC50 < 1 μM.
2. Hert et al. [185] showed that combining multiple queries and
different similarity metrics for the same query molecule is a
successful strategy for improving recall in retrospective studies.
3. Baber et al. [186] studied the use of multiple ligand-based
methods against four GPCRs and found that enrichment was
improved the most by using sum rank and logistic regression
data fusion. It was concluded that the improved performance
was primarily due to increased sampling as well as the scoring
functions being in approximate agreement regarding ranking
of actives.
4.6 Challenges 1. There has been a great deal of progress in GPCR VS over the
past ~20 years, but there are still challenges to be met. While
some of these are general issues for VS against any target class,
some are more specific or have an outsized impact in applica-
tion to GPCRs. One fundamental issue is the consistency of
SAR information collected during data mining. Even though
information in a company database may have been collected
using a consistent assay format, the inclusion of public data
sources, with contributions from many different labs, will be
more difficult to reconcile.
2. In LBVS, the weighting of features in pharmacophore and
shape-based methods is also a challenge, and often these set-
tings are chosen not for data-driven reasons, but based on user
experience and anecdotal evidence.
3. There are a number of challenges related to SBVS, including
the fact that even with the impressive progress in X-ray crystal-
lography there is still limited structural coverage of the GPCR
phylogenetic tree, which leads to difficulties in homology mod-
eling. There are also many potential binding regions that
ligands can occupy in addition to the orthosteric site and
information on these sites is still growing. The intracellular
binding of vircirnon to CCR9 is a recent example [101]. Lack
of structural information is also a problem in modeling differ-
ent functional states, especially activated states, of many
GPCRs. Even though there is a growing understanding of the
relationship between structure and function of GPCRs, there
are still very few structural examples with which to build high
quality models that can be used to find functionally relevant
binders.
4. Another set of issues involves the inherent dynamics of GPCRs
and flexibility within the orthosteric site resulting in uncer-
tainty in side chain positions as well as difficulties in loop
modeling. This can also make it difficult to accurately model
allosteric sites (including PAMs and NAMs). The addition of
water molecules adds an additional layer of complexity to VS,
but the inclusion of key water molecules, either from X-ray data
or MD simulations, can be critical to the success of a VS.
5. Improvements in protein-ligand affinity prediction and incor-
poration of desolvation effects into scoring are ongoing issues
not just in the VS of GPCRs, but for structure-based design
generally. Even marginal improvements in scoring can have a
large effect on VS success.
4.7 Best Practices VS has proven to be a valuable tool for GPCR drug discovery and
an effective method for finding novel chemical starting points for
medicinal chemistry optimization. It can be used on its own or in
conjunction with other experimental screening methods (HTS,
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 253
References
1. Filmore D (2004) It’s a GPCR world. Mod comparison of ligand-based virtual screening
Drug Discov 7:24–28 tools against the DUD data set reveals limita-
2. Garland SL (2013) Are GPCRs still a source tions of current 3D methods. J Chem Inf
of new targets? J Biomol Screen 18:947–966. Model 50:2079–2093. https://doi.org/10.
https://doi.org/10.1177/ 1021/ci100263p
1087057113498418 12. Warren GL, Andrews CW, Capelli A-M,
3. Muegge I (2008) Synergies of virtual screen- Clarke B, LaLonde J, Lambert MH,
ing approaches. Mini Rev Med Chem Lindvall M, Nevins N, Semus SF, Senger S,
8:927–933. https://doi.org/10.2174/ Tedesco G, Wall ID, Woolven JM, Peishoff
138955708785132792 CE, Head MS (2006) A critical assessment
4. Ripphausen P, Nisius B, Peltason L, Bajorath J of docking programs and scoring functions. J
(2010) Quo vadis, virtual screening? A com- Med Chem 49:5912–5931. https://doi.org/
prehensive survey of prospective applications. 10.1021/jm050362n
J Med Chem 53:8461–8467. https://doi. 13. Onodera K, Satou K, Hirota H (2007) Eva-
org/10.1021/jm101020z luations of molecular docking programs for
5. Tanrikulu Y, Kr€ uger B, Proschak E (2013) virtual screening. J Chem Inf Model
The holistic integration of virtual screening 47:1609–1618. https://doi.org/10.1021/
in drug discovery. Drug Discov Today ci7000378
18:358–364. https://doi.org/10.1016/j. 14. Cross JB, Thompson DC, Rai BK, Baber JC,
drudis.2013.01.007 Fan KY, Hu Y, Humblet C (2009) Compari-
6. Irwin JJ (2008) Community benchmarks for son of several molecular docking programs:
virtual screening. J Comput Aided Mol Des pose prediction and virtual screening accu-
22:193–199. https://doi.org/10.1007/ racy. J Chem Inf Model 49:1455–1474.
s10822-008-9189-4 https://doi.org/10.1021/ci900056c
7. Rohrer SG, Baumann K (2009) Maximum 15. McGaughey GB, Sheridan RP, Bayly CI, Cul-
unbiased validation (MUV) data sets for vir- berson JC, Kreatsoulas C, Lindsley S,
tual screening based on pubchem bioactivity Maiorov V, Truchon J-F, Cornell WD
data. J Chem Inf Model 49:169–184. (2007) Comparison of topological, shape,
https://doi.org/10.1021/ci8002649 and docking methods in virtual screening. J
Chem Inf Model 47:1504–1519. https://doi.
8. Xia J, Jin H, Liu Z, Zhang L, Wang XS (2014) org/10.1021/ci700052x
An unbiased method to build benchmarking
sets for ligand-based virtual screening and its 16. Hu G, Kuang G, Xiao W, Li W, Liu G, Tang Y
application to GPCRs. J Chem Inf Model (2012) Performance evaluation of 2D finger-
54:1433–1450. https://doi.org/10.1021/ print and 3D shape similarity methods in vir-
ci500062f tual screening. J Chem Inf Model
52:1103–1113. https://doi.org/10.1021/
9. Weiss DR, Bortolato A, Tehan B, Mason JS ci300030u
(2016) GPCR-bench: a benchmarking set
and practitioners’ guide for G protein- 17. Jain AN, Nicholls A (2008) Recommenda-
coupled receptor docking. J Chem Inf tions for evaluation of computational meth-
Model 56:642–651. https://doi.org/10. ods. J Comput Aided Mol Des 22:133–139.
1021/acs.jcim.5b00660 https://doi.org/10.1007/s10822-008-
9196-5
10. Tiikkainen P, Markt P, Wolber G, Kirchmair J,
Distinto S, Poso A, Kallioniemi O (2009) 18. Truchon J-F, Bayly CI (2007) Evaluating vir-
Critical comparison of virtual screening meth- tual screening methods: good and bad metrics
ods against the MUV data set. J Chem Inf for the “early recognition” problem. J Chem
Model 49:2168–2178. https://doi.org/10. Inf Model 47:488–508. https://doi.org/10.
1021/ci900249b 1021/ci600426e
11. Venkatraman V, Pérez-Nueno VI, Mavridis L, 19. Triballeau N, Acher F, Brabet I, Pin J-P, Ber-
Ritchie DW (2010) Comprehensive trand H-O (2005) Virtual screening workflow
development guided by the “receiver
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 255
43. Jones G, Willett P, Glen RC, Leach AR, Tay- 54. Salomon-Ferrer R, Case DA, Walker RC
lor R (1997) Development and validation of a (2013) An overview of the Amber biomolec-
genetic algorithm for flexible docking. J Mol ular simulation package: Amber biomolecular
Biol 267:727–748. https://doi.org/10. simulation package. WIRE Comp Mol Sci
1006/jmbi.1996.0897 3:198–210. https://doi.org/10.1002/
44. Kramer B, Rarey M, Lengauer T (1999) Eval- wcms.1121
uation of the FLEXX incremental construc- 55. Phillips JC, Braun R, Wang W, Gumbart J,
tion algorithm for protein–ligand docking. Tajkhorshid E, Villa E, Chipot C, Skeel RD,
Proteins 37:228–241. https://doi.org/10. Kalé L, Schulten K (2005) Scalable molecular
1002/(SICI)1097-0134(19991101) dynamics with NAMD. J Comput Chem
37:2<228::AID-PROT8>3.0.CO;2-8 26:1781–1802. https://doi.org/10.1002/
45. Jain AN (2003) Surflex: fully automatic flexi- jcc.20289
ble molecular docking using a molecular 56. Bowers KJ, Sacerdoti FD, Salmon JK, Shan Y,
similarity-based search engine. J Med Chem Shaw DE, Chow E, Xu H, Dror RO, East-
46:499–511. https://doi.org/10.1021/ wood MP, Gregersen BA, Klepeis JL,
jm020406h Kolossvary I, Moraes MA (2006) Molecular
46. Friesner RA, Banks JL, Murphy RB, Halgren dynamics–scalable algorithms for molecular
TA, Klicic JJ, Mainz DT, Repasky MP, Knoll dynamics simulations on commodity clusters.
EH, Shelley M, Perry JK, Shaw DE, Francis P, ACM Press, New York, p 84
Shenkin PS (2004) Glide: a new approach for 57. Goodford PJ (1985) A computational proce-
rapid, accurate docking and scoring. dure for determining energetically favorable
1. Method and assessment of docking accu- binding sites on biologically important
racy. J Med Chem 47:1739–1749. https:// macromolecules. J Med Chem 28:849–857.
doi.org/10.1021/jm0306430 https://doi.org/10.1021/jm00145a002
47. Halgren TA, Murphy RB, Friesner RA, Beard 58. Sciabola S, Stanton RV, Mills JE, Flocco MM,
HS, Frye LL, Pollard WT, Banks JL (2004) Baroni M, Cruciani G, Perruccio F, Mason JS
Glide: a new approach for rapid, accurate (2010) High-throughput virtual screening of
docking and scoring. 2. Enrichment factors proteins using GRID molecular interaction
in database screening. J Med Chem fields. J Chem Inf Model 50:155–169.
47:1750–1759. https://doi.org/10.1021/ https://doi.org/10.1021/ci9003317
jm030644s 59. SZMAP 1.2.1.4. OpenEye Scientific Soft-
48. McGann MR, Almond HR, Nicholls A, Grant ware, Santa Fe, NM
JA, Brown FK (2003) Gaussian docking func- 60. Young T, Abel R, Kim B, Berne BJ, Friesner
tions. Biopolymers 68:76–90. https://doi. RA (2007) Motifs for molecular recognition
org/10.1002/bip.10207 exploiting hydrophobic enclosure in pro-
49. Kiefer F, Arnold K, Kunzli M, Bordoli L, tein–ligand binding. Proc Natl Acad Sci
Schwede T (2009) The SWISS-MODEL 104:808–813. https://doi.org/10.1073/
repository and associated resources. Nucleic pnas.0610202104
Acids Res 37:D387–D392. https://doi.org/ 61. Abel R, Young T, Farid R, Berne BJ, Friesner
10.1093/nar/gkn750 RA (2008) Role of the active-site solvent in
50. Zhang Y (2008) I-TASSER server for protein the thermodynamics of factor Xa Ligand
3D structure prediction. BMC Bioinformatics binding. J Am Chem Soc 130:2817–2831.
9:40. https://doi.org/10.1186/1471-2105- https://doi.org/10.1021/ja0771033
9-40 62. Beuming T, Che Y, Abel R, Kim B,
51. Yang J, Yan R, Roy A, Xu D, Poisson J, Zhang Shanmugasundaram V, Sherman W (2012)
Y (2014) The I-TASSER suite: protein struc- Thermodynamic analysis of water molecules
ture and function prediction. Nat Methods at the surface of proteins and applications to
12:7–8. https://doi.org/10.1038/nmeth. binding site prediction and characterization.
3213 Proteins 80:871–883. https://doi.org/10.
52. Eswar N, Webb B, Marti-Renom MA, Mad- 1002/prot.23244
husudhan MS, Eramian D, Shen M, Pieper U, 63. Misin M, Fedorov MV, Palmer DS (2015)
Sali A (2007) Comparative protein structure Communication: accurate hydration free
modeling using MODELLER, Curr. Protoc. energies at a wide range of temperatures
Protein Sci. John Wiley & Sons, Inc., Hobo- from 3D-RISM. J Chem Phys 142:91105.
ken, NJ, pp 2.9.1–2.9.31 https://doi.org/10.1063/1.4914315
53. Schrödinger Release 2016–4: Prime. Schrö- 64. Evans BE, Rittle KE, Bock MG, DiPardo RM,
dinger, LLC, New York, NY Freidinger RM, Whitter WL, Lundell GF,
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 257
Veber DF, Anderson PS (1988) Methods for development settings. Adv Drug Deliv Rev
drug discovery: development of potent, selec- 23:3–25. https://doi.org/10.1016/S0169-
tive, orally effective cholecystokinin antago- 409X(96)00423-1
nists. J Med Chem 31:2235–2246. https:// 75. Oprea TI (2000) Current trends in lead dis-
doi.org/10.1021/jm00120a002 covery: are we looking for the appropriate
65. Lewell XQ, Judd DB, Watson SP, Hann MM properties? Mol Divers 5:199–208. https://
(1998) RECAP-retrosynthetic combinatorial doi.org/10.1023/A:1021368007777
analysis procedure: a powerful new technique 76. Oprea TI, Davis AM, Teague SJ, Leeson PD
for identifying privileged molecular fragments (2001) Is there a difference between leads and
with useful applications in combinatorial drugs? A historical perspective. J Chem Inf
chemistry. J Chem Inf Comput Sci Comput Sci 41:1308–1315. https://doi.
38:511–522. https://doi.org/10.1021/ org/10.1021/ci010366a
ci970429i 77. Kelder J, Grootenhuis PDJ, Bayada DM, Del-
66. Irwin JJ, Sterling T, Mysinger MM, Bolstad bressine LPC, Ploemen J-P (1999) Polar
ES, Coleman RG (2012) ZINC: a free tool to molecular surface as a dominating determi-
discover chemistry for biology. J Chem Inf nant for oral absorption and brain penetration
Model 52:1757–1768. https://doi.org/10. of drugs. Pharm Res 16:1514–1519. https://
1021/ci3001277 doi.org/10.1023/A:1015040217741
67. Walters WP, Namchuk M (2003) Designing 78. Norinder U, Haeberlein M (2002) Computa-
screens: how to make your hits a hit. Nat Rev tional approaches to the prediction of the
Drug Discov 2:259–266. https://doi.org/ blood–brain distribution. Adv Drug Deliv
10.1038/nrd1063 Rev 54:291–313. https://doi.org/10.1016/
68. Walters WP, Stahl MT, Murcko MA (1998) S0169-409X(02)00005-4
Virtual screening—an overview. Drug Discov 79. Wager TT, Hou X, Verhoest PR, Villalobos A
Today 3:160–178. https://doi.org/10. (2010) Moving beyond rules: the develop-
1016/S1359-6446(97)01163-X ment of a central nervous system multiparam-
69. Baell JB, Holloway GA (2010) New substruc- eter optimization (CNS MPO) approach to
ture filters for removal of pan assay interfer- enable alignment of druglike properties. ACS
ence compounds (PAINS) from screening Chem Neurosci 1:435–449. https://doi.org/
libraries and for their exclusion in bioassays. 10.1021/cn100008c
J Med Chem 53:2719–2740. https://doi. 80. Ripphausen P, Nisius B, Bajorath J (2011)
org/10.1021/jm901137j State-of-the-art in ligand-based virtual
70. McGovern SL, Caselli E, Grigorieff N, Shoi- screening. Drug Discov Today 16:372–376.
chet BK (2002) A common mechanism https://doi.org/10.1016/j.drudis.2011.02.
underlying promiscuous inhibitors from vir- 011
tual and high-throughput screening. J Med 81. Willett P (2006) Similarity-based virtual
Chem 45:1712–1722. https://doi.org/10. screening using 2D fingerprints. Drug Discov
1021/jm010533y Today 11:1046–1053. https://doi.org/10.
71. Ryan AJ, Gray NM, Lowe PN, Chung C 1016/j.drudis.2006.10.005
(2003) Effect of detergent on “promiscuous” 82. Cereto-Massagué A, Ojeda MJ, Valls C,
inhibitors. J Med Chem 46:3448–3451. Mulero M, Garcia-Vallvé S, Pujadas G
https://doi.org/10.1021/jm0340896 (2015) Molecular fingerprint similarity search
72. Walters WP, Murcko AA, Murcko MA (1999) in virtual screening. Methods 71:58–63.
Recognizing molecules with drug-like prop- https://doi.org/10.1016/j.ymeth.2014.08.
erties. Curr Opin Chem Biol 3:384–387. 005
https://doi.org/10.1016/S1367-5931(99) 83. O’Boyle NM, Sayle RA (2016) Comparing
80058-1 structural fingerprints using a literature-
73. Teague SJ, Davis AM, Leeson PD, Oprea T based similarity benchmark. J Cheminfor-
(1999) The design of leadlike combinatorial matics 8:36. https://doi.org/10.1186/
libraries. Angew Chem Int Ed s13321-016-0148-0
38:3743–3748. https://doi.org/10.1002/( 84. Vogt I, Ahmed HEA, Auer J, Bajorath J
SICI)1521-3773(19991216)38:24<3743:: (2008) Exploring structure–selectivity rela-
AID-ANIE3743>3.0.CO;2-U tionships of biogenic amine GPCR antago-
74. Lipinski CA, Lombardo F, Dominy BW, Fee- nists using similarity searching and dynamic
ney PJ (1997) Experimental and computa- compound mapping. Mol Divers 12:25–40.
tional approaches to estimate solubility and https://doi.org/10.1007/s11030-008-
permeability in drug discovery and 9071-2
258 Jason B. Cross
85. Hu Y, Stumpfe D, Bajorath J (2016) Recent 95. Cherezov V, Rosenbaum DM, Hanson MA,
advances in scaffold hopping. J Med Chem 60 Rasmussen SGF, Thian FS, Kobilka TS, Choi
(4):1238–1246. https://doi.org/10.1021/ H-J, Kuhn P, Weis WI, Kobilka BK, Stevens
acs.jmedchem.6b01437 RC (2007) High-resolution crystal structure
86. Horvath D (2011) Pharmacophore-based vir- of an engineered human β2-Adrenergic G
tual screening. In: Bajorath J protein–coupled receptor. Science
(ed) Chemoinformatics and computational 318:1258–1265. https://doi.org/10.1126/
chemical biology. Humana Press, New York, science.1150577
pp 261–298 96. Rasmussen SGF, Choi H-J, Fung JJ,
87. Sanders MPA, Verhoeven S, de Graaf C, Pardon E, Casarosa P, Chae PS, DeVree BT,
Roumen L, Vroling B, Nabuurs SB, de Rosenbaum DM, Thian FS, Kobilka TS,
Vlieg J, Klomp JPG (2011) Snooker: a Schnapp A, Konetzki I, Sunahara RK, Gell-
structure-based pharmacophore generation man SH, Pautsch A, Steyaert J, Weis WI,
tool applied to class A GPCRs. J Chem Inf Kobilka BK (2011) Structure of a nanobody-
Model 51:2277–2292. https://doi.org/10. stabilized active state of the β2 adrenoceptor.
1021/ci200088d Nature 469:175–180. https://doi.org/10.
88. Hawkins PCD, Skillman AG, Nicholls A 1038/nature09648
(2007) Comparison of shape-matching and 97. Berman HM, Westbrook J, Feng Z,
docking as virtual screening tools. J Med Gilliland G, Bhat TN, Weissig H, Shindyalov
Chem 50:74–82. https://doi.org/10.1021/ IN, Bourne PE (2000) The protein data bank.
jm0603365 Nucleic Acids Res 28:235–242. https://doi.
89. Tawa GJ, Baber JC, Humblet C (2009) Com- org/10.1093/nar/28.1.235
putation of 3D queries for ROCS based vir- 98. Wu B, Chien EYT, Mol CD, Fenalti G, Liu W,
tual screens. J Comput Aided Mol Des Katritch V, Abagyan R, Brooun A, Wells P, Bi
23:853. https://doi.org/10.1007/s10822- FC, Hamel DJ, Kuhn P, Handel TM,
009-9302-3 Cherezov V, Stevens RC (2010) Structures
90. Kirchmair J, Distinto S, Markt P, Schuster D, of the CXCR4 chemokine GPCR with small-
Spitzer GM, Liedl KR, Wolber G (2009) How molecule and cyclic peptide antagonists. Sci-
to optimize shape-based virtual screening: ence 330:1066–1071. https://doi.org/10.
choosing the right query and including chem- 1126/science.1194396
ical information. J Chem Inf Model 99. Tan Q, Zhu Y, Li J, Chen Z, Han GW,
49:678–692. https://doi.org/10.1021/ Kufareva I, Li T, Ma L, Fenalti G, Li J,
ci8004226 Zhang W, Xie X, Yang H, Jiang H,
91. Melville JL, Burke EK, Hirst JD (2009) Cherezov V, Liu H, Stevens RC, Zhao Q,
Machine learning in virtual screening. Comb Wu B (2013) Structure of the CCR5 chemo-
Chem High Throughput Screen 12:332–343. kine receptor–HIV entry inhibitor maraviroc
https://doi.org/10.2174/ complex. Science 341:1387–1390. https://
138620709788167980 doi.org/10.1126/science.1241475
92. Geppert H, Vogt M, Bajorath J (2010) Cur- 100. Zheng Y, Qin L, Zacarı́as NVO, de Vries H,
rent trends in ligand-based virtual screening: Han GW, Gustavsson M, Dabros M, Zhao C,
molecular representations, data mining meth- Cherney RJ, Carter P, Stamos D, Abagyan R,
ods, new application areas, and performance Cherezov V, Stevens RC, IJzerman AP, Heit-
evaluation. J Chem Inf Model 50:205–216. man LH, Tebben A, Kufareva I, Handel TM
https://doi.org/10.1021/ci900419k (2016) Structure of CC chemokine receptor
2 with orthosteric and allosteric antagonists.
93. Plewczynski D, Spieser SAH, Koch U (2009) Nature 540:458–461. https://doi.org/10.
Performance of machine learning methods for 1038/nature20605
ligand-based virtual screening. Comb Chem
High Throughput Screen 12:358–368. 101. Oswald C, Rappas M, Kean J, Doré AS, Errey
https://doi.org/10.2174/ JC, Bennett K, Deflorian F, Christopher JA,
138620709788167962 Jazayeri A, Mason JS, Congreve M, Cooke
RM, Marshall FH (2016) Intracellular alloste-
94. Palczewski K, Kumasaka T, Hori T, Behnke ric antagonism of the CCR9 receptor. Nature
CA, Motoshima H, Fox BA, Trong IL, Teller 540:462–465. https://doi.org/10.1038/
DC, Okada T, Stenkamp RE, Yamamoto M, nature20606
Miyano M (2000) Crystal structure of rho-
dopsin: a G protein-coupled receptor. Science 102. Chien EYT, Liu W, Zhao Q, Katritch V, Han
289:739–745. https://doi.org/10.1126/sci GW, Hanson MA, Shi L, Newman AH,
ence.289.5480.739 Javitch JA, Cherezov V, Stevens RC (2010)
Structure of the human dopamine D3
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 259
receptor in complex with a D2/D3 selective 111. Wu H, Wang C, Gregory KJ, Han GW, Cho
antagonist. Science 330:1091–1095. https:// HP, Xia Y, Niswender CM, Katritch V,
doi.org/10.1126/science.1197410 Meiler J, Cherezov V, Conn PJ, Stevens RC
103. Shimamura T, Shiroishi M, Weyand S, (2014) Structure of a class C GPCR metabo-
Tsujimoto H, Winter G, Katritch V, tropic glutamate receptor 1 bound to an allo-
Abagyan R, Cherezov V, Liu W, Han GW, steric modulator. Science 344:58–64.
Kobayashi T, Stevens RC, Iwata S (2011) https://doi.org/10.1126/science.1249489
Structure of the human histamine H1 recep- 112. Wang C, Wu H, Katritch V, Han GW, Huang
tor complex with doxepin. Nature X-P, Liu W, Siu FY, Roth BL, Cherezov V,
475:65–70. https://doi.org/10.1038/ Stevens RC (2013) Structure of the human
nature10236 smoothened receptor bound to an antitu-
104. Haga K, Kruse AC, Asada H, Yurugi- mour agent. Nature 497:338–343. https://
Kobayashi T, Shiroishi M, Zhang C, Weis doi.org/10.1038/nature12167
WI, Okada T, Kobilka BK, Haga T, Kobayashi 113. Yuriev E, Holien J, Ramsland PA (2015)
T (2012) Structure of the human M2 musca- Improvements, trends, and new ideas in
rinic acetylcholine receptor bound to an molecular docking: 2012–2013 in review. J
antagonist. Nature 482:547–551. https:// Mol Recognit 28:581–604. https://doi.
doi.org/10.1038/nature10753 org/10.1002/jmr.2471
105. Wacker D, Wang C, Katritch V, Han GW, 114. Andrews SP, Brown GA, Christopher JA
Huang X-P, Vardy E, McCorvy JD, Jiang Y, (2014) Structure-based and fragment-based
Chu M, Siu FY, Liu W, Xu HE, Cherezov V, GPCR drug discovery. ChemMedChem
Roth BL, Stevens RC (2013) Structural fea- 9:256–275. https://doi.org/10.1002/
tures for functional selectivity at serotonin cmdc.201300382
receptors. Science 340:615–619. https:// 115. Beuming T, Lenselink B, Pala D, McRobb F,
doi.org/10.1126/science.1232808 Repasky M, Sherman W (2015) Docking and
106. Manglik A, Kruse AC, Kobilka TS, Thian FS, virtual screening strategies for GPCR drug
Mathiesen JM, Sunahara RK, Pardo L, Weis discovery. In: Filizola M (ed) G protein-
WI, Kobilka BK, Granier S (2012) Crystal coupled receptors drug discovery. Springer,
structure of the μ-opioid receptor bound to New York, pp 251–276
a morphinan antagonist. Nature 116. Beuming T, Sherman W (2012) Current
485:321–326. https://doi.org/10.1038/ assessment of docking into GPCR crystal
nature10954 structures and homology models: successes,
107. Wu H, Wacker D, Mileni M, Katritch V, Han challenges, and guidelines. J Chem Inf
GW, Vardy E, Liu W, Thompson AA, Huang Model 52:3263–3277. https://doi.org/10.
X-P, Carroll FI, Mascarella SW, Westkaemper 1021/ci300411b
RB, Mosier PD, Roth BL, Cherezov V, Ste- 117. Cheng T, Li Q, Zhou Z, Wang Y, Bryant SH
vens RC (2012) Structure of the human (2012) Structure-based virtual screening for
κ-opioid receptor in complex with JDTic. drug discovery: a problem-centric review.
Nature 485:327–332. https://doi.org/10. AAPS J 14:133–141. https://doi.org/10.
1038/nature10939 1208/s12248-012-9322-0
108. Thompson AA, Liu W, Chun E, Katritch V, 118. Michino M, Abola E, Participants GD,
Wu H, Vardy E, Huang X-P, Trapella C, Brooks CL, Dixon JS, Moult J, Stevens RC
Guerrini R, Calo G, Roth BL, Cherezov V, (2009) Community-wide assessment of
Stevens RC (2012) Structure of the nocicep- GPCR structure modelling and ligand dock-
tin/orphanin FQ receptor in complex with a ing: GPCR dock 2008. Nat Rev Drug Discov
peptide mimetic. Nature 485:395–399. 8:455–463. https://doi.org/10.1038/
https://doi.org/10.1038/nature11085 nrd2877
109. Granier S, Manglik A, Kruse AC, Kobilka TS, 119. Kufareva I, Rueda M, Katritch V, Stevens RC,
Thian FS, Weis WI, Kobilka BK (2012) Struc- Abagyan R (2011) Status of GPCR modeling
ture of the δ-opioid receptor bound to nal- and docking as reflected by community-wide
trindole. Nature 485:400–404. https://doi. GPCR dock 2010 assessment. Structure
org/10.1038/nature11111 19:1108–1126. https://doi.org/10.1016/j.
110. Hollenstein K, Kean J, Bortolato A, Cheng str.2011.05.012
RKY, Doré AS, Jazayeri A, Cooke RM, 120. Kufareva I, Katritch V, Stevens RC, Abagyan
Weir M, Marshall FH (2013) Structure of R (2014) Advances in GPCR modeling eval-
class B GPCR corticotropin-releasing factor uated by the GPCR dock 2013 assessment:
receptor 1. Nature 499:438–443. https:// meeting new challenges. Structure
doi.org/10.1038/nature12357
260 Jason B. Cross
141. Kelemen ÁA, Kiss R, Ferenczy GG, Kovács L, Vaddi K, Newton R, Hollis G, Friedman S,
Flachner B, Lőrincz Z, Keserű GM (2016) Metcalf B, Xue C-B (2011) Discovery of
Structure-based consensus scoring scheme INCB10820/PF-4178903, a potent, selec-
for selecting class A aminergic GPCR frag- tive, and orally bioavailable dual CCR2 and
ments. J Chem Inf Model 56:412–422. CCR5 antagonist. Bioorg Med Chem Lett
https://doi.org/10.1021/acs.jcim.5b00598 21:1442–1446. https://doi.org/10.1016/j.
142. Houston DR, Walkinshaw MD (2013) Con- bmcl.2011.01.015
sensus docking: improving the reliability of 151. Baba M, Takashima K, Miyake H, Kanzaki N,
docking in a virtual screening context. J Teshima K, Wang X, Shiraishi M, Iizawa Y
Chem Inf Model 53:384–390. https://doi. (2005) TAK-652 inhibits CCR5-mediated
org/10.1021/ci300399w human immunodeficiency virus type 1 infec-
143. Sastry GM, Inakollu VSS, Sherman W (2013) tion in vitro and has favorable pharmacokinet-
Boosting virtual screening enrichments with ics in humans. Antimicrob Agents Chemother
data fusion: coalescing hits from 49:4584–4591. https://doi.org/10.1128/
two-dimensional fingerprints, shape, and AAC.49.11.4584-4591.2005
docking. J Chem Inf Model 53:1531–1542. 152. van der Horst E, van der Pijl R, Mulder-
https://doi.org/10.1021/ci300463g Krieger T, Bender A, IJzerman AP (2011)
144. Bologa CG, Revankar CM, Young SM, Substructure-based virtual screening for
Edwards BS, Arterburn JB, Kiselyov AS, adenosine A2A receptor ligands. ChemMed-
Parker MA, Tkachenko SE, Savchuck NP, Chem 6:2302–2311. https://doi.org/10.
Sklar LA, Oprea TI, Prossnitz ER (2006) Vir- 1002/cmdc.201100369
tual and biomolecular screening converge on 153. Taylor CM, Rockweiler NB, Liu C,
a selective agonist for GPR30. Nat Chem Biol Rikimaru L, Tunemalm A-K, Kisselev OG,
2:207–212. https://doi.org/10.1038/ Marshall GR (2010) Using ligand-based vir-
nchembio775 tual screening to allosterically stabilize the
145. Pérez-Nueno VI, Pettersson S, Ritchie DW, activated state of a GPCR. Chem Biol Drug
Borrell JI, Teixidó J (2009) Discovery of Des 75:325–332. https://doi.org/10.1111/
novel HIV entry inhibitors for the CXCR4 j.1747-0285.2009.00944.x
receptor by prospective virtual screening. J 154. Low CMR, Buck IM, Cooke T, Cushnir JR,
Chem Inf Model 49:810–823. https://doi. Kalindjian SB, Kotecha A, Pether MJ, Shank-
org/10.1021/ci800468q ley NP, Vinter JG, Wright L (2005) Scaffold
146. Svensson F, Karlén A, Sköld C (2012) Virtual hopping with molecular field points: identifi-
screening data fusion using both structure- cation of a cholecystokinin-2 (CCK2) recep-
and ligand-based methods. J Chem Inf tor pharmacophore and its use in the design
Model 52:225–232. https://doi.org/10. of a prototypical series of pyrrole- and
1021/ci2004835 imidazole-based CCK2 antagonists. J Med
147. Tan L, Geppert H, Sisay MT, G€ utschow M, Chem 48:6790–6802. https://doi.org/10.
Bajorath J (2008) Integrating structure- and 1021/jm049069y
ligand-based virtual screening: comparison of 155. Saeh JC, Lyne PD, Takasaki BK, Cosgrove
individual, parallel, and fused molecular dock- DA (2005) Lead hopping using SVM and
ing and similarity search calculations on mul- 3D pharmacophore fingerprints. J Chem Inf
tiple targets. ChemMedChem 3:1566–1571. Model 45:1122–1133. https://doi.org/10.
https://doi.org/10.1002/cmdc.200800129 1021/ci049732r
148. Patchett AA, Nargund RP (2000) Privileged 156. Bock JR, Gough DA (2005) Virtual screen
structures — an update. In: Doherty AM for ligands of orphan G protein-coupled
(ed) Annual reports in medicinal chemistry. receptors. J Chem Inf Model
Academic Press, London, pp 289–298 45:1402–1414. https://doi.org/10.1021/
149. Ungashe S, Wei Z, Basak A, Charvat T, Jin J, ci050006d
Moore J, Zang Y, Punna S, Dairaghi D, 157. Jacob L, Hoffmann B, Stoven V, Vert J-P
Hansen D, Pennell A, Wright J (2006) Het- (2008) Virtual screening of GPCRs: an in
eroaryl sulfonamides and CCR2. US Patent silico chemogenomics approach. BMC Bioin-
Application 20060173019 A1 formatics 9:363. https://doi.org/10.1186/
150. Zheng C, Cao G, Xia M, Feng H, Glenn J, 1471-2105-9-363
Anand R, Zhang K, Huang T, Wang A, 158. Ananthan S, Zhang W, Hobrath JV (2009)
Kong L, Li M, Galya L, Hughes RO, Recent advances in structure-based virtual
Devraj R, Morton PA, Rogier DJ, screening of G-protein coupled receptors.
Covington M, Baribaud F, Shin N, AAPS J 11:178–185. https://doi.org/10.
Scherle P, Diamond S, Yeleswaram S, 1208/s12248-009-9094-3
262 Jason B. Cross
159. Rodrı́guez D, Ranganathan A, Carlsson J 168. Kooistra AJ, Leurs R, de Esch IJP, de Graaf C
(2015) Discovery of GPCR ligands by molec- (2015) Structure-based prediction of G-
ular docking screening: novel opportunities protein-coupled receptor ligand function: a
provided by crystal structures. Curr Top β-adrenoceptor case study. J Chem Inf
Med Chem 15:2484–2503 Model 55:1045–1061. https://doi.org/10.
160. Rodrı́guez D, Gao Z-G, Moss SM, Jacobson 1021/acs.jcim.5b00066
KA, Carlsson J (2015) Molecular docking 169. Heifetz A, Barker O, Verquin G, Wimmer N,
screening using agonist-bound GPCR struc- Meutermans W, Pal S, Law RJ, Whittaker M
tures: probing the A2A adenosine receptor. J (2013) Fighting obesity with a sugar-based
Chem Inf Model 55:550–563. https://doi. library: discovery of novel MCH-1R antago-
org/10.1021/ci500639g nists by a new computational–VAST approach
161. Weiss DR, Ahn S, Sassano MF, Kleist A, for exploration of GPCR binding sites. J
Zhu X, Strachan R, Roth BL, Lefkowitz RJ, Chem Inf Model 53:1084–1099. https://
Shoichet BK (2013) Conformation guides doi.org/10.1021/ci4000882
molecular efficacy in docking screens of acti- 170. Radestock S, Weil T, Renner S (2008)
vated β-2 adrenergic G protein coupled recep- Homology model-based virtual screening for
tor. ACS Chem Biol 8:1018–1026. https:// GPCR ligands using docking and target-
doi.org/10.1021/cb400103f biased scoring. J Chem Inf Model
162. Taylor CM, Barda Y, Kisselev OG, Marshall 48:1104–1117. https://doi.org/10.1021/
GR (2008) Modulating G-protein coupled ci8000265
receptor/G-protein signal transduction by 171. Chen J-Z, Wang J, Xie X-Q (2007) GPCR
small molecules suggested by virtual screen- structure-based virtual screening approach
ing. J Med Chem 51:5297–5303. https:// for CB2 antagonist search. J Chem Inf
doi.org/10.1021/jm800326q Model 47:1626–1637. https://doi.org/10.
163. Sato M, Hirokawa T (2014) Extended 1021/ci7000814
template-based modeling and evaluation 172. Evers A, Klabunde T (2005) Structure-based
method using consensus of binding mode of drug discovery using gpcr homology model-
GPCRs for virtual screening. J Chem Inf ing: successful virtual screening for antago-
Model 54:3153–3161. https://doi.org/10. nists of the Alpha1A adrenergic receptor. J
1021/ci500499j Med Chem 48:1088–1097. https://doi.
164. de Graaf C, Kooistra AJ, Vischer HF, org/10.1021/jm0491804
Katritch V, Kuijer M, Shiroishi M, Iwata S, 173. Cavasotto CN, Orry AJW, Murgolo NJ,
Shimamura T, Stevens RC, de Esch IJP, Leurs Czarniecki MF, Kocsi SA, Hawes BE,
R (2011) Crystal structure-based virtual O’Neill KA, Hine H, Burton MS, Voigt JH,
screening for fragment-like ligands of the Abagyan RA, Bayne ML, Monsma FJ (2008)
human histamine H1 receptor. J Med Chem Discovery of novel chemotypes to a G-
54:8195–8206. https://doi.org/10.1021/ protein-coupled receptor through ligand-
jm2011589 steered homology modeling and structure-
165. Istyastono EP, Kooistra AJ, Vischer HF, based virtual screening. J Med Chem
Kuijer M, Roumen L, Nijmeijer S, Smits RA, 51:581–588. https://doi.org/10.1021/
de Esch IJP, Leurs R, de Graaf C (2015) jm070759m
Structure-based virtual screening for 174. Levoin N, Labeeuw O, Billot X, Calmels T,
fragment-like ligands of the G protein -cou- Danvy D, Krief S, Berrebi-Bertrand I,
pled histamine H 4 receptor. MedChem- Lecomte J-M, Schwartz J-C, Capet M
Comm 6:1003–1017. https://doi.org/10. (2017) Discovery of nanomolar ligands with
1039/C5MD00022J novel scaffolds for the histamine H4 receptor
166. Kooistra AJ, Vischer HF, McNaught-Flores- by virtual screening. Eur J Med Chem
D, Leurs R, de EIJP, de GC (2016) Function- 125:565–572. https://doi.org/10.1016/j.
specific virtual screening for GPCR ligands ejmech.2016.09.074
using a combined scoring method. Sci Rep 175. Vilar S, Ferino G, Phatak SS, Berk B, Cava-
6:28288. https://doi.org/10.1038/ sotto CN, Costanzi S (2011) Docking-based
srep28288 virtual screening for ligands of G protein-
167. de Graaf C, Rognan D (2008) Selective coupled receptors: not only crystal structures
structure-based virtual screening for full and but also in silico models. J Mol Graph Model
partial agonists of the β2 adrenergic receptor. 29:614–623. https://doi.org/10.1016/j.
J Med Chem 51:4978–4985. https://doi. jmgm.2010.11.005
org/10.1021/jm800710x 176. Kołaczkowski M, Bucki A, Feder M, Paw-
łowski M (2013) Ligand-optimized
Methods for Virtual Screening of GPCR Targets: Approaches and Challenges 263
homology models of D1 and D2 dopamine 185. Hert J, Willett P, Wilton DJ, Acklin P,
receptors: application for virtual screening. J Azzaoui K, Jacoby E, Schuffenhauer A
Chem Inf Model 53:638–648. https://doi. (2006) New methods for ligand-based virtual
org/10.1021/ci300413h screening: use of data fusion and machine
177. Thomas T, McLean KC, McRobb FM, Man- learning to enhance the effectiveness of simi-
allack DT, Chalmers DK, Yuriev E (2014) larity searching. J Chem Inf Model
Homology modeling of human muscarinic 46:462–470. https://doi.org/10.1021/
acetylcholine receptors. J Chem Inf Model ci050348j
54:243–253. https://doi.org/10.1021/ 186. Baber JC, Shirley WA, Gao Y, Feher M (2006)
ci400502u The use of consensus scoring in ligand-based
178. McRobb FM, Capuano B, Crosby IT, Chal- virtual screening. J Chem Inf Model
mers DK, Yuriev E (2010) Homology model- 46:277–288. https://doi.org/10.1021/
ing and docking evaluation of aminergic G ci050296y
protein-coupled receptors. J Chem Inf 187. Gregory KJ, Dong EN, Meiler J, Conn PJ
Model 50:626–637. https://doi.org/10. (2011) Allosteric modulation of metabotro-
1021/ci900444q pic glutamate receptors: structural insights
179. Langmead CJ, Andrews SP, Congreve M, and therapeutic potential. Neuropharmacol-
Errey JC, Hurrell E, Marshall FH, Mason JS, ogy 60:66–81. https://doi.org/10.1016/j.
Richardson CM, Robertson N, Zhukov A, neuropharm.2010.07.007
Weir M (2012) Identification of novel adeno- 188. Bennett KA, Doré AS, Christopher JA, Weiss
sine A2A receptor antagonists by virtual DR, Marshall FH (2015) Structures of
screening. J Med Chem 55:1904–1909. mGluRs shed light on the challenges of drug
https://doi.org/10.1021/jm201455y development of allosteric modulators. Curr
180. Lam VM, Rodrı́guez D, Zhang T, Koh EJ, Opin Pharmacol 20:1–7. https://doi.org/
Carlsson J, Salahpour A (2015) Discovery of 10.1016/j.coph.2014.09.022
trace amine-associated receptor 1 ligands by 189. Noeske T, Jirgensons A, Starchenkovs I,
molecular docking screening against a homol- Renner S, Jaunzeme I, Trifanova D,
ogy model. MedChemComm 6:2216–2223. Hechenberger M, Bauer T, Kauss V, Parsons
https://doi.org/10.1039/C5MD00400D CG, Schneider G, Weil T (2007) Virtual
181. Higgs C, Beuming T, Sherman W (2010) screening for selective allosteric mGluR1
Hydration site thermodynamics explain antagonists and structure–activity relationship
SARs for triazolylpurines analogues binding investigations for coumarine derivatives.
to the A2A receptor. ACS Med Chem Lett ChemMedChem 2:1763–1773. https://doi.
1:160–164. https://doi.org/10.1021/ org/10.1002/cmdc.200700151
ml100008s 190. Noeske T, Trifanova D, Kauss V, Renner S,
182. Mason JS, Bortolato A, Congreve M, Mar- Parsons CG, Schneider G, Weil T (2009) Syn-
shall FH (2012) New insights from structural ergism of virtual screening and medicinal
biology into the druggability of G protein- chemistry: identification and optimization of
coupled receptors. Trends Pharmacol Sci allosteric antagonists of metabotropic gluta-
33:249–260. https://doi.org/10.1016/j. mate receptor 1. Bioorg Med Chem
tips.2012.02.005 17:5708–5715. https://doi.org/10.1016/j.
183. Lenselink EB, Beuming T, Sherman W, van bmc.2009.05.072
Vlijmen HWT, IJzerman AP (2014) Selecting 191. Tresadern G, Cid JM, Macdonald GJ, Vega
an optimal number of binding site waters to JA, de Lucas AI, Garcı́a A, Matesanz E,
improve virtual screening enrichments against Linares ML, Oehlrich D, Lavreysen H,
the adenosine A2A receptor. J Chem Inf Biesmans I, Trabanco AA (2010) Scaffold
Model 54:1737–1746. https://doi.org/10. hopping from pyridones to imidazo[1,2-α]
1021/ci5000455 pyridines. New positive allosteric modulators
184. Tömöri T, Hajdú I, Barna L, Lőrincz Z, of metabotropic glutamate 2 receptor. Bioorg
Cseh S, Dormán G (2012) Combining 2D Med Chem Lett 20:175–179. https://doi.
and 3D in silico methods for rapid selection org/10.1016/j.bmcl.2009.11.008
of potential PDE5 inhibitors from multimil- 192. Mueller R, Dawson ES, Niswender CM,
lion compounds’ repositories: biological eval- Butkiewicz M, Hopkins CR, Weaver CD,
uation. Mol Divers 16:59–72. https://doi. Lindsley CW, Conn PJ, Meiler J (2012) Iter-
org/10.1007/s11030-011-9335-0 ative experimental and virtual high-
264 Jason B. Cross
Abstract
Predicting the functional preferences of the ligands was always a highly demanding task, much harder that
predicting whether a ligand can bind to the receptor. This is because of significant similarities of agonists,
antagonists and inverse agonists which are binding usually in the same binding site of the receptor and only
small structural changes can push receptor toward a particular activation state. For G protein-coupled
receptors, due to a large progress in crystallization techniques and also in receptor thermal stabilization, it
was possible to obtain a large number of high-quality structures of complexes of these receptors with
agonists and non-agonists. Additionally, the long-time-scale molecular dynamics simulations revealed how
the activation processes of GPCRs can take place. Using both theoretical and experimental knowledge it
was possible to employ many clever and sophisticated methods which can help to differentiate agonists and
non-agonists, so one can interconvert them in search of the optimal drug.
Key words GPCRs, Agonists, Activation, Ligand docking, Fingerprints, Molecular dynamics
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_12, © Springer Science+Business Media LLC 2018
265
266 Przemysław Miszta et al.
Fig. 1 General scheme showing modularity of GPCRs. Purple ribbon patches highlight highly conserved,
functionally relevant motifs in the TM helices of class A GPCRs. Prolines, which induce kinks in helices, are
shown in ball-and-stick representation
Agonist/Antagonist Differentiation 267
(TM) region, where the ligand recognition and binding occur. The
IC area includes lower TM region, ICLs, and C-terminal domain—
this area experiences the largest conformational changes during
receptor activation [7].
Our current understanding of the function of GPCRs was
changed from simple On-Off switches to microprocessor-like
action [8]. Especially, the phenomenon of functional selectivity,
whereby certain ligands initiate only portions of the signaling
mechanisms mediated by a given receptor, opened new horizons
for drug discovery. Each receptor undergoes a series of conforma-
tional rearrangements controlled by molecular switches leading to
partial or full activation and the dynamic character of GPCRs is
thought to be essential for their diverse physiological functions.
Transition between these intermediate states involves the disrup-
tion of intramolecular interactions that stabilize the basal state of a
receptor. Such profound changes are evoked by the action of
molecular switches (Fig. 1) [9]. The major switches proposed so
far for different GPCRs include the “Trp rotamer toggle switch”
also called a “transmission switch” involving the CWxP sequence
on transmembrane helix TM6, the “Tyr rotamer toggle switch”
based on the NPxxY sequence on TM7, the “ionic lock” linking
transmembrane helices TM3 and TM6 and employing the (D/E)
RY motif on TM3, and the “3–7 lock” interaction connecting TM3
and TM7 (involving, e.g., Schiff base-counterion interaction in
rhodopsin).
As a result of their broad influence on human physiology and
behavior, GPCRs are promising candidates for the development of
new and more effective small-molecule therapeutics. However, the
development of selective GPCR drugs is challenging for several
reasons: there is a high degree of homology among many closely
related receptor subtypes that can regulate diverse physiological
functions; additionally, a single GPCR may couple to more than
one G protein, or signal through G protein-independent pathways.
Although this functional versatility is important for normal physio-
logical signaling, it makes identifying effective therapeutics very
challenging. New data support a multi-state activation of GPCRs,
where the receptor can adopt multiple conformations, including
active, inactive, and other intermediate ones. In such multi-state
model the ligands have the propensity to stabilize a unique confor-
mation leading to a specific signaling response.
Table 1
Some similarity coefficients and distances used with fingerprints
Where, given the fingerprints of two compounds, A and B, m equals the total amount of bits present in the fingerprints,
a equals the amount of bit set to 1 in A, b equals the amount of bits set to 1 in B, and c equals the amount of bits set to 1 in
both A and B [11].
Agonist/Antagonist Differentiation 269
Fig. 2 Exemplary interaction fingerprints of β2AR hits from each of the scoring approaches compared to the
X-ray structure. Adapted from [22]
2.2 Usage Kooistra et al. [21, 22] employed unique protein-ligand interaction
of Molecular fingerprints (IFPs) derived from all the ligand-bound β-adrenergic
Fingerprints from crystal structure monomers to post-process the docking poses of
Crystal Structures known β1AR/β2AR ligands, and physicochemically similar decoys
and Docking Poses in each of the β1AR/β2AR structures. The analysis of 1920 unique
IFP-structure combinations using IFP scoring was employed to
virtual screening (VS) for selecting ligands with a specific agonist/
non-agonist functional effect [21]. IFP rescoring was shown to be
essential to obtain high enrichment factors and at the same time a
high selectivity. The analysis showed that the IFPs of non-agonists
were more similar to each other than to agonist IFPs (75% versus
19% similar pairs, respectively). Analogously, the pairwise similarity
between agonist IFPs was higher (62%) than similarity to
non-agonists (21%) (Fig. 3). By using the correctly chosen agonist
reference IFP (a complex with epinephrine), it was possible to
selectively retrieve agonists compared to non-agonists with a high
efficiency (EF1% ¼ 43.6 and 9.4, respectively).
Protein-ligand interaction fingerprints have been successfully
used for post-docking processing of ligand poses, and that method
proved to be superior to the conventional energy-based docking
scores or RMSD calculations. To improve the predictive value of
docking even further, interaction fingerprints are often used
270 Przemysław Miszta et al.
Fig. 3 Overview of interaction fingerprints of all cocrystallized ligands in β1AR and β2AR. The colors indicate
the presence of a particular interaction according to the 7-bit fingerprints (colors described at the bottom of
the figure). The last two columns describe the amount of times (as a percentage of the total comparisons) an
IFP comparisons having score 0.6 when compared with non-agonist IFPs (ANT/iAGO, antagonist/inverse
agonist, names in blue, a blue background indicates a high percentage), and the f/pAGO IFPs (full/partial
agonists, names in red, a red background indicates a high percentage) [21]
extracellular
a b agonistic isomer antagonistic isomer
F6.52 F6.52
N N
H+ H+
O O
W6.48 W6.48
agonist antagonist
intracellular
Fig. 4 Stereoselective pair of 5-HT1A receptor ligands. (a) agonist and antagonist epimers. (b) Action of
molecular switches and water influx in agonist-bound receptor [23]
Fig. 5 The binding sites and the interaction fingerprints of 5-HT1A receptor ligands. (ABEF) antagonist-bound
receptor. (CDGH) Agonist-bound receptor. Start (ACEG) and end (BDFH) of simulations. Blue, green, and red
areas on spider plots represent the three different MD simulations presented in this work [23]
Fig. 6 (Upper panels) The 16 important residues that form polar and/or hydrophobic interactions with
exemplary ligands in binding site of β2AR. (Lower panels) The relationship of protein-ligand interactions and
the state of β2AR. Thick lines–dominant interactions; thin lines–rare interactions; orange–hydrogen bonds;
black–non-polar interactions. Yellow spheres: water molecules; (a) agonist; (b) antagonist; (c) inverse
agonist [26]
Agonist/Antagonist Differentiation 273
Fig. 7 The interaction fingerprints of the twelve ligands with β2AR. (a) The four agonists. (b) The four
antagonists. (c) The four inverse agonists. (Left panels) The normalized frequency of H-bonds/ionic bonds
in the final 100 frames. (Right panels) The normalized frequency of hydrophobic interactions in the final
100 frames [26]
3.1 Structure-Based The recent abundance of crystal structures of GPCRs has stimu-
Virtual Screening lated the structure-based drug discovery studies against these tar-
gets. The increased amount of high-resolution structural
information on GPCRs has opened up new opportunities for the
identification of novel GPCR ligands by structure-based virtual
screening (SBVS). SBVS can be employed for the efficient identifi-
cation of chemically novel ligands with high hit rates and also for
the structure-based prediction of GPCR ligand function. Increased
computational power enabled docking screenings of very large
libraries of small compounds to identify ligands that complement
GPCR binding sites, which may lead to identifying drug-like mole-
cules with tailored pharmacological properties [28]. The recent
Agonist/Antagonist Differentiation 275
Fig. 8 Workflow of the virtual-screening approaches performed on the H1R and the β2AR. Only compounds
within the top 500 (H1R) or top 750 (β2AR) compounds were selected for further processing. Figure adapted
from [22]
3.3 Enhanced A prospective SBVS using a large library of 3.4 million molecules
Docking in SBVS aiming at β2AR, as well as dopamine D2 receptor (D2R) agonists,
was done by Weiss et al. [37]. In this study, a library of lead-like and
fragment-like molecules from the ZINC database was screened
against the active state (PDB id: 3P0G) and inactive state, carazo-
lol-bound crystal structure (PDB id:2RH1). Using a set of 30 ago-
nists and 30 inverse-agonists of β2AR, they tested the ability of
receptor’s active structure to recognize known β2AR ligands against
a background of property matched decoys and to preferentially
score agonists over inverse-agonists. To ensure that the reasonable
poses were obtained in docking, the dipole moment of S2035.42,
S2045.43, or S2075.46 was increased to enhance docking scores for
poses in polar contact with these residues. Serine residues were
proposed to be important for interactions with agonists and for
the activation [38], and the largest change between the active and
inactive β2AR structures was associated with those residues. Com-
pounds ranking within the top 0.2% of the active-state structure
and ranking at least 5000 positions higher for the active-state
278 Przemysław Miszta et al.
3.4 Enrichment This measure emphasizes early enrichment of ligands, at the first 1%
Factor as a Measure (EF1%) of the database [39, 40]. For the enrichment metric the
of SBVS-Based adjusted LogAUC (area under the curve) was used for enrichment
Agonist/Non-agonist curves, which measures the ranking of true positives (known
Differentiation ligands) over false positives (decoy molecules) compared to what
would be expected at random—an adjusted LogAUC of 0 repre-
sents the random ranking. The active receptor structure enriched
the 60 known β2AR ligands over decoys, with an enrichment of
23.6% adjusted LogAUC. The active receptor structure also distin-
guished agonists from inverse-agonists, with adjusted LogAUC of
35.4% for agonists and 10.6% for inverse-agonists (Fig. 9). In the
Fig. 9 Semilogarithmic enrichment curves for retrospective enrichment of known GPCR ligands from a set of
computational decoys employing β2AR active structure (top), inactive β2AR with the same set of known
ligands (middle), and the active dopamine D2R model with 100 known ligands (50 agonists and 50 antago-
nists). Figure adapted from [37]
Agonist/Antagonist Differentiation 279
3.5 Employing An important issue to resolve is to what extent the structures solved
Induced Fit Docking with a ligand of a certain class of functionality can be used in
for Changing GPCR docking studies focused on another class of ligands. Constanzi
Preferences for Ligand and Vilar [41] evaluated crystal structures of β2AR for their ability
Binding to discriminate between agonist and antagonist compounds. The
results clearly showed that inactive crystal structures favored the
retrieval of antagonists, while the active-state crystal structure
prioritized agonists over antagonists. With the aim of evaluating
the effect of a ligand-induced optimization on the receptor’s ability
to recognize agonist or antagonist compounds, they built three
β2AR models by refining the binding site of an inverse agonist-
bound structure (solved in complex with carazolol) with three full
agonists, i.e., epinephrine, isoproterenol, and fenoterol. To opti-
mize the recognition of agonist compounds in VS the induced fit
docking (IFD) protocol has been applied to GPCR crystal struc-
tures. Interestingly, all three agonist-induced β2AR models reverted
their initial preferences, being as effective in prioritizing agonists
over antagonists as the active-state crystal structure of the β2AR.
Moreover, Constanzi and Vilar demonstrated that the induced-fit
docking of agonists is a viable way of modifying an inactive crystal
structure and bias it toward the in silico recognition of agonists
rather than blockers.
3.6 The Effect Due to the pharmacological importance [42] and availability of
of Water Molecules crystal structures solved in both the active and inactive states, the
on SBVS Enrichment adenosine A2A receptor has been a widely studied target using
structure-based computational approaches. Once a A2A receptor
crystal structure with a resolution of 1.8 Å was released in 2012
(PDB id:4EIY) [43], it revealed several interesting and novel fea-
tures, including a large number of water molecules located deep in
the binding site. These water molecules have been shown to play a
pivotal role in binding of ligands to the A2A receptor [44]. In
particular, the “unhappy” waters trapped between the ligand and
the protein lead to the short residence time of a ligand and can be
used for ligand binding kinetics prediction and also to generate
working hypotheses how to improve binding in the lead optimiza-
tion program. The effect of presence of water molecules on virtual
280 Przemysław Miszta et al.
Table 2
The percentage of the β2AR agonist/antagonist pairs for which the Eq. 1 was fulfilled
Fig. 10 Conformational fluctuations of W2466.48 and distribution of water molecules in the complex A2AR/
NECA. (a) 3D structure of A2AR with agonist NECA. (b) W2466.48 fluctuates between two distinct conformations
but only in complex with agonist. (c) Average water density during MD simulation showing formation of
intrinsic water pathway. Right panels: correlation analysis of network interactions in antagonist- (upper panel)
and agonist-bound (lower panel) A2A receptor. Residues in the helix and in the loop are red and cyan dots,
respectively. Line connections indicate residues’ contacts [47]
Fig. 11 Simultaneous view of the community residue interaction network and 3D structure of β2AR. (a)
Agonist-bound β2AR; (b) antagonist-bound β2AR; (c) inverse agonist-bound β2AR [26]
4.2 The Network Another kind of signaling network was proposed by Lee et al.
of Binary Switches [51]. Based on 5 μs all-atom MD simulations of A2A adenosine
receptor in its apo, antagonist-bound, and agonist-bound com-
plexes, they examined the corresponding dynamics and correlation
between the 10 key structural motifs that serve as the allosteric
hotspots in the intramolecular signaling network (Fig. 12). For this
purpose they identified 10 molecular interactions that switch
between two distinct states and they called them “binary switches”.
Such switches are able to yield in total 210 microstates and the
communication over the network of binary switches regulates the
activation of A2A adenosine receptor. Their cross-correlation analy-
sis showed that W6.48, located deep inside the binding cleft can
serve as both an agonist sensor and actuator of intramolecular
signaling during the receptor activation. A signal of rotameric
change of W6.48, triggered by a direct hydrophobic interaction
with an agonist was transmitted to six other binary switches (S1, S2,
S3, S5, S8, S9). Statistical analyses on the dynamics of and correla-
tion among the 10 binary switches reveal that the three receptor
states retain distinct dynamic properties. The antagonist- and
agonist-bound form of the receptors explore vastly different con-
formational space, and the apo form lies between them, yet located
closer to the antagonist-bound form.
4.3 Allosteric Effects To investigate the activation process of opioid receptors, the MD
of Sodium Ions studies on μ-opioid receptor (μOR) crystal structure [52] were
in GPCRs performed [53] which revealed distinct consecutive mobility
284 Przemysław Miszta et al.
a
Antagonist-bound Apo Agonist-bound
1 1 1
10 10 10
9 0.8 9 N 0.8 9 P 0.8
8 0.6
8 N P 0.6
8 P P P 0.6
7 7 N 7 P P P P P P
6 0.4 6 0.4 6 0.4
5 P 0.2 5 0.2 5 P P P 0.2
4 4 N P 4
0 0 0
3 P 3 N N N 3 P P
2 -0.2 2 -0.2 2 P P P -0.2
1 1 N 1 P P -0.4
-0.4 -0.4
1 2 3 4 5 6 7 8 9 10 1 2 3 4 5 6 7 8 9 10 1 2 3 4 5 6 7 8 9 10
b
S5 S5 S5
TM4 TM3 TM4 TM3 TM4 TM3
S3 S3 S3
S6 TM5 S6 TM5 S6 TM5
S4 TM2 S4 TM2 S4 TM2
Fig. 12 Cross-correlations among binary switches. (a) Cross-correlation matrices between the changes in
10 binary switches: symbols P means a positive correlation (Cij > 0.25); N is for the negative correlation
(Cij < 0.25). (b) Diagram of the cross-correlation between the switches. TM1–TM7 helices are displayed in
gray circles, and the ten switches are specified with the boxes. The positive and negative correlations are
depicted using red and blue lines, respectively. S7 switch (W6.48) is as a central switch located at the bottom
of the orthosteric binding cleft [51]
Fig. 13 Sodium ion entrance pathway. (a) Cross-section of μOR showing a pathway of a particular sodium ion
during the initial 200 ns of Apo μOR simulation. Blue dots are consecutive positions of the sodium ion along its
pathway. An arrow indicates a rotamer switch of W2936.48. (b) Distances Na+-D1142.50 (blue) and Na+-
S1543.39 (red) during two separate 500 ns simulations. (c) Superimposed crystal structure of A2AR (light colors)
and final Apo μOR MD structure (bold colors). (d) Positions of second sodium ion (blue crosses) during
simulation of unliganded receptor [53]
5.1 Probing Active, For adenosine A2A receptor it was possible to find that a hydropho-
Inactive, and Meta- bic layer of amino acid residues next to the characteristic NPxxY
State Conformations motif forms a gate that opens to form a continuous water channel
286 Przemysław Miszta et al.
a b
0 0
free energy surface (KJ/mol)
-5
Fig. 14 Three distinct rotamer states of Y2887.53 at the NPxxY motif of adenosine A2A receptor. (a) Free-energy
surface of the agonist NECA bound to the A2AR in absence of Gα. (b) Free-energy surface of agonist NECA
bound to the A2AR in presence of Gα at the cytoplasmic site [60]
5.2 Modulation Taking advantage of the recently published inactive and active
of the Free-Energy crystal structures of GPCRs, Provasi et al. [65] developed a compu-
Landscape tational strategy that enabled the identification of the specific con-
of the Receptor by formations taken by β2AR when interacting with ligands that elicit
the Ligand different physiological responses. This methodology can be also
used for virtual screening, and possibly lead to the structure-
based rational discovery of novel “biased” ligands that are capable
of selectively activating one cellular signaling pathway over another.
They showed that ligands with different efficacies (either inverse
agonists, neutral antagonists, or agonists) modulate the free-energy
landscape of the receptor by shifting the conformational equilib-
rium toward active or inactive conformations. Using metadynamics
simulations they estimated the free-energy surface of the complexes
as a function of three important descriptors of receptor activation,
namely the distance between R3.50 and E6.30 (the “ionic lock”),
the rotamer of residue W6.48 (the so-called toggle switch), and the
outward displacement of the intracellular segment of TM6. Specif-
ically, the receptor was studied in its unliganded form as well as in
complex with the full agonist epinephrine, the weak partial agonist
dopamine, the very weak partial agonist catechol, the inverse ago-
nist ICI-118-551, the inverse agonist carazolol, and the neutral
antagonist alprenolol. The ligands with varied efficacies are believed
to modulate the free-energy landscape of a GPCR shifting the
conformational equilibrium toward active or inactive conforma-
tions of the receptor, depending on their pharmacological action.
In case of agonist, epinephrine, it was found that full agonist
was capable of stabilizing a state of β2AR presenting structural
features that have been found in the nanobody-stabilized agonist-
bound crystal structure of β2AR. They also obtained a relatively
stable agonist-bound inactive state that was structurally similar to
the inverse agonist-bound crystal structure of β2AR. This is in line
with the absence of outward location of TM6 noted in both the
β2AR crystal structure with a covalently-bound agonist [66], and
the agonist-bound β1AR crystal structures. The obtained relatively
small difference in free energy between the fully active and the
inactive agonist-bound conformations was probably due to the
lack of the G-protein in the simulations because a ligand alone
was not sufficient to stabilize a fully active state of the receptor.
Fig. 15 Binding of ligands to opioid receptors. (a) Levallorphan in different receptors. (b) Solvent accessible
surface areas (SASA) values for agonist-bound κOR (left panel) and antagonist-bound κOR (right panel). Error
bars represent standard deviations obtained from statistical evaluation of 200 snapshots extracted from the
final parts of the MD simulations [67]
6.3 Principal This method was used for visualization of helix movements for
Component Analysis agonists, antagonists and inverse agonists bound to β2AR
of the Ligand-Receptor [26]. Fig. 17 shows the lowest frequency mode calculated for the
Vibrational Modes ligands using the alpha carbons. The helix movements in the intra-
cellular region are more consistent than in the extracellular region.
Agonist/Antagonist Differentiation 289
Fig. 16 The volumes of the intracellular pockets in the twelve β2AR studied systems and the cross sections of
selected complexes [26]
In agonist bound systems, TM6 and TM7 move away from each
other and thus a large void space is created. In antagonist and
inverse agonist bound systems, the movement of TM6 is more
diverse and consequently the helix keeps the intracellular pocket
closed. The principal component analysis for the final frames of MD
simulations was calculated in VMD [68].
7.1 Simple QSAR For the particular receptor types it was possible to discriminate
Methods agonists and non-agonists based on ligand properties using even
simple parameters: the molecular weight (MW), calculated loga-
rithm of octanol/water partition coefficient (clogP), molar refrac-
tion, dipole moment, ELUMO (the energy of the lowest unoccupied
molecular orbital, a measure of the electron affinity of a molecule
and its reactivity as an electrophile), EHOMO (the energy of the
highest occupied molecular orbital, related to the ionization
290 Przemysław Miszta et al.
Fig. 17 Principal component analysis of the vibrational modes in the presence of agonists, antagonists, and
inverse agonists of β2AR [26]
7.2 Classification The problem with the classification methods based on ligands alone
of Ligands Using QSAR is that the methods are not associated with the receptor, because
and Machine Learning they do not include influence of the environment. Some com-
pounds can play different roles depending on the type of receptor
they bind to, and in such cases the ligand-based classification meth-
ods that are not taking into account the environment (the receptor
binding site) will fail. For example, flibanserin is a full agonist of
serotonin 5-HT1A receptor and, with lower affinity, is an
Agonist/Antagonist Differentiation 291
7.3 Usage The set of 47 ligands of the histamine receptors H1-H4 was ana-
of Vibrational lyzed [71] by structural similarity and molecular vibrational fre-
Frequency quency patterns using by the quantum calculations method, namely
Calculations density functional theory (DFT) for geometry optimization, and
for Ligands vibrational frequency calculations in the GAMESS program. Then,
the radial tree was produced by clustering analysis of molecular
vibrational frequency patterns. The “corralled” intensity of molec-
ular vibrational frequency (CIMVF) allowed creating a hierarchical
clustering of all ligands where eight agonists were located close
together, except impromidine, and all antagonists were clustered
close to each other in the radial tree. The same method was used
later for ligands of adenosine receptors A1R, A2AR, A2BR, and A3R
[72]. The molecular vibrational frequency may play a role in the
classification of agonists/antagonists for GPCR ligands as a possi-
ble molecular descriptor. Employing a larger set of adenosine
receptor ligands they performed molecular vibration calculations
followed by clustering and they employed a novel classification
method based on information gain (IG) function and machine
learning [73]. The IG measures the amount of information (rela-
tive entropy) about the class prediction in bits, if the only
292 Przemysław Miszta et al.
Agonist
4 Non-agonist
Mean intensity
3
Fig. 18 The mean intensities of the two corralled intensities of molecular vibrational frequency (CIMVFs) of
adenosine receptor agonists (blue) and non-agonists (red) according to the wave number of the molecular
vibration [73]
Acknowledgments
References
1. Pierce KL, Premont RT, Lefkowitz RJ (2002) patterns in fingerprints and graphs. J Chem
Seven-transmembrane receptors. Nat Rev Mol Inf Model 53:623–637
Cell Biol 3:639–650 15. Da C, Kireev D (2014) Structural protein-
2. Moreno JL, Holloway T, Gonzalez-Maeso J ligand interaction fingerprints (SPLIF) for
(2013) G protein-coupled receptor hetero- structure-based virtual screening: method and
complexes in neuropsychiatric disorders. Prog benchmark study. J Chem Inf Model
Mol Biol Transl Sci 117:187–205 54:2555–2561
3. O’Hayre M, Degese MS, Gutkind JS (2014) 16. Baroni M, Cruciani G, Sciabola S, Perruccio F,
Novel insights into G protein and G protein- Mason JS (2007) A common reference frame-
coupled receptor signaling in cancer. Curr work for analyzing/comparing proteins and
Opin Cell Biol 27:126–135 ligands. Fingerprints for ligands and proteins
4. Sodhi A, Montaner S, Gutkind JS (2004) Viral (FLAP): theory and application. J Chem Inf
hijacking of G-protein-coupled-receptor sig- Model 47:279–294
nalling networks. Nat Rev Mol Cell Biol 17. Wood DJ, de Vlieg J, Wagener M, Ritschel T
5:998–1012 (2012) Pharmacophore fingerprint-based
5. Lundstrom K (2006) Latest development in approach to binding site subpocket similarity
drug discovery on G protein-coupled recep- and its application to bioisostere replacement. J
tors. Curr Protein Pept Sci 7:465–470 Chem Inf Model 52:2031–2043
6. Schioth HB, Fredriksson R (2005) The 18. Lavecchia A (2015) Machine-learning
GRAFS classification system of G-protein cou- approaches in drug discovery: methods and
pled receptors in comparative perspective. Gen applications. Drug Discov Today 20:318–331
Comp Endocrinol 142:94–101 19. Mordalski S, Kosciolek T, Kristiansen K,
7. Katritch V, Cherezov V, Stevens RC (2011) Sylte I, Bojarski AJ (2011) Protein binding
Diversity and modularity of G protein-coupled site analysis by means of structural interaction
receptor structures. Trends Pharmacol Sci 33 fingerprint patterns. Bioorg Med Chem Lett
(1):17–27 21:6816–6819
8. Kenakin T, Miller LJ (2010) Seven transmem- 20. Cao R, Wang Y (2016) Predicting molecular
brane receptors as shapeshifting proteins: the targets for small-molecule drugs with a ligand-
impact of allosteric modulation and functional based interaction fingerprint approach. Chem-
selectivity on new drug discovery. Pharmacol MedChem 11:1352–1361
Rev 62:265–304 21. Kooistra AJ, Leurs R, de Esch IJ, de Graaf C
9. Trzaskowski B, Latek D, Yuan S, (2015) Structure-based prediction of G-
Ghoshdastider U, Debinski A, Filipek S protein-coupled receptor ligand function: a
(2012) Action of molecular switches in beta-adrenoceptor case study. J Chem Inf
GPCRs–theoretical and experimental studies. Model 55:1045–1061
Curr Med Chem 19:1090–1109 22. Kooistra AJ, Vischer HF, McNaught-Flores D,
10. Vass M, Kooistra AJ, Ritschel T, Leurs R, de Leurs R, de Esch IJ, de Graaf C (2016)
Esch IJ, de Graaf C (2016) Molecular interac- Function-specific virtual screening for GPCR
tion fingerprint approaches for GPCR drug ligands using a combined scoring method. Sci
discovery. Curr Opin Pharmacol 30:59–68 Rep 6:28288
11. Cereto-Massague A, Ojeda MJ, Valls C, 23. Yuan S, Peng Q, Palczewski K, Vogel H, Filipek
Mulero M, Garcia-Vallve S, Pujadas G (2015) S (2016) Mechanistic studies on the stereose-
Molecular fingerprint similarity search in vir- lectivity of the serotonin 5-HT1A receptor.
tual screening. Methods 71:58–63 Angew Chem Int Ed 55:8661–8665
12. Deng Z, Chuaqui C, Singh J (2004) Structural 24. Latek D, Pasznik P, Carlomagno T, Filipek S
interaction fingerprint (SIFt): a novel method (2013) Towards improved quality of GPCR
for analyzing three-dimensional protein-ligand models by usage of multiple templates and
binding interactions. J Med Chem 47:337–344 profile-profile comparison. PLoS One 8:
13. Marcou G, Rognan D (2007) Optimizing frag- e56742
ment and scaffold docking by use of molecular 25. Vroling B, Sanders M, Baakman C,
interaction fingerprints. J Chem Inf Model Borrmann A, Verhoeven S, Klomp J,
47:195–207 Oliveira L, de Vlieg J, Vriend G (2011)
14. Desaphy J, Raimbaud E, Ducrot P, Rognan D GPCRDB: information system for G protein-
(2013) Encoding protein-ligand interaction coupled receptors. Nucleic Acids Res 39:
D309–D319
294 Przemysław Miszta et al.
26. Chan HC, Filipek S, Yuan S (2016) The prin- 2 adrenergic G protein coupled receptor. ACS
ciples of ligand specificity on beta-2-adrenergic Chem Biol 8:1018–1026
receptor. Sci Rep 6:34736 38. Liapakis G, Ballesteros JA, Papachristou S,
27. Ballesteros JA, Weinstein H (1995) Integrated Chan WC, Chen X, Javitch JA (2000) The
methods for the construction of three- forgotten serine. A critical role for
dimensional models and computational prob- Ser-2035.42 in ligand binding to and activa-
ing of structure-function relations in G tion of the beta 2-adrenergic receptor. J Biol
protein-coupled receptors. Methods Neurosci Chem 275:37779–37788
25:366–428 39. Huang N, Shoichet BK, Irwin JJ (2006)
28. Rodriguez D, Ranganathan A, Carlsson J Benchmarking sets for molecular docking. J
(2015) Discovery of GPCR ligands by molecu- Med Chem 49:6789–6801
lar docking screening: novel opportunities 40. Mysinger MM, Shoichet BK (2010) Rapid
provided by crystal structures. Curr Top Med context-dependent ligand desolvation in
Chem 15:2484–2503 molecular docking. J Chem Inf Model
29. Gutierrez-de-Teran H, Sallander J, Sotelo E 50:1561–1573
(2017) Structure-based rational design of 41. Costanzi S, Vilar S (2012) In silico screening
adenosine receptor ligands. Curr Top Med for agonists and blockers of the beta(2) adren-
Chem 17:40–58 ergic receptor: implications of inactive and acti-
30. Kolb P, Rosenbaum DM, Irwin JJ, Fung JJ, vated state structures. J Comput Chem
Kobilka BK, Shoichet BK (2009) Structure- 33:561–572
based discovery of beta2-adrenergic receptor 42. Jazayeri A, Andrews SP, Marshall FH (2017)
ligands. Proc Natl Acad Sci U S A Structurally enabled discovery of adenosine
106:6843–6848 A2A receptor antagonists. Chem Rev
31. Bissantz C, Bernard P, Hibert M, Rognan D 117:21–37
(2003) Protein-based virtual screening of 43. Liu W, Chun E, Thompson AA, Chubukov P,
chemical databases. II. Are homology models Xu F, Katritch V, Han GW, Roth CB, Heitman
of G-protein coupled receptors suitable tar- LH, AP IJ, Cherezov V, Stevens RC (2012)
gets? Proteins 50:5–25 Structural basis for allosteric regulation of
32. Korb O, Stutzle T, Exner TE (2009) Empirical GPCRs by sodium ions. Science 337:232–236
scoring functions for advanced protein-ligand 44. Bortolato A, Tehan BG, Bodnarchuk MS,
docking with PLANTS. J Chem Inf Model Essex JW, Mason JS (2013) Water network
49:84–96 perturbation in ligand binding: adenosine a
33. de Graaf C, Kooistra AJ, Vischer HF, (2A) antagonists as a case study. J Chem Inf
Katritch V, Kuijer M, Shiroishi M, Iwata S, Model 53:1700–1713
Shimamura T, Stevens RC, de Esch IJ, Leurs 45. Lenselink EB, Beuming T, Sherman W, van
R (2011) Crystal structure-based virtual Vlijmen HW, AP IJ (2014) Selecting an opti-
screening for fragment-like ligands of the mal number of binding site waters to improve
human histamine H(1) receptor. J Med Chem virtual screening enrichments against the aden-
54:8195–8206 osine A2A receptor. J Chem Inf Model
34. O’Boyle NM, Liebeschuetz JW, Cole JC 54:1737–1746
(2009) Testing assumptions and hypotheses 46. Friesner RA, Banks JL, Murphy RB, Halgren
for rescoring success in protein-ligand docking. TA, Klicic JJ, Mainz DT, Repasky MP, Knoll
J Chem Inf Model 49:1871–1878 EH, Shelley M, Perry JK, Shaw DE, Francis P,
35. Shimamura T, Shiroishi M, Weyand S, Shenkin PS (2004) Glide: a new approach for
Tsujimoto H, Winter G, Katritch V, rapid, accurate docking and scoring. 1. Method
Abagyan R, Cherezov V, Liu W, Han GW, and assessment of docking accuracy. J Med
Kobayashi T, Stevens RC, Iwata S (2011) Chem 47:1739–1749
Structure of the human histamine H1 receptor 47. Yuan S, Hu Z, Filipek S, Vogel H (2015) W246
complex with doxepin. Nature 475:65–70 (6.48) opens a gate for a continuous intrinsic
36. Rogers D, Hahn M (2010) Extended- water pathway during activation of the adeno-
connectivity fingerprints. J Chem Inf Model sine A2A receptor. Angew Chem Int Ed
50:742–754 54:556–559
37. Weiss DR, Ahn S, Sassano MF, Kleist A, Zhu X, 48. Skjaerven L, Yao XQ, Scarabelli G, Grant BJ
Strachan R, Roth BL, Lefkowitz RJ, Shoichet (2014) Integrating protein structural dynamics
BK (2013) Conformation guides molecular and evolutionary analysis with Bio3D. BMC
efficacy in docking screens of activated beta- Bioinformatics 15:399
Agonist/Antagonist Differentiation 295
49. Grant BJ, Rodrigues AP, ElSawy KM, McCam- receptors correlates with the formation of a
mon JA, Caves LS (2006) Bio3d: an R package continuous internal water pathway. Nat Com-
for the comparative analysis of protein struc- mun 5:4733
tures. Bioinformatics 22:2695–2696 61. Bonomi M, Branduardi D, Bussi G,
50. Van Wart AT, Durrant J, Votapka L, Amaro RE Camilloni C, Provasi D, Raiteri P, Donadio D,
(2014) Weighted implementation of subopti- Marinelli F, Pietrucci F, Broglia RA, Parrinello
mal paths (WISP): an optimized algorithm and M (2009) PLUMED: a portable plugin for
tool for dynamical network analysis. J Chem free-energy calculations with molecular
Theory Comput 10:511–517 dynamics. Comput Phys Commun
51. Lee Y, Choi S, Hyeon C (2015) Communica- 180:1961–1972
tion over the network of binary switches reg- 62. Barducci A, Bussi G, Parrinello M (2008) Well-
ulates the activation of A2A adenosine tempered metadynamics: a smoothly converg-
receptor. PLoS Comput Biol 11:e1004044 ing and tunable free-energy method. Phys Rev
52. Manglik A, Kruse AC, Kobilka TS, Thian FS, Lett 100:020603
Mathiesen JM, Sunahara RK, Pardo L, Weis 63. Li JN, Jonsson AL, Beuming T, Shelley JC,
WI, Kobilka BK, Granier S (2012) Crystal Voth GA (2013) Ligand-dependent activation
structure of the micro-opioid receptor bound and deactivation of the human adenosine A
to a morphinan antagonist. Nature (2A) receptor. J Am Chem Soc
485:321–326 135:8749–8759
53. Yuan S, Vogel H, Filipek S (2013) The role of 64. Yuan S, Filipek S, Vogel H (2016) A gating
water and sodium ions in the activation of the mechanism of the serotonin 5-HT3 receptor.
mu-opioid receptor. Angew Chem Int Ed Structure 24:816–825
52:10112–10115 65. Provasi D, Artacho MC, Negri A, Mobarec JC,
54. Phillips JC, Braun R, Wang W, Gumbart J, Filizola M (2011) Ligand-induced modulation
Tajkhorshid E, Villa E, Chipot C, Skeel RD, of the free-energy landscape of G protein-
Kale L, Schulten K (2005) Scalable molecular coupled receptors explored by adaptive biasing
dynamics with NAMD. J Comput Chem techniques. PLoS Comput Biol 7:e1002193
26:1781–1802 66. Rosenbaum DM, Zhang C, Lyons JA, Holl R,
55. Pronk S, Pall S, Schulz R, Larsson P, Aragao D, Arlow DH, Rasmussen SGF, Choi
Bjelkmar P, Apostolov R, Shirts MR, Smith H-J, Devree BT, Sunahara RK, Chae PS, Gell-
JC, Kasson PM, van der Spoel D, Hess B, Lin- man SH, Dror RO, Shaw DE, Weis WI,
dahl E (2013) GROMACS 4.5: a high- Caffrey M, Gmeiner P, Kobilka BK (2011)
throughput and highly parallel open source Structure and function of an irreversible
molecular simulation toolkit. Bioinformatics agonist-beta(2) adrenoceptor complex. Nature
29:845–854 469:236–240
56. Salomon-Ferrer R, Gotz AW, Poole D, Le 67. Yuan S, Palczewski K, Peng Q, Kolinski M,
Grand S, Walker RC (2013) Routine microsec- Vogel H, Filipek S (2015) The mechanism of
ond molecular dynamics simulations with ligand-induced activation or inhibition of mu-
AMBER on GPUs. 2. Explicit solvent particle and kappa-opioid receptors. Angew Chem Int
mesh ewald. J Chem Theory Comput Ed 54:7560–7563
9:3878–3888 68. Humphrey W, Dalke A, Schulten K (1996)
57. Harvey MJ, Giupponi G, Fabritiis GD (2009) VMD: visual molecular dynamics. J Mol
ACEMD: accelerating biomolecular dynamics Graph Model 14:33–38
in the microsecond time scale. J Chem Theory 69. Kuo CL, Wang RB, Shen LJ, Lien LL, Lien EJ
Comput 5:1632–1639 (2004) G-protein coupled receptors: SAR ana-
58. Bergdorf M, Baxter S, Rendleman CA, Shaw lyses of neurotransmitters and antagonists. J
DE (2016) Desmond/GPU performance as of Clin Pharm Ther 29:279–298
November 2016, D. E. Shaw Research Techni- 70. Zhu XL, Cai HY, Xu ZJ, Wang Y, Wang HY,
cal Report DESRES/TR Zhang A, Zhu WL (2011) Classification of
59. Klauda JB, Venable RM, Freites JA, O’Connor 5-HT(1A) receptor agonists and antagonists
JW, Tobias DJ, Mondragon-Ramirez C, using GA-SVM method. Acta Pharmacol Sin
Vorobyov I, AD MK Jr, Pastor RW (2010) 32:1424–1430
Update of the CHARMM all-atom additive 71. Oh SJ (2012) Characteristics in molecular
force field for lipids: validation on six lipid vibrational frequency patterns between ago-
types. J Phys Chem B 114:7830–7843 nists and antagonists of histamine receptors.
60. Yuan S, Filipek S, Palczewski K, Vogel H Genomics Inform 10:128–132
(2014) Activation of G-protein-coupled
296 Przemysław Miszta et al.
72. Chee HK, Oh SJ (2013) Molecular vibration- of adenosine receptor ligands. FEBS Lett
activity relationship in the agonism of adeno- 589:548–552
sine receptors. Genomics & informatics 74. Frank E, Hall M, Trigg L, Holmes G, Witten
11:282–288 IH (2004) Data mining in bioinformatics using
73. Chee HK, Yang JS, Joung JG, Zhang BT, Oh Weka. Bioinformatics 20:2479–2481
SJ (2015) Characteristic molecular vibrations
Chapter 13
Abstract
From the pharmacological point of view, allosteric modulators may present numerous advantages over
orthosteric ligands. Growing availability of novel tools and experimental data provides a tempting oppor-
tunity to apply computational methods to improve known modulators and design novel ones. However,
recent progress in understanding of complexity of allostery increases awareness of problems involved in
design of modulators with desired properties. Deeper insight into phenomena such as probe dependence,
altering signaling bias with minor changes in ligand structure, as well as influence of subtle endogenous
allosteric factors turns out to be fundamental. These effects make the design of a modulator with precise
pharmacological outcome a very challenging task, and need to be taken into consideration throughout the
design process. In this chapter, we focus on nuances of targeting GPCR allosteric sites in computational
drug design efforts, in particular with application of docking, virtual screening, and molecular dynamics.
Key words Allostery, Allosteric modulation, GPCR, Molecular dynamics, Molecular docking, Virtual
screening, Probe dependence, Signal transduction, Structure-based drug design, Protein dynamics
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_13, © Springer Science+Business Media LLC 2018
297
298 Damian Bartuzi et al.
more traps for its safe and efficient use in humans are set. On one
hand, Cinacalcet [2], Maraviroc [3], and Plerixafor [4] serve as an
example of successful application of such strategy into therapy. On
the other hand, an example of LY2033298 underlines the complex-
ity of probe dependence and subtype specificity issues [5], while an
example of Oliceridine (TRV130), a biased ligand of the μ opioid
receptors [6], clearly shows that some sophisticated mechanisms,
like functional selectivity, are strongly dependent on very subtle
influences of number of elusive factors, which manifested itself as
pronounced species-dependent differences in pharmacology of that
agonist [7], and due to similar nature of allostery and biased
signaling, analogical problems can appear in design of allosteric
modulators. Analysis of these cases could suggest that the only
way to prevent such complications would be performing studies
on the target species in vivo, which is obviously impossible. How-
ever, the present in silico techniques, together with growing
amount of experimental data, allow for satisfactory reconstruction
of native conditions to improve quality of computer-aided design
and investigation of allosteric modulators [8–11]. In this chapter,
we are going to highlight some key concepts crucial in planning
in silico studies on allosteric modulation of G protein-coupled
receptors (GPCRs). Although we focus on this particular important
family of receptors, a number of issues apply to other classes of
proteins as well.
Fig. 1 The scheme depicting possible mechanisms of probe dependence. It presents interrelationships of
signals transmitted through allosteric pathways. The illustrated mechanism helps to understand the need of
native conditions in studies on allosteric ligands. Central cog represents a hypothetical molecular switch,
upper left cog represent orthosteric binding pocket, upper right cog—allosteric site, lower cog—G-protein
coupling region. (a) In the inactive receptor, all the molecular switches oscillate around their rest positions. (b)
Binding of the red agonist activates the receptor to a certain extent, shifting the equilibrium toward the active
conformation. (c) Additional binding of a brown allosteric modulator allows for shifting the equilibrium even
farther, increasing the maximal activation level. Binding of one of them stabilizes the favorable structure,
facilitating binding of the other, and therefore increasing its affinity. Red and brown compounds present
positive cooperativity. (d) The blue agonist is capable of activating the receptor to similar extent as the red
one. However, its specific structural features induce rearrangements that prevent the brown modulator
binding. (e) The signal is reciprocal. In the presence of the brown modulator, blue agonist has decreased
affinity. Blue and brown compounds present negative cooperativity
Fig. 2 Overview of known endogenous allosteric modulators of GPCRs (detailed description in the text)
3.1 Hidden Sites It should be stressed that all the endogenous allosteric factors
described in the previous section can affect a GPCR behavior.
Therefore, their action contributes to mechanisms implied in the
creation of another class of binding sites—the hidden ones. The
receptor structure can be significantly altered under allosteric influ-
ence, so that potential allosteric binding pockets can be revealed. It
is known that proteins are not static entities, but they could be
more appropriately represented by ensembles of structures balanc-
ing around an equilibrium. Therefore, some potential binding sites
can be buried in static snapshots caught in X-ray crystals, but
revealed, e.g., during molecular dynamics simulations
[56–60]. Presence of appropriate endogenous modulators would
affect resultant conformation derived from such simulation, and
could greatly contribute to revealing novel druggable surfaces.
GPCR Allosteric Modulators: Opportunities and Challenges 305
3.2 Allosteric The picture of allosteric modulation of GPCRs is even more com-
Mechanisms within plex thanks to the possibility of allosteric modulation within dimers
GPCR Dimers and oligomers and the allosteric effect of membrane components.
and Oligomers It can be thus concluded that allosteric mechanisms enable an
integrative activity to emerge either intramolecularly in G protein-
coupled receptor monomers or intermolecularly via receptor–re-
ceptor interactions in GPCR homodimers, heterodimers, and
receptor mosaics [61].
Allostery can be generally termed a mode of long distance
communication between distal sites in proteins [61]. According
to the classical point of view one binding site influences the activity
of another site via a conformational change. The Monod–Wyman–-
Changeux model describes allosteric proteins as symmetric oligo-
mers with identical protomers existing in “at least” two
conformational states (tense, T; relaxed, R) with different affinities
for ligands [61]. According to this model the protein interconverts
between two conformations, R and T, in a concerted manner. In
the Koshland–Nemethy–Filmer sequential model subunits change
conformation, one at a time. The new concept allostery assumes
that proteins may have an ensemble of conformations and dynamic
states. Allostery is thus a thermodynamic phenomenon governed
by enthalpy and/or entropy. In the receptor heteromers the allo-
steric communication between the two receptors occurs via the
receptor interface, which has a key role in mediating the receptor–-
receptor interaction. This takes place thanks to modulation of the
orthosteric and allosteric binding sites of the neighboring proto-
mer, its G protein activation and selectivity, its signaling cascades,
and through occurrence of new allosteric pockets which may affect,
e.g., G protein coupling and selectivity [61].
The experimental proofs for allosterism or cooperativity within
homomeric proteins are mainly based on radioligand binding stud-
ies [62]. They can be also derived from receptor heteromers, in that
one of the interacting partners has been changed in such a way that
it can be distinguished from its dimeric partner. Negative coopera-
tivity has been shown by radioligand binding for numerous GPCR
homomers. Changes in ligand binding affinity or dissociation kinet-
ics have been reported in cells and tissues co-expressing pairs of
GPCRs that can form heteromers and supply further evidence of
allosteric communication across GPCRs [62]. The studies on
CXCR2-δ-opioid receptor heteromers demonstrate another phar-
macological effect typical for allosterism at heteromers: increased
signaling of an orthosteric ligand as a result of the presence of
another receptor with or without a bound ligand [62]. However,
more common pharmacological outcome of heteromerization is
the cross-inhibition of signaling in an effect of allosteric
communication.
Discovery of compounds that allosterically modulate GPCR
dimers is problematic as nowadays design of molecules binding to
306 Damian Bartuzi et al.
4.3 Ligand- Structure-based drug design of allosteric GPCR ligands has been
and Structure-Based hampered by the lack of structural data for allosteric binding sites,
Drug Design making a strong case for predictive computational methods [59]. In
of Allosteric this context, ligand-based approaches have been often applied, in
Modulators particular for designing family C GPCR allosteric modulators.
There are only a few reports of successful computational design
of family A and family B allosteric modulators and a number of
cases referring to family C ligands. Lane et al. [101] reported
structure-based ligand discovery targeting orthosteric and allosteric
pockets of dopamine receptors. In order to identify novel ligands
they used D3 receptor with an empty orthosteric pocket and this
312 Damian Bartuzi et al.
5 Summary
References
1. Christopoulos A (2014) Advances in G 56:563–570. https://doi.org/10.1021/acs.
protein-coupled receptor allostery: from jcim.5b00705
function to structure. Mol Pharmacol 9. Bartuzi D, Kaczor AA, Matosiuk D (2015)
86:463–478. https://doi.org/10.1124/mol. Activation and allosteric modulation of
114.094342 human μ opioid receptor in molecular dynam-
2. Sekercioglu N, Busse JW, Mustafa RA et al ics. J Chem Inf Model 55:2421–2434.
(2016) Cinacalcet versus standard treatment https://doi.org/10.1021/acs.jcim.5b00280
for chronic kidney disease: a protocol for a 10. Sadiq SK, Guixa-Gonzalez R, Dainese E et al
systematic review and meta-analysis. Syst Rev (2013) Molecular modeling and simulation of
5:2. https://doi.org/10.1186/s13643-015- membrane lipid-mediated effects on GPCRs.
0177-1 Curr Med Chem 20:22–38
3. Woollard SM, Kanmogne GD (2015) Mara- 11. Guixà-González R, Ramı́rez-Anguita JM,
viroc: a review of its use in HIV infection and Kaczor AA, Selent J (2013) Simulating G
beyond. Drug Des Devel Ther 9:5447–5468. protein-coupled receptors in native-like mem-
https://doi.org/10.2147/DDDT.S90580 branes: from monomers to oligomers. Meth-
4. M€ uller CE, Schiedel AC, Baqi Y (2012) Allo- ods Cell Biol 117:63–90. https://doi.org/
steric modulators of rhodopsin-like G 10.1016/B978-0-12-408143-7.00004-9
protein-coupled receptors: opportunities in 12. Fenton AW (2008) Allostery: an illustrated
drug development. Pharmacol Ther definition for the “second secret of life”.
135:292–315. https://doi.org/10.1016/j. Trends Biochem Sci 33:420–425. https://
pharmthera.2012.06.002 doi.org/10.1016/j.tibs.2008.05.009
5. Valant C, Felder CC, Sexton PM, Christo- 13. Ballesteros JA, Weinstein H (1995)
poulos A (2012) Probe dependence in the [19] integrated methods for the construction
allosteric modulation of a G protein-coupled of three-dimensional models and computa-
receptor: implications for detection and vali- tional probing of structure-function relations
dation of allosteric ligand effects. Mol Phar- in G protein-coupled receptors. In: Sealfon
macol 81:41–52. https://doi.org/10.1124/ SC (ed) Methods neuroscience. Academic
mol.111.074872 Press, San Diego, CA, pp 366–428
6. Schneider S, Provasi D, Filizola M (2016) 14. Livingston KE, Traynor JR (2014) Disrup-
How oliceridine (TRV-130) binds and stabi- tion of the Naþ ion binding site as a mecha-
lizes a μ-opioid receptor conformational state nism for positive allosteric modulation of the
that selectively triggers G protein-signaling mu-opioid receptor. Proc Natl Acad Sci U S A
pathways. Biochemistry (Mosc) 55 111:18369–18374. https://doi.org/10.
(46):6456–6466. https://doi.org/10.1021/ 1073/pnas.1415013111
acs.biochem.6b00948 15. Azzi M, Piñeyro G, Pontier S et al (2001)
7. Rankovic Z, Brust TF, Bohn LM (2016) Allosteric effects of G protein overexpression
Biased agonism: an emerging paradigm in on the binding of beta-adrenergic ligands
GPCR drug discovery. Bioorg Med Chem with distinct inverse efficacies. Mol Pharmacol
Lett 26:241–250. https://doi.org/10. 60:999–1007
1016/j.bmcl.2015.12.024 16. Burstein ES, Spalding TA, Brann MR (1997)
8. Bartuzi D, Kaczor AA, Matosiuk D (2016) Pharmacology of muscarinic receptor sub-
Interplay between two allosteric sites and types constitutively activated by G proteins.
their influence on agonist binding in human Mol Pharmacol 51:312–319
μ opioid receptor. J Chem Inf Model 17. Yan F, Mosier PD, Westkaemper RB, Roth BL
(2008) Galpha-subunits differentially alter
GPCR Allosteric Modulators: Opportunities and Challenges 315
the conformation and agonist affinity of Ca2þsensing receptor. Proc Natl Acad Sci
kappa-opioid receptors. Biochemistry (Mosc) U S A 97:4814–4819
47:1567–1578. https://doi.org/10.1021/ 28. Kerr DIB, Ong J (2003) Potentiation of
bi701476b metabotropic GABAB receptors by L-amino
18. Periole X (2017) Interplay of G protein- acids and dipeptides in rat neocortex. Eur J
coupled receptors with the membrane: Pharmacol 468:103–108
insights from supra-atomic coarse grain 29. Agnati LF, Ferré S, Genedani S et al (2006)
molecular dynamics simulations. Chem Rev Allosteric modulation of dopamine D2 recep-
117:156–185. https://doi.org/10.1021/ tors by homocysteine. J Proteome Res
acs.chemrev.6b00344 5:3077–3083. https://doi.org/10.1021/
19. Zheng Y, Qin L, Zacarı́as NVO et al (2016) pr0601382
Structure of CC chemokine receptor 2 with 30. Molderings GJ, Menzel S, Kathmann M et al
orthosteric and allosteric antagonists. Nature (2000) Dual interaction of agmatine with the
540:458–461. https://doi.org/10.1038/ rat alpha(2D)-adrenoceptor: competitive
nature20605 antagonism and allosteric activation. Br J
20. Oswald C, Rappas M, Kean J et al (2016) Pharmacol 130:1706–1712. https://doi.
Intracellular allosteric antagonism of the org/10.1038/sj.bjp.0703495
CCR9 receptor. Nature 540:462–465. 31. McLatchie LM, Fraser NJ, Main MJ et al
https://doi.org/10.1038/nature20606 (1998) RAMPs regulate the transport and
21. Yuan S, Vogel H, Filipek S (2013) The role of ligand specificity of the calcitonin-receptor-
water and sodium ions in the activation of the like receptor. Nature 393:333–339. https://
μ-opioid receptor. Angew Chem Int Ed Engl doi.org/10.1038/30666
52:10112–10115. https://doi.org/10. 32. Muff R, B€ uhlmann N, Fischer JA, Born W
1002/anie.201302244 (1999) An amylin receptor is revealed follow-
22. Selent J, Sanz F, Pastor M, De Fabritiis G ing co-transfection of a calcitonin receptor
(2010) Induced effects of sodium ions on with receptor activity modifying proteins-1
dopaminergic G-protein coupled receptors. or 3. Endocrinology 140:2924–2927.
PLoS Comput Biol 6(8):e1000884. https:// https://doi.org/10.1210/endo.140.6.6930
doi.org/10.1371/journal.pcbi.1000884 33. Novoselova TV, Jackson D, Campbell DC
23. van der Westhuizen ET, Valant C, Sexton PM, et al (2013) Melanocortin receptor accessory
Christopoulos A (2015) Endogenous alloste- proteins in adrenal gland physiology and
ric modulators of G protein-coupled recep- beyond. J Endocrinol 217:R1–11. https://
tors. J Pharmacol Exp Ther 353:246–260. doi.org/10.1530/JOE-12-0501
https://doi.org/10.1124/jpet.114.221606 34. El Moustaine D, Granier S, Doumazane E
24. Broadhead GK, Mun H, Avlani VA et al et al (2012) Distinct roles of metabotropic
(2011) Allosteric modulation of the calcium- glutamate receptor dimerization in agonist
sensing receptor by gamma-glutamyl pep- activation and G-protein coupling. Proc Natl
tides: inhibition of PTH secretion, suppres- Acad Sci U S A 109:16342–16347. https://
sion of intracellular cAMP levels, and a doi.org/10.1073/pnas.1205838109
common mechanism of action with L-amino 35. White JH, Wise A, Main MJ et al (1998)
acids. J Biol Chem 286:8786–8797. https:// Heterodimerization is required for the forma-
doi.org/10.1074/jbc.M110.149724 tion of a functional GABAB receptor. Nature
25. Ott MC, Mishra RK, Johnson RL (1996) 396:679–682. https://doi.org/10.1038/
Modulation of dopaminergic neurotransmis- 25354
sion in the 6-hydroxydopamine lesioned rota- 36. Schonenbach NS, Hussain S, O’Malley MA
tional model by peptidomimetic analogues of (2015) Structure and function of G protein-
L-prolyl-L-leucyl-glycinamide. Brain Res coupled receptor oligomers: implications for
737:287–291 drug discovery. Wiley Interdiscip Rev
26. Murdoch R, Morecroft I, MacLean MR Nanomed Nanobiotechnol 7:408–427.
(2003) 5-HT moduline: an endogenous https://doi.org/10.1002/wnan.1319
inhibitor of 5-HT(1B/1D)-mediated con- 37. Hasbi A, O’Dowd BF, George SR (2011)
traction in pulmonary arteries. Br J Pharmacol Dopamine D1-D2 receptor heteromer signal-
138:795–800. https://doi.org/10.1038/sj. ing pathway in the brain: emerging physiolog-
bjp.0705123 ical relevance. Mol Brain 4:26. https://doi.
27. Conigrave AD, Quinn SJ, Brown EM (2000) org/10.1186/1756-6606-4-26
L-amino acid sensing by the extracellular 38. Brock C, Oueslati N, Soler S et al (2007)
Activation of a dimeric metabotropic
316 Damian Bartuzi et al.
glutamate receptor by intersubunit rearrange- 48. Pike LJ, Han X, Chung K-N, Gross RW
ment. J Biol Chem 282:33000–33008. (2002) Lipid rafts are enriched in arachidonic
https://doi.org/10.1074/jbc.M702542200 acid and plasmenylethanolamine and their
39. Rivero-M€ uller A, Chou Y-Y, Ji I et al (2010) composition is independent of caveolin-1
Rescue of defective G protein–coupled recep- expression: a quantitative electrospray ioniza-
tor function in vivo by intermolecular cooper- tion/mass spectrometric analysis. Biochemis-
ation. Proc Natl Acad Sci 107:2319–2324. try (Mosc) 41:2075–2088
https://doi.org/10.1073/pnas. 49. Langelier B, Linard A, Bordat C et al (2010)
0906695106 Long chain-polyunsaturated fatty acids mod-
40. Lanzafame AA, Guida E, Christopoulos A ulate membrane phospholipid composition
(2004) Effects of anandamide on the binding and protein localization in lipid rafts of neural
and signaling properties of M1 muscarinic stem cell cultures. J Cell Biochem
acetylcholine receptors. Biochem Pharmacol 110:1356–1364. https://doi.org/10.1002/
68:2207–2219. https://doi.org/10.1016/j. jcb.22652
bcp.2004.08.005 50. Saulière-Nzeh Ndong A, Saulière-Nzeh AN,
41. Lane JR, Beukers MW, Mulder-Krieger T, Millot C et al (2010) Agonist-selective
Ijzerman AP (2010) The endocannabinoid dynamic compartmentalization of human mu
2-arachidonylglycerol is a negative allosteric opioid receptor as revealed by resolutive
modulator of the human A3 adenosine recep- FRAP analysis. J Biol Chem
tor. Biochem Pharmacol 79:48–56. https:// 285:14514–14520. https://doi.org/10.
doi.org/10.1016/j.bcp.2009.07.024 1074/jbc.M109.076695
42. Pamplona FA, Ferreira J, Menezes de Lima O 51. Kaczor AA, Silva AG, Loza MI et al (2016)
et al (2012) Anti-inflammatory lipoxin A4 is Structure-based virtual screening for dopa-
an endogenous allosteric enhancer of CB1 mine D2 receptor ligands as potential antipsy-
cannabinoid receptor. Proc Natl Acad Sci U chotics. ChemMedChem 11:718–729.
S A 109:21134–21139. https://doi.org/10. https://doi.org/10.1002/cmdc.201500599
1073/pnas.1202906109 52. Srivastava A, Yano J, Hirozane Y et al (2014)
43. Prasanna X, Sengupta D, Chattopadhyay A High-resolution structure of the human
(2016) Cholesterol-dependent conforma- GPR40 receptor bound to allosteric agonist
tional plasticity in GPCR dimers. Sci Rep TAK-875. Nature 513:124–127. https://doi.
6:31858. https://doi.org/10.1038/ org/10.1038/nature13494
srep31858 53. Stanley N, Pardo L, Fabritiis GD (2016) The
44. Pluhackova K, Gahbauer S, Kranz F et al pathway of ligand entry from the membrane
(2016) Dynamic cholesterol-conditioned bilayer to a lipid G protein-coupled receptor.
dimerization of the G protein coupled chemo- Sci Rep 6:22639. https://doi.org/10.1038/
kine receptor type 4. PLoS Comput Biol 12: srep22639
e1005169. https://doi.org/10.1371/jour 54. Hurst DP, Schmeisser M, Reggio PH (2013)
nal.pcbi.1005169 Endogenous lipid activated G protein-
45. Marino KA, Prada-Gracia D, Provasi D, Fili- coupled receptors: emerging structural fea-
zola M (2016) Impact of lipid composition tures from crystallography and molecular
and receptor conformation on the spatio- dynamics simulations. Chem Phys Lipids
temporal organization of μ-opioid receptors 169:46–56. https://doi.org/10.1016/j.
in a multi-component plasma membrane chemphyslip.2013.01.009
model. PLoS Comput Biol 12:e1005240. 55. Hanson MA, Roth CB, Jo E et al (2012)
https://doi.org/10.1371/journal.pcbi. Crystal structure of a lipid G protein-coupled
1005240 receptor. Science 335:851–855. https://doi.
46. Koldsø H, Reddy T, Fowler PW et al (2016) org/10.1126/science.1215904
Membrane compartmentalization reducing 56. Hertig S, Latorraca NR, Dror RO (2016)
the mobility of lipids and proteins within a Revealing atomic-level mechanisms of protein
model plasma membrane. J Phys Chem B allostery with molecular dynamics simula-
120:8873–8881. https://doi.org/10.1021/ tions. PLoS Comput Biol 12:e1004746.
acs.jpcb.6b05846 https://doi.org/10.1371/journal.pcbi.
47. Dawaliby R, Trubbia C, Delporte C et al 1004746
(2016) Allosteric regulation of GPCR activity 57. Wassman CD, Baronio R, Demir Ö et al
by phospholipids. Nat Chem Biol 12:35–39. (2013) Computational identification of a
https://doi.org/10.1038/nchembio.1960 transiently open L1/S3 pocket for
GPCR Allosteric Modulators: Opportunities and Challenges 317
hM1 muscarinic receptor. J Biol Chem 105. Mueller R, Dawson ES, Niswender CM et al
286:31661–31675. https://doi.org/10. (2012) Iterative experimental and virtual
1074/jbc.M111.261404 high-throughput screening identifies metabo-
99. Ragnarsson L, Wang C-IA, Andersson Å et al tropic glutamate receptor subtype 4 positive
(2013) Conopeptide ρ-TIA defines a new allosteric modulators. J Mol Model
allosteric site on the extracellular surface of 18:4437–4446. https://doi.org/10.1007/
the α1B-adrenoceptor. J Biol Chem s00894-012-1441-0
288:1814–1827. https://doi.org/10.1074/ 106. Mueller R, Rodriguez AL, Dawson ES et al
jbc.M112.430785 (2010) Identification of metabotropic gluta-
100. Mukund S, Shang Y, Clarke HJ et al (2013) mate receptor subtype 5 potentiators using
Inhibitory mechanism of an allosteric anti- virtual high-throughput screening. ACS
body targeting the glucagon receptor. J Biol Chem Neurosci 1:288–305. https://doi.
Chem 288:36168–36178. https://doi.org/ org/10.1021/cn9000389
10.1074/jbc.M113.496984 107. Mueller R, Dawson ES, Meiler J et al (2012)
101. Lane JR, Chubukov P, Liu W et al (2013) Discovery of 2-(2-benzoxazoyl amino)-4-
Structure-based ligand discovery targeting aryl-5-cyanopyrimidine as negative allosteric
orthosteric and allosteric pockets of dopa- modulators (NAMs) of metabotropic gluta-
mine receptors. Mol Pharmacol mate receptor 5 (mGlμ5): from an artificial
84:794–807. https://doi.org/10.1124/ neural network virtual screen to an in vivo
mol.113.088054 tool compound. ChemMedChem
102. de Graaf C, Rein C, Piwnica D et al (2011) 7:406–414. https://doi.org/10.1002/
Structure-based discovery of allosteric modu- cmdc.201100510
lators of two related class B G-protein-cou- 108. Omer A, Prasad CS (2012) Designing alloste-
pled receptors. ChemMedChem ric modulators for active conformational state
6:2159–2169. https://doi.org/10.1002/ of m-glutamate G-protein coupled receptors.
cmdc.201100317 Bioinformation 8:170–174. https://doi.org/
103. Kubas H, Meyer U, Krueger B et al (2013) 10.6026/97320630008170
Discovery, synthesis, and structure-activity 109. Jang JW, Cho N-C, Min S-J et al (2016)
relationships of 2-aminoquinazoline deriva- Novel scaffold identification of mGlu1 recep-
tives as a novel class of metabotropic gluta- tor negative allosteric modulators using a
mate receptor 5 negative allosteric hierarchical virtual screening approach.
modulators. Bioorg Med Chem Lett Chem Biol Drug Des 87:239–256. https://
23:4493–4500. https://doi.org/10.1016/j. doi.org/10.1111/cbdd.12654
bmcl.2013.06.049 110. Jiang L, Zhang X, Chen X et al (2015) Virtual
104. Noeske T, Jirgensons A, Starchenkovs I et al screening and molecular dynamics study of
(2007) Virtual screening for selective alloste- potential negative allosteric modulators of
ric mGluR1 antagonists and structure-activity mGluR1 from Chinese herbs. Molecules
relationship investigations for coumarine 20:12769–12786. https://doi.org/10.
derivatives. ChemMedChem 2:1763–1773. 3390/molecules200712769
https://doi.org/10.1002/cmdc.200700151
Chapter 14
Abstract
The observation of biased agonism in G protein-coupled receptors (GPCRs) has provided new approaches
for the development of more efficacious and safer drugs. However, in order to rationally design biased
drugs, one must understand the molecular basis of this phenomenon. Computational approaches can help
in exploring the conformational universe of GPCRs and detecting conformational states with relevance for
distinct functional outcomes. This information is extremely valuable for the development of new therapeu-
tic agents that promote desired conformational receptor states and responses while avoiding the ones
leading to undesired side-effects.
This book chapter intends to introduce the reader to powerful computational approaches for sampling
the conformational space of these receptors, focusing first on molecular dynamics and the analysis of the
produced data through methods such as dimensionality reduction, Markov State Models and adaptive
sampling. Then, we show how to seek for compounds that target distinct conformational states via docking
and virtual screening. In addition, we describe how to detect receptor-ligand interactions that drive
signaling bias and comment current challenges and opportunities of presented methods.
Key words G protein-coupled receptor, Receptor plasticity, Conformational space, Signaling bias,
Drug discovery
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_14, © Springer Science+Business Media LLC 2018
321
322 Ismael Rodrı́guez-Espigares et al.
2.2 Markov State Although dimensionality reduction methods are useful in MD anal-
Models and Adaptive ysis, they have problems when obtaining long-living relevant meta-
Sampling stable states from the protein conformational space as they cannot
confirm their energy landscape convergence. Grossfield et al. have
studied the convergence of PCA on membrane proteins, especially
GPCRs, and they concluded that 26 simulations of 100 ns are not
324 Ismael Rodrı́guez-Espigares et al.
Fig. 1 Workflow of GPCR conformational analysis via MSM and adaptive sampling methods. (a) 3D represen-
tation of GPCR structural model backbone and residues selected for their study through MSM. (b) Relevant
reaction coordinates are obtained from MD simulation of the GPCR model. (c) Bidimensional histogram of two
first IC obtained from dimensionality reduction of reaction coordinates. (d) Discretization of reaction coordi-
nates or relevant ICs obtained in dimensionality reduction. (e) Example of discretized trajectories. (f)
Connectivity between the different clusters/states (nodes, d–e) of the build MSM. Equilibrium probabilities
shown in a color-scale from blue to red. (g) States with high probability membership at coarse-grained states
(macro-states) obtained from PCCAþ. (h) Chapman-Kolmogorov test for transition probability from macro-
state S4 to itself. Transition matrix propagation (green) against estimated from MD data with standard error
bars (blue). (i) Kinetic model obtained by TPT analysis. Equilibrium probabilities of macro-states as node width.
Arrow width is proportional to net fluxes between macro-states. (j) Adaptive sampling is initiated if more input
data from MD is needed for MSM convergence. Reproduced from Rodrı́guez-Espigares, I., Kaczor, A. A., and
Selent, J. (2016). In silico Exploration of the Conformational Universe of GPCRs. Molecular Informatics, 35
(6–7), 227–237
326 Ismael Rodrı́guez-Espigares et al.
There are two recent examples where MSM have been applied
to explore the GPCR conformational space. Kohlhoff et al. [28]
simulated the β2AR starting from active (PDB ID: 3P0G) and
inactive (PDB ID: 2RH1) conformations, in complex with both
an agonist (BI-167107) and an inverse-agonist (carazolol) as well as
in its apoform and analyzed them with MSM generating several
metastable states that were used as targets for virtual screening.
In another study, Bai et al. applied MSM to study the inactiva-
tion of the β2AR-G-protein complex (PDB ID: 3SN6) by the
inverse-agonist ICI118,551 focusing on the formation of a water
channel in the receptor interior related to receptor activation [10].
All in all, these examples highlight the usefulness of applying
MSM for exploring the conformational space of GPCRs.
Fig. 2 Identification of biased ligands using virtual screening and de novo design
virtual screening and docking studies with both active and inactive
state models of serotonin 5-HT1A receptors identifying agonist-like
and antagonist-like compounds. Molecular docking can be also
supported by using protein-ligand interaction fingerprints (IFPs)
to post-process the docking poses as it was done by Kooistra et al.
[42] for adrenergic β1 and β2 receptors. Finally, de novo design
techniques can be applied to develop novel ligands as it was done
for novel selective nanomolar and ligand-efficient serotonin
5-HT2B receptor ligands [43].
In summary, molecular docking and subsequent successful
structure-based virtual screening to identify biased ligands of
GPCRs require the availability of appropiate receptor conforma-
tions responsible for functional selectivity. When an adequate
receptor X-ray structure is not available, molecular dynamics sup-
ported by experimental data can be used to adjust receptor confor-
mation. It can be expected that more and more successful
applications of molecular docking, in particular high-throughput
docking to identify functionally selective ligands, will be reported in
next years along with new X-ray structures, new site-directed muta-
genesis data and development of molecular dynamics techniques.
Acknowledgments
References
1. Martı́-Solano M, Guixà-González R, Sanz F 8. Lange OF, Grubm€ uller H (2006) Generalized
et al (2013) Novel insights into biased agonism correlation for biomolecular dynamics. Pro-
at G protein-coupled receptors and their teins 62:1053–1061. https://doi.org/10.
potential for drug design. Curr Pharm Des 1002/prot.20784
19:5156–5166 9. Teodoro ML, Phillips GN, Kavraki LE (2003)
2. Violin JD, Dewire SM, Yamashita D et al Understanding protein flexibility through
(2010) Selectively engaging B-arrestins at the dimensionality reduction. J Comput Biol
angiotensin II type 1 receptor reduces blood 10:617–634. https://doi.org/10.1089/
pressure and increases cardiac performance. 10665270360688228
Pharmacol Ther 335:572–579. https://doi. 10. Bai Q, Pérez-Sánchez H, Zhang Y et al (2014)
org/10.1124/jpet.110.173005 Ligand induced change of β2 adrenergic recep-
3. Rosenbaum DM, Cherezov V, Hanson MA tor from active to inactive conformation and its
et al (2007) GPCR engineering yields high- implication for the closed/open state of the
resolution structural insights into water channel: insight from molecular dynam-
2-adrenergic receptor function. Science ics simulation, free energy calculation and Mar-
318:1266–1273. https://doi.org/10.1126/ kov state model analysis. Phys Chem Chem
science.1150609 Phys 16:15874–15885. https://doi.org/10.
4. Kang Y, Zhou XE, Gao X et al (2015) Crystal 1039/c4cp01185f
structure of rhodopsin bound to arrestin by 11. Ng HW, Laughton CA, Doughty SW (2013)
femtosecond X-ray laser. Nature Molecular dynamics simulations of the adeno-
523:561–567. https://doi.org/10.1038/ sine A2a receptor: structural stability, sampling,
nature14656 and convergence. J Chem Inf Model
5. Rodrı́guez-Espigares I, Kaczor AA, Selent J 53:1168–1178. https://doi.org/10.1021/
(2016) In silico exploration of the conforma- ci300610w
tional universe of GPCRs. Mol Inform 12. Pérez-Hernández G, Paul F, Giorgino T et al
35:227–237. https://doi.org/10.1002/minf. (2013) Identification of slow molecular order
201600012 parameters for Markov model construction. J
6. Altis A, Nguyen PH, Hegger R, Stock G Chem Phys 139:15102. https://doi.org/10.
(2007) Dihedral angle principal component 1063/1.4811489
analysis of molecular dynamics simulations. J 13. Scherer MK, Trendelkamp-Schroer B, Paul F et
Chem Phys 126:244111. https://doi.org/10. al (2015) PyEMMA 2: a software package for
1063/1.2746330 estimation, validation, and analysis of Markov
7. Brown WM, Martin S, Pollock SN et al (2008) models. J Chem Theory Comput
Algorithmic dimensionality reduction for 11:5525–5542. https://doi.org/10.1021/
molecular structure analysis. J Chem Phys acs.jctc.5b00743
129:64118
Drug Discovery of Bias Ligands 333
14. Razavi AM, Wuest WM, Voelz VA (2014) 26. Bowman GR, Ensign DL, Pande VS (2010)
Computational screening and selection of Enhanced modeling via network theory: adap-
cyclic peptide hairpin mimetics by molecular tive sampling of Markov state models. J Chem
simulation and kinetic network models. J Theory Comput 6:787–794. https://doi.org/
Chem Inf Model 54:1425–1432. https://doi. 10.1021/ct900620b
org/10.1021/ci500102y 27. Doerr S, Harvey MJ, Noé F, De Fabritiis G
15. Grossfield A, Feller SE, Pitman MC (2007) (2016) HTMD: high-throughput molecular
Convergence of molecular dynamics simula- dynamics for molecular discovery. J Chem The-
tions of membrane proteins. Proteins ory Comput 12:1845–1852. https://doi.org/
67:31–40. https://doi.org/10.1002/prot. 10.1021/acs.jctc.6b00049
21308 28. Kohlhoff KJ, Shukla D, Lawrenz M et al
16. Hartigan AJ (1975) Clustering algorithms. (2013) Cloud-based simulations on Google
John Wiley & Sons, Inc, Hoboken, NJ Exacycle reveal ligand modulation of GPCR
17. Prinz J-H, Wu H, Sarich M et al (2011) Mar- activation pathways. Nat Chem 6:15–21.
kov models of molecular kinetics: generation https://doi.org/10.1038/nchem.1821
and validation. J Chem Phys 134:174105. 29. Bruno A, Costantino G (2012) Molecular
https://doi.org/10.1063/1.3565032 dynamics simulations of G protein-coupled
18. Arthur D, Vassilvitskii S (2007) K-meansþþ: receptors. Mol Inform 31:222–230. https://
the advantages of careful seeding. In: Proceed- doi.org/10.1002/minf.201100138
ings of the Eighteenth Annual ACM-SIAM 30. Kufareva I, Katritch V, Participants of GPCR
Symposium on Discrete Algorithms. Society Dock 2013 et al (2014) Advances in GPCR
for Industrial and Applied Mathematics, Phila- modeling evaluated by the GPCR Dock 2013
delphia, PA, pp 1027–1035 assessment: meeting new challenges. Structure
19. Sculley D (2010) Web-scale k-means cluster- 22:1120–1139. https://doi.org/10.1016/j.
ing. In: Proceedings of the 19th international str.2014.06.012
conference on World wide web–WWW ‘10. 31. Woo AY-H, Jozwiak K, Toll L et al (2014)
ACM Press, New York, NY, p 1177 Tyrosine 308 is necessary for ligand-directed
20. Pande VS, Beauchamp K, Bowman GR (2010) Gs protein-biased signaling of β2-adrenocep-
Everything you wanted to know about Markov tor. J Biol Chem 289:19351–19363. https://
state models but were afraid to ask. Methods doi.org/10.1074/jbc.M114.558882
52:99–105. https://doi.org/10.1016/j. 32. Zhang H, Unal H, Desnoyer R et al (2015)
ymeth.2010.06.002 Structural basis for ligand recognition and
21. Röblitz S, Weber M (2013) Fuzzy spectral functional selectivity at angiotensin receptor. J
clustering by PCCAþ: application to Markov Biol Chem 290:29127–29139. https://doi.
state models and data classification. Adv Data org/10.1074/jbc.M115.689000
Anal Classif 7:147–179. https://doi.org/10. 33. Weichert D, Banerjee A, Hiller C et al (2015)
1007/s11634-013-0134-6 Molecular determinants of biased agonism at
22. Noé F, Sch€ utte C, Vanden-Eijnden E et al the dopamine D2 receptor. J Med Chem
(2009) Constructing the equilibrium ensemble 58:2703–2717. https://doi.org/10.1021/
of folding pathways from short off-equilibrium jm501889t
simulations. Proc Natl Acad Sci U S A 34. Manglik A, Lin H, Aryal DK et al (2016)
106:19011–19016. https://doi.org/10. Structure-based discovery of opioid analgesics
1073/pnas.0905466106 with reduced side effects. Nature
23. Swope WC, Pitera JW, Suits F (2004) Describ- 537:185–190. https://doi.org/10.1038/
ing protein folding kinetics by molecular nature19112
dynamics simulations. 1. Theory. J Phys 35. Kaczor AA, Rutkowska E, Bartuzi D et al
Chem B 108:6571–6581. https://doi.org/ (2016) Chapter 17 – computational methods
10.1021/jp037421y for studying G protein-coupled receptors
24. Park S, Pande VS (2006) Validation of Markov (GPCRs). Methods Cell Biol 132:359–399.
state models using Shannon’s entropy. J Chem https://doi.org/10.1016/bs.mcb.2015.11.
Phys 124:54118. https://doi.org/10.1063/1. 002
2166393 36. Topiol S, Sabio M (2015) The role of experi-
25. Bacallado S, Chodera JD, Pande V (2009) mental and computational structural
Bayesian comparison of Markov models of approaches in 7TM drug discovery. Expert
molecular dynamics with detailed balance con- Opin Drug Discovery 10:1071–1084.
straint. J Chem Phys 131:45106. https://doi. https://doi.org/10.1517/17460441.2015.
org/10.1063/1.3192309 1072166
334 Ismael Rodrı́guez-Espigares et al.
37. Costanzi S (2014) Modeling G protein- 48. Berg KA, Stout BD, Cropper JD et al (1999)
coupled receptors in complex with biased ago- Novel actions of inverse agonists on 5-HT2C
nists. Trends Pharmacol Sci 35:277–283. receptor systems. Mol Pharmacol 55
https://doi.org/10.1016/j.tips.2014.04.004 (5):863–872
38. Tarcsay A, Paragi G, Vass M et al (2013) The 49. Kurita M, Holloway T, Garcı́a-Bea A et al
impact of molecular dynamics sampling on the (2012) HDAC2 regulates atypical antipsy-
performance of virtual screening against chotic responses through the modulation of
GPCRs. J Chem Inf Model 53:2990–2999. mGlu2 promoter activity. Nat Neurosci
https://doi.org/10.1021/ci400087b 15:1245–1254. https://doi.org/10.1038/
39. Bhattacharya S, Vaidehi N (2010) Computa- nn.3181
tional mapping of the conformational transi- 50. Hertig S, Latorraca NR, Dror RO (2016)
tions in agonist selective pathways of a Revealing atomic-level mechanisms of protein
G-protein coupled receptor. J Am Chem Soc allostery with molecular dynamics simulations.
132:5205–5214. https://doi.org/10.1021/ PLoS Comput Biol 12:e1004746. https://doi.
ja910700y org/10.1371/journal.pcbi.1004746
40. Kakarala KK, Jamil K (2016) Biased signaling: 51. Glykos NM (2006) Software news and updates
potential agonist and antagonist of PAR2. J carma: a molecular dynamics analysis program.
Biomol Struct Dyn 34:1363–1376. https:// J Comput Chem 27:1765–1768. https://doi.
doi.org/10.1080/07391102.2015.1079556 org/10.1002/jcc.20482
41. Gandhimathi A, Sowdhamini R (2015) Molec- 52. Koukos PI, Glykos NM (2013) Grcarma: a
ular modelling of human 5-hydroxytryptamine fully automated task-oriented interface for the
receptor (5-HT 2A ) and virtual screening analysis of molecular dynamics trajectories. J
studies towards the identification of agonist Comput Chem 34:2310–2312. https://doi.
and antagonist molecules. J Biomol Struct org/10.1002/jcc.23381
Dyn 34(5):952–970. https://doi.org/10. 53. Humphrey W, Dalke A, Schulten K (1996)
1080/07391102.2015.1062802 VMD: visual molecular dynamics. J Mol
42. Kooistra AJ, Roumen L, Leurs R et al (2013) Graph 14:33–38. https://doi.org/10.1016/
From heptahelical bundle to hits from the hay- 0263-7855(96)00018-5
stack: structure-based virtual screening for 54. Schneider S, Provasi D, Filizola M (2016) How
GPCR ligands. In: Conn PM (ed) G protein oliceridine (TRV-130) binds and stabilizes a
coupled receptors modeling, activation, inter- μ-opioid receptor conformational state that
actions and virtual screening. Academic Press, selectively triggers G protein signaling path-
New York, pp 279–336 ways. Biochemistry 55:6456–6466. https://
43. Rodrigues T, Hauser N, Reker D et al (2015) doi.org/10.1021/acs.biochem.6b00948
Multidimensional de novo design reveals 55. Perez A, Morrone JA, Simmerling C, Dill KA
5-HT2B receptor-selective ligands. Angew (2016) Advances in free-energy-based simula-
Chem Int Ed Engl 54(5):1551. https://doi. tions of protein folding and ligand binding.
org/10.1002/anie.201410201 Curr Opin Struct Biol 36:25–31. https://doi.
44. Marti-Solano M, Iglesias A, de Fabritiis G et al org/10.1016/j.sbi.2015.12.002
(2015) Detection of new biased agonists for 56. Barducci A, Bonomi M, Parrinello M (2011)
the serotonin 5-HT2A receptor: modeling Metadynamics. WIRE Comput Mol Sci
and experimental validation. Mol Pharmacol 1:826–843. https://doi.org/10.1002/wcms.
87:740–746. https://doi.org/10.1124/mol. 31
114.097022 57. Hamelberg D, Mongan J, McCammon JA
45. Nichols DE (2004) Hallucinogens. Pharmacol (2004) Accelerated molecular dynamics: a
Ther 101:131–181. https://doi.org/10. promising and efficient simulation method for
1016/j.pharmthera.2003.11.002 biomolecules. J Chem Phys
46. Meltzer H (1999) The role of serotonin in 120:11919–11929. https://doi.org/10.
antipsychotic drug action. Neuropsychophar- 1063/1.1755656
macology 21:106S–115S. https://doi.org/ 58. Miao Y, McCammon JA (2016) G-protein
10.1016/S0893-133X(99)00046-9 coupled receptors: advances in simulation and
47. González-Maeso J, Sealfon SC (2009) Psyche- drug discovery. Curr Opin Struct Biol
delics and schizophrenia. Trends Neurosci 41:83–89. https://doi.org/10.1016/j.sbi.
32:225–232. https://doi.org/10.1016/j.tins. 2016.06.008
2008.12.005
Chapter 15
Abstract
There is a substantial amount of historical ligand binding data available from site-directed mutagenesis
(SDM) studies of many different GPCR subtypes. This information was generated prior to the wave of
GPCR crystal structure, in an effort to understand ligand binding with a view to drug discovery. Concerted
efforts to determine the atomic structure of GPCRs have proven extremely successful and there are now
more than 80 GPCR crystal structure in the PDB database, many of which have been obtained in the
presence of receptor ligands and associated G proteins. These structural data enable the generation of
computational model structures for all GPCRs, including those for which crystal structures do not yet exist.
The power of these models in designing novel ligands, especially those with improved residence times, and
for better understanding receptor function can be enhanced tremendously by combining them synergisti-
cally with historic SDM ligand binding data. Here, we describe a protocol by which historic SDM binding
data and receptor models may be used together to identify novel key residues for mutagenesis studies.
Key words GPCRs, Adenosine receptors, Homology modeling, Ligand binding, Binding kinetics,
Receptor, Site-directed mutagenesis
1 Introduction
1.1 Site-Directed Despite their shared seven transmembrane helix structure, GPCRs
Mutagenesis (SDM) recognize a wide array of ligands in many different signaling path-
Binding Studies ways [1]. Ligand specificity stems from sequence variance between
receptors, at key residues. The mechanism of specificity is important
to understand so that structure-based drug design can achieve high
efficacy and avoid off-target side effects. To determine these key
amino acid residues, site-directed mutagenesis (SDM) studies are
performed. By comparing binding values for mutant compared to
wild-type receptors, the influence of a given residue on ligand
binding affinity or kinetics can be determined. Many mutagenesis
studies have been conducted in a shotgun approach, but careful
targeting of informative mutations for these experiments will
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_15, © Springer Science+Business Media LLC 2018
335
336 Andrew Potterton et al.
1.2 Using GPCR Advances in techniques that stabilize GPCRs, which have many
Models to Elucidate different conformations, have allowed a greater number of these
Binding receptors to be crystallized [4]. Further, these stabilization meth-
ods have enable receptors to be cocrystallized, generating struc-
tures with agonist bound to the receptor [5]. These methods
involve specific thermostabilizing mutations and often include the
engineering of a fusion domain between transmembrane helix
5 and 6. If these modifications are restored to the wild-type resi-
dues, homology modeling can be used to further increase the
number of receptors for which accurate models can be obtained.
In homology modeling, the model of the receptor is largely treated
as static during drug docking, ignoring ligand flexibility and any
conformational changes that could take place upon ligand binding.
The loop regions, particularly extracellular loop 2, have been found
to be involved in ligand binding [6], causing a problem for tradi-
tional GPCR homology modeling as the loop regions tend to be
inaccurately predicted. Hierarchical GPCR modeling protocol
(HGMP), described in Chapter 19, is a more advanced modeling
workflow that addresses these problems.
The use of residue engineering and the introduction of
non-GPCR sequences to stabilize receptors for improved crystalli-
zation means that computational models based on crystal structure
are the best means of exploring structure-function relationships for
GPCRs. Using accurate models allows the mutagenesis data to be
put in the 3D context of the binding site, allowing for indirect
interactions to be more easily noted. For the A2A adenosine recep-
tor, viewing mutagenesis studies in the context of a model has
enabled the identification of a hydrophobic pocket, which holds
the adenine ring of agonists [7]. Historic mutagenesis binding data,
therefore, when explored in the context of a computational model
can be of great help in understanding ligand binding at the atomic
level.
GPCR Modelling and SDM 337
2 Methods
2.1 Models Can The overall process of this workflow is outlined in Fig. 1. The first
Inform Which Residues stage of a SDM binding experiment is to plan which residues to
to Mutate mutate, something that requires careful attention in order to maxi-
mize the amount of information that can be obtained. Identifica-
tion of a suitable model, either crystal or homology, should be used
as a starting point in planning:
1. Search for a crystal structure for the GPCR to be studied, using
the PDB [8].
(a) If there are multiple entries for the receptor, make a quick
table comparing the resolution, the ligand bound, if any,
and any crystallization techniques that may have altered
Fig. 1 Flow diagram of a simplified version of the methodology detailed in this chapter. Diamond-shaped
boxes represent decisions that need to be made and the rounded rectangle boxes represent inputs that help
carry out a task
338 Andrew Potterton et al.
2.2 Selecting Tailoring the selection of ligands for each mutagenesis study will
Ligands for Binding maximize the information gained from the binding experiments.
Studies Using Models Four ligands are usually selected for a mutagenesis study that is
and SDM Binding Data intended to determine whether a residue interacts with a specific
category of ligand. For radioligand binding studies, at least one of
the ligands must be available as a radiolabeled ligand to allow for
340 Andrew Potterton et al.
2.3 Models After mutagenesis binding studies have been performed, the results
and Historic SDM should be analyzed in conjunction with models of the receptor to
Binding Data Add gain a more informed understanding of the nature of the binding
Value to the Analyses and the changes that mutagenesis elicits. One should similarly
of New SDM Binding evaluate any existing historic mutagenesis data with a view to
Experiments integrating all sources of information needed to put the recently
obtained results in context. This will allow for a comprehensive 3D
analysis of binding.
1. Gather all mutagenesis binding study data for the receptor of
interest. To find previous mutagenesis data for a given receptor,
one can use GPCRdb’s mutation browser: http://gpcrdb.org/
mutations/ [16]. This will show details of all the mutants that
have been made in a specified receptor which can be made into
a database. The entries of the database must be checked to
indicate whether the mutation was made as part of a binding
study or if it was mutated for some other purpose, these latter
entries should be removed. The database will allow one to
check for historic data for the residue of interest. After the
removal of nonbinding study data, the ligands used in each
study and the fold differences in ligand binding values to the
mutant compared to the wildtype can be added by searching
the reference associated with each entry. If no mutants have
been made for binding studies with the receptor of interest,
another closely related receptor can be used. In these cases, the
models of the two receptors should be superimposed (see Note
4), to check for equivalent residues.
2. Map the historic mutagenesis study results to the models of the
receptors that have the ligands used in the binding study
docked. This can be done by editing the color of residues that
have significantly different binding values for a given ligand
using a molecular visualization software package, such as
PyMOL or Chimera. The current experimental results should
also be mapped to the model.
3. Check the position of the residue that has been mutated in
comparison with other residues that are colored because of a
GPCR Modelling and SDM 341
Fig. 2 A model of the A2A adenosine receptor with SDM binding data for NECA mapped, using the methodology
described in this protocol. Residues, which when mutated have significantly different binding affinity value
compared to the wildtype, are colored in pink and are in stick representation. NECA, the ligand, is also shown
in stick representation and is tan colored
2.4 SDM Data Can Be Docking a ligand into a receptor results in many distinct docking
Used to Select poses. Selection of the correct pose from the list of docked posi-
a Docking Pose tions can be tricky as the only selection criterion given is an arbitrary
docking score. Using the following methodology, SDM binding
data can give experimental validation for the selection of a given
pose:
1. Work out the binding pocket of the GPCR. This can be done
by looking at the locations of mutagenesis binding studies with
significant results for that ligand, or if those data are not
available, use any ligand for which data exist. This will give a
quick selection criterion that should halve the number of dock-
ing results.
2. Check that key interactions, predicted using SDM binding data
and the methodology detailed in Subheading 2.3, are possible
in each docked pose. Hydrogen bond predictor tools can be
useful to help determine this but it is important to remember
that the receptor is flexible, which is something that is not
accounted for in docking.
3. Make certain that the orientation of the ligand corresponds to
most the significant mutagenesis binding studies data; these
significant residues can be colored so that they can be easily
identified.
3 Notes
Acknowledgments
References
1. Marinissen MJ, Gutkind JS (2001) G-protein- 10. Ballesteros J, Weinstein H (1995) Integrated
coupled receptors and signaling networks: methods for the construction of three-
emerging paradigms. Trends Pharmacol Sci dimensional models and computational prob-
22:368–376. https://doi.org/10.1016/ ing of structure-function relations in G
S0165-6147(00)01678-3 protein-coupled receptors. Methods Neurosci
2. Fredholm BB, IJzerman AP, Jacobson KA et al 25:366–428. https://doi.org/10.1016/
(2001) International Union of Pharmacology. S1043-9471(05)80049-7
XXV. Nomenclature and classification of aden- 11. Chemical Computing Group Inc. (2017)
osine receptors. Pharmacol Rev 53:527–552. Molecular operating Environement (MOE).,
https://doi.org/10.1124/pr.110.003285.1 Version 2015.10
3. Franchetti P, Cappellacci L, Marchetti S et al 12. Notredame C, Higgins DG, Heringa J (2000)
(1998) 20 -C-methyl analogues of selective T-coffee: a novel method for fast and accurate
adenosine receptor agonists: synthesis and multiple sequence alignment. J Mol Biol
binding studies. J Med Chem 41:1708–1715 302:205–217. https://doi.org/10.1006/
4. Heydenreich F, Vuckovic Z, Matkovic M, jmbi.2000.4042
Veprintsev D (2015) Stabilization of G 13. Fiser A, Sali A (2003) MODELLER: genera-
protein-coupled receptors by point mutations. tion and refinement of homology-based pro-
Front Pharmacol 6:1–15. https://doi.org/10. tein structure models. Methods Enzymol
3389/fphar.2015.00082 374:461–491. https://doi.org/10.1016/
5. Lebon G, Bennett K, Jazayeri A, Tate CG S0076-6879(03)74020-8
(2011) Thermostabilisation of an agonist- 14. Schrodinger LLC (2015) The PyMOL molec-
bound conformation of the human adenosine ular graphics system. Version 1.8
A2A receptor. J Mol Biol 409:298–310. 15. Pettersen EF, Goddard TD, Huang CC et al
https://doi.org/10.1016/j.jmb.2011.03.075 (2004) UCSF chimera - a visualization system
6. Nguyen ATN, Baltos J-A, Thomas T et al for exploratory research and analysis. J Comput
(2016) Extracellular loop 2 of the adenosine Chem 25:1605–1612. https://doi.org/10.
A1 receptor has a key role in orthosteric ligand 1002/jcc.20084
affinity and agonist efficacy. Mol Pharmacol 16. Munk C, Isberg V, Mordalski S et al (2016)
90:703–714. https://doi.org/10.1124/mol. GPCRdb: the G protein-coupled receptor
116.105007 database - an introduction. Br J Pharmacol
7. Olah ME, Stiles GL (2000) The role of recep- 16:2195–2207. https://doi.org/10.1111/
tor structure in determining adenosine recep- bph.13509
tor activity. Pharmacol Ther 85:55–75. 17. Kim J, Wess J, van Rhee AM et al (1995) Site-
https://doi.org/10.1016/S0163-7258(99) directed mutagenesis identifies residues
00051-0 involved in ligand recognition in the human
8. Berman HM, Westbrook J, Feng Z et al (2000) A2a adenosine receptor. J Biol Chem
The protein data bank. Nucleic Acids Res 270:13987–13997
28:235–242. https://doi.org/10.1093/nar/ 18. Jiang Q, Rhee AM v, Kim J et al (1996) Hydro-
28.1.235 philic side chains in the third and seventh trans-
9. Carpenter B, Nehmé R, Warne T et al (2016) membrane helical domains of human A2A
Structure of the adenosine A2A receptor adenosine receptors are required for ligand rec-
bound to an engineered G protein. Nature ognition. Mol Pharmacol 50:512–521
536:104–107. https://doi.org/10.1038/
nature18966
Chapter 16
Abstract
The practice of computational chemistry in an industrial setting poses unique opportunities and challenges.
Industrial computational chemists must manage large amounts of data, master modeling software, write
scripts to perform custom calculations, and stay abreast of scientific advances in the field. Just as impor-
tantly, because computational chemists are full partners in the drug discovery effort at companies, in order
to influence and streamline the drug discovery process, they must communicate effectively with medicinal
chemists and other scientists to deliver results of their calculations in a timely fashion. The skills necessary to
play this role require education that emphasizes a combination of chemistry, programming, and communi-
cation skills. Professors are encouraged to incorporate such training in their curriculum.
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_16, © Springer Science+Business Media LLC 2018
345
346 Daniel F. Ortwine
1.1 Data Unlike typical academic settings where data may be available for a
limited number of compounds, the average industrial drug discov-
ery project involves multiple results on hundreds to thousands of
compounds. Data are generated from in vitro assay experiments on
the biological target of interest or specific off-targets, cellular
assays, and in vivo pharmacology experiments in animals. There is
frequently panel screening done against a wide variety of enzymes
and receptors to assess selectivity. Physiochemical measurements
such as log P, solubility, and pKa are obtained. Many compounds
undergo pharmacokinetic evaluation for hepatic stability, perme-
ability, plasma protein binding, and other endpoints. Safety (i.e.,
toxicity) data may also be available. A number of small molecule
and protein Xrays are often available to support structure-based
drug design analyses. As a result, a substantial fraction of an
industrial computational chemist’s time is consumed by data man-
agement, from ensuring timely results are available to the project
teams they support in an easy-to-consume format, to providing
insightful analyses on that data to help drive decision making on
what molecules to synthesize next.
1.4 Integration With access to multiple sources of data and technology in industry,
putting it all together in a form readily accessible to chemists and
other scientists on the project team is essential. Three-dimensional
X-ray and modeling information must be combined with potency
and other data by making all available inside in a unified interface to
permit all aspects of molecules’ and chemical series’ behavior to be
considered when determining trends and what to synthesize next.
Tracking virtually designed compounds, along with the reasons
they were suggested for synthesis, is important [4]. Once tested,
one learns if the hypothesis for the synthesis was correct or wrong
by returning to the tracking tool to see what idea was being tested,
348 Daniel F. Ortwine
1.6 Education Most medicinal chemists perform their own docking and scoring,
and are becoming proficient in understanding physical organic
chemistry principles. The environment is waning where the compu-
tational chemist is asked to dock a chemist’s idea and pass judge-
ment on it, or explain existing structure-activity relationships in
terms of protein-ligand interactions. Concurrently, new scientific
methodology is constantly being developed that requires integra-
tion into a company’s infrastructure. Industrial computational che-
mists are expected to be able to script, know modeling software,
and perhaps generate statistical models. Just as importantly, they
need to be able to communicate the results of their modeling
Computational Support of Medicinal Chemistry in Industrial Settings 349
References
1. Abel R, Mondal S, Masse C, Greenwood J, challenge. Nat Rev Drug Discov 9:203–214.
Harriman G, Ashwell MA, Bhat S, Wester R, https://doi.org/10.1038/nrd3078
Frye L, Kapeller R, Friesner RA (2017) Accel- 6. Warr WA (2017) A CADD-alog of strategies in
erating drug discovery through tight integra- pharma. J Comput Aided Mol Des
tion of expert molecular design and predictive 31:245–247. https://doi.org/10.1007/
scoring. Curr Opin Struct Biol 43:38–44. s10822-017-0017-6
https://doi.org/10.1016/j.sbi.2016.10.007 7. Tsui V, Ortwine DF, Blaney JM (2016)
2. Kuhn B, Tichý M, Wang L, Robinson S, Mar- Enabling drug discovery project decisions
tin RE, Kuglstatter A, Benz J, Giroud M, with integrated computational chemistry and
Schirmeister T, Abel R, Diederich F, Hert J informatics. J Comput Aided Mol Des
(2017) Prospective evaluation of free energy 31:1–5. https://doi.org/10.1007/s10822-
calculations for the prioritization of Cathepsin 016-9988-y
L inhibitors. J Med Chem 60:2485–2497. 8. Miller SM, Moos WH, Munk BH, Munk SA
https://doi.org/10.1021/acs.jmedchem. (2016) Managing the drug discovery process:
6b01881 how to make it more efficient and cost-
3. Gawehn E, Hiss JA, Schneider G (2016) Deep effective. Woodhead Publishing, Elsevier,
learning in drug discovery. Mol Inform United Kingdom
35:3–14. https://doi.org/10.1002/minf. 9. Feng JA, Aliagas I, Bergeron P, Blaney JM,
201501008 Bradley EK, Koehler MFT, Lee M-L, Ortwine
4. Lee M-L, Aliagas I, Dotson J, a Feng J, DF, Tsui V, Wu J, Gobbi A (2015) An
Gobbi A, Heffron T (2012) DEGAS: sharing integrated suite of modeling tools that
and tracking target compound ideas with exter- empower scientists in structure- and property-
nal collaborators. J Chem Inf Model based drug design.J Comput Aided Mol Des
52:278–284. https://doi.org/10.1021/ 29(6):511–523
ci2003297 10. Lee M-L, Aliagas I, Feng JA, Gabriel T,
5. Paul SM, Mytelka DS, Dunwiddie CT, Per- O’Donnell TJ, Sellers BD, Wiswedel B, Gobbi
singer CC, Munos BH, Lindborg SR, Schacht A (2017) chemalot and chemalot_knime:
AL (2010) How to improve R&D productiv- Command line programs as workflow tools
ity: the pharmaceutical industry’s grand for drug discovery. J Chem Inf 9(1)
Chapter 17
Abstract
An increasing number of G protein-coupled receptor (GPCR) crystal structures provide important—albeit
static—pictures of how small molecules or peptides interact with their receptors. These high-resolution
structures represent a tremendous opportunity to apply molecular dynamics (MD) simulations to capture
atomic-level dynamical information that is not easy to obtain experimentally. Understanding ligand binding
and unbinding processes, as well as the related responses of the receptor, is crucial to the design of better
drugs targeting GPCRs. Here, we discuss possible ways to study the dynamics involved in the binding of
small molecules to GPCRs, using long timescale MD simulations or metadynamics-based approaches.
Key words Molecular dynamics, Ligand binding, Small-molecule drugs, GPCRs, Enhanced-sampling
methods, Interaction fingerprints, Allosteric communication
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_17, © Springer Science+Business Media LLC 2018
351
352 Kristen A. Marino and Marta Filizola
2 Materials
3 Methods
3.1 Protein Setup In our recently published work, we used the crystal structures of the
inactive DOR (PDB: 4N6H [33]), inactive MOR (PDB: 4DKL
[34]), and activated MOR (PDB: 5C1M [35]) (see Note 3). First,
with the exception of the crystallographic waters, the non-receptor
atoms, including the ligands, lipids, and some of the proteins
required for crystallization (BRIL for DOR and T4L for inactive
MOR), were removed. Many crystal structures of GPCRs are miss-
ing segments of intracellular or extracellular loops that are too
flexible to be resolved crystallographically or were removed to
insert fusion proteins necessary for crystallization. These segments
such as most of the intracellular loop 3 (ICL3) missing from the
inactive MOR crystal structure (PDB: 4DKL [34]), need to be
built ab initio or modeled by homology using an available, close
template structure, as a reference. In our recently published studies,
we used MODELLER to perform homology modeling of MOR
ICL3 based on the corresponding segment in the ultra-high-
resolution DOR crystal structure (PDB: 4N6H [33]) (see Notes
4 and 5). To crystallize activated forms of GPCRs, G protein
mimetic nanobodies have been used to maintain the
Investigating Molecular Mechanisms of GPCR Ligand Binding 355
3.2 Trajectory To generate binding trajectories and identify the bound pose(s) of
Generation ligands, we have used two approaches in recently published works:
with Unbiased MD (1) long-timescale MD and (2) multiple-walker metadynamics.
Here, we discuss how to set up and run these types of simulations.
Normally, unbiased MD is unable to capture the timescale on
which GPCR ligand binding from the bulk occurs, but thanks to
specially designed hardware, e.g., D. E. Shaw Research’s Anton
supercomputer [38], this problem is partially alleviated. To further
enhance the probability of ligand binding, the concentration of the
ligand is increased in the simulation box instead of only using one
molecule. For example, we added ten TRV-130 molecules to our
recently published simulations [7]. They can be manually placed in
the simulation box using PyMOL [31] at a distance of at least 1 nm
from the receptor. Multiple copies of the system need to be created
to further enhance the probability of a binding event. In the case of
TRV-130, eight starting conformations were generated by ran-
domly assigning initial velocities. The individual MD trajectories
can be run until a binding event occurs or when all ligands are
bound to the membrane. Once a ligand binds to the membrane it is
unlikely to be released back into the bulk during typical timescales
of ligand binding (several microseconds on Anton). For the
356 Kristen A. Marino and Marta Filizola
where rij is the distance between the atoms of the ligand and the
receptor and r0 was set to 5 Å. The same two CVs were biased in our
recently published simulations which predict the binding pose of
kurkinorin [6]. While the starting configuration of the walkers
should be independent of the final results, sampling is more effi-
cient if each walker starts from a different initial structure, including
structures in which the ligand is in the orthosteric binding site as
well as in the bulk. An easy way to generate the starting structures is
to perform a metadynamics simulation in which only CV1 is biased.
To restrict sampling of the ligand in the bulk to the area of interest
(i.e., close to the protein) and prevent the ligand from binding to
the membrane, limits can be placed on the xy-position of the ligand.
Since all replicas in multiple-walker metadynamics experience a
bias, the trajectories must be reweighed to recover the Boltzmann
distribution using, for instance, the method developed by Tiwary
et al. [40]. The reweighting procedure can also be used to recon-
struct the free-energy surface as a function of other CVs to aid in
Investigating Molecular Mechanisms of GPCR Ligand Binding 357
3.4 Clustering To determine representative poses of the bound ligand and meta-
to Identify the Binding stable states, the poses sampled during the simulations are clus-
Pose and Metastable tered. In recently published work [6–8], we have used two types of
States interaction fingerprints, which describe the interactions between
the ligand and the receptor. The first considers the number and
type of ligand-receptor interaction with the interaction type classi-
fied as hydrophobic, polar, or aromatic. The polar interactions can
be direct, between the ligand and the receptor in which the receptor
is either the H-bond donor or acceptor, or water-mediated, in
which one water molecule interacts with both the ligand and recep-
tor at the same time. The aromatic interactions are divided into
π-cation, edge-to-face, and edge-to-edge interactions. In the sec-
ond type of interaction fingerprint, the ligand is divided into frag-
ments and the interactions between the fragments and receptor
residues are clustered regardless of the type of interaction. For
example, TRV-130 was split into four fragments [7]: (1) the
methoxy-thiophene moiety, (2) the pyridine, (3) the 6-oxaspiro
358 Kristen A. Marino and Marta Filizola
Fig. 2 Structure of TRV-130 which shows the four fragments into which the
structure was broken to compute the interaction fingerprints to identify the
ligand bound pose and metastable sites along the binding pathway: (1) the
methoxy-thiophene moiety (yellow), (2) the pyridine moiety (green), (3) the
6-oxaspiro[4.5]decan-9-yl moiety (purple), and (4) the amine moiety (orange).
Adapted with permission from Schneider S, Provasi D, Filizola M (2016) How
oliceridine (TRV-130) binds and stabilizes a mu-opioid receptor conformational
state that selectively triggers G protein signaling pathways. Biochemistry
55 (46):6456–6466. Copyright 2016 American Chemical Society
[4.5]decan-9-yl, and (4) the amine moiety (see Fig. 2). Sometimes,
the definition of which interactions to cluster needs to be extended
based on the problem of interest. For example, since we were only
interested in defining the binding pose of kurkinorin [6], only the
interactions between the ligand and receptor were considered. In
the case of TRV-130, we were interested in the full binding path-
way so interactions between the ligand and lipid headgroups were
considered in addition to those between the ligand and the receptor
since the ligand spent some time outside the extracellular vestibule.
Finally, when determining the binding poses of the PAM BMS-
986187 to DOR [8], the interactions between the PAM and the
orthosteric ligand SNC-80 were also considered since they could
come into contact. Using the Tanimoto dissimilarity coefficient as
the distance metric, we then apply a density-based spatial clustering
of applications with noise (DBSCAN) [41] algorithm to perform
the clustering. This is our currently preferred method since it does
not require the user to input the desired number of clusters as is
necessary, for instance, in k-means clustering. Finally, the free
energy of each cluster is calculated to determine which is the lowest
energy ligand binding pose. The energy is directly proportional to
the population of each cluster for unbiased simulations, but in the
case of the metadynamics simulations, the free energy of a cluster α
is calculated as
Z
F ðs; t Þ
F α ðt Þ ¼ kB Tlog dsexp þ kB T logZ
α kB T
3.5 Characterizing Markov state models (MSM) can be used to derive kinetic informa-
Pathway Connectivity tion from MD simulations and are useful in characterizing transi-
tions between states. While our simulations of TRV-130 binding
[7] were not comprehensive enough to derive converged rate con-
stants, we applied the PyEMMA python library [32] to determine
likely transitions between identified metastable states (see Note 6).
An alternative set of libraries for the construction of MSMs is
MSMBUILDER [42].
A very extensive set of simulations totaling 831 μs was recently
carried out by Stanley et al. [12] to examine the kinetics of binding
of ML056 to S1P1R. Specifically, a first set of 1000 trajectories
totaling 579 μs was followed by two iterations of trajectory
respawning to increase sampling of binding events. From the
kinetic model, the simulations were able to show that the rate-
limiting step of the binding of ML056, which occurs via the
membrane, corresponds to entry into the vestibule region of the
receptor and not to movement into the orthosteric site, an obser-
vation that is consistent with the work by Dror et al. [10].
3.6 Allosteric While a comparison of the inactive and activated crystal structures
Communication of GPCRs can provide some clues as to how communication can
Between travel from the orthosteric binding site to the intracellular side of
the Orthosteric Ligand the receptor, the use of computational analysis methods based on
Binding Site MD simulations of these crystal structures allows an assessment of
and the Intracellular these communication pathways based on dynamics. Extracting rel-
Side of the Receptor evant allosteric pathways from simulations of proteins is a long-
standing problem and a number of approaches have been
developed (see e.g. [43–45] for reviews of these methods). Such
methods have been applied to study various GPCRs, including the
A2A-adenosine receptor [46], β2AR [18], dopamine receptors [47],
luteinizing hormone receptor [48], MOR [7], rhodopsin [49, 50],
and 5HT2A serotonin receptor [51, 52].
We recently applied the N-body Information Theory (NbIT)
analysis [53] of LeVine and Weinstein to study the allosteric com-
munication between the MOR orthosteric binding site and the
intracellular end of the receptor, in the presence of bound TRV-
130 or bound morphine. NbIT provides a more detailed picture of
allosteric communication because it is determined using an infor-
mation theory-based analysis of N-body correlated motions derived
from the configurational entropy of the system rather than simply
pairwise atomic fluctuation correlations from MD.
To compare the allosteric communication between morphine
bound to the activated MOR crystal structure and TRV-130 bound
to activated MOR, we performed three 1 μs simulations for each
ligand/MOR complex. While the nanobody used to crystallize
activated MOR was retained in the simulations of TRV-130 bind-
ing, it was removed to study MOR communication in order to
ensure we captured the communication in the receptor due to only
360 Kristen A. Marino and Marta Filizola
the bound ligand. The first step was to define two sets of residues,
the “transmitting” (T) region and the “receiving” (R) region. The
T residues were selected as those within 5 Å of the ligand in the
initial conformation of the ligand-protein complex. The selected R
residues were those within 5 Å of the nanobody in the activated
MOR crystal structure. Within the NbIT formalism [53], the
mutual information (MI) between the T and R residues is defined as
MI ðT ; RÞ ¼ H ðRÞ þ H ðT Þ H ðR [ T Þ
4 Notes
Acknowledgments
References
1. Kruse AC, Ring AM, Manglik A, Hu J, Hu K, 2. Oswald C, Rappas M, Kean J, Doré AS, Errey
Eitel K, Hubner H, Pardon E, Valant C, Sexton JC, Bennett K, Deflorian F, Christopher JA,
PM, Christopoulos A, Felder CC, Gmeiner P, Jazayeri A, Mason JS, Congreve M, Cooke
Steyaert J, Weis WI, Garcia KC, Wess J, Kobilka RM, Marshall FH (2016) Intracellular alloste-
BK (2013) Activation and allosteric modula- ric antagonism of the CCR9 receptor. Nature
tion of a muscarinic acetylcholine receptor. 540(7633):462–465. https://doi.org/10.
Nature 504(7478):101–106. https://doi. 1038/nature20606
org/10.1038/nature12735
362 Kristen A. Marino and Marta Filizola
3. Zheng Y, Qin L, Zacarı́as NVO, de Vries H, 11. Kruse AC, Hu J, Pan AC, Arlow DH, Rosen-
Han GW, Gustavsson M, Dabros M, Zhao C, baum DM, Rosemond E, Green HF, Liu T,
Cherney RJ, Carter P, Stamos D, Abagyan R, Chae PS, Dror RO, Shaw DE, Weis WI,
Cherezov V, Stevens RC, Ijzerman AP, Heit- Wess J, Kobilka BK (2012) Structure and
man LH, Tebben A, Kufareva I, Handel TM dynamics of the M3 muscarinic acetylcholine
(2016) Structure of CC chemokine receptor receptor. Nature 482:552–556. https://doi.
2 with orthosteric and allosteric antagonists. org/10.1038/nature10867
Nature 540(7633):458–461. https://doi. 12. Stanley N, Pardo L, Fabritiis GD (2016) The
org/10.1038/nature20605 pathway of ligand entry from the membrane
4. Wootten D, Christopoulos A, Sexton PM bilayer to a lipid G protein-coupled receptor.
(2013) Emerging paradigms in GPCR allo- Sci Rep 6:22639. https://doi.org/10.1038/
stery: implications for drug discovery. Nat Rev srep22639
Drug Discov 12(8):630–644. https://doi. 13. Laio A, Parrinello M (2002) Escaping free-
org/10.1038/nrd4052 energy minima. Proc Natl Acad Sci U S A 99
5. DeWire SM, Yamashita DS, Rominger DH, (20):12562–12566. https://doi.org/10.
Liu G, Cowan CL, Graczyk TM, Chen X-T, 1073/pnas.202427399
Pitis PM, Gotchev D, Yuan C, Koblish M, Lark 14. Provasi D, Bortolato A, Filizola M (2009)
MW, Violin JD (2013) A G protein-biased Exploring molecular mechanisms of ligand rec-
ligand at the μ-opioid receptor is potently anal- ognition by opioid receptors with metady-
gesic with reduced gastrointestinal and respira- namics. Biochemistry 48(42):10020–10029.
tory dysfuncation compared with morphine. J https://doi.org/10.1021/bi901494n
Pharmacol Exp Ther 344:708–717. https:// 15. Friesner RA, Murphy RB, Repasky MP, Frye
doi.org/10.1124/jpet.112.201616 LL, Greenwood JR, Halgren TA, Sanschagrin
6. Crowley RS, Riley AP, Sherwood AM, Groer PC, Mainz DT (2006) Extra precision glide:
CE, Shivaperumal N, Biscaia M, Paton K, docking and scoring incorporating a model of
Schneider S, Provasi D, Kivell BM, Filizola M, hydrophobic enclosure for proteinligand
Prisinzano TE (2016) Synthetic studies of neo- complexes. J Med Chem 49(21):6177–6196.
clerodane diterpenes from salvia divinorum: https://doi.org/10.1021/jm051256o
identification of a potent and centrally acting 16. Hamelberg D, Mongan J, McCammon JA
μ opioid analgesic with reduced abuse liability. J (2004) Accelerated molecular dynamics: a
Med Chem 59(24):11027–11038. https:// promising and efficient simulation method for
doi.org/10.1021/acs.jmedchem.6b01235 biomolecules. J Chem Phys 120
7. Schneider S, Provasi D, Filizola M (2016) How (24):11919–11929
oliceridine (TRV-130) binds and stabilizes a 17. Kappel K, Miao Y, McCammon JA (2015)
mu-opioid receptor conformational state that Accelerated molecular dynamics simulations
selectively triggers G protein signaling path- of ligand binding to a muscarinic G-protein-
ways. Biochemistry 55(46):6456–6466. coupled receptor. Q Rev Biophys 48
https://doi.org/10.1021/acs.biochem. (4):479–487. https://doi.org/10.1017/
6b00948 S0033583515000153
8. Shang Y, Yeatman HR, Provasi D, Alt A, 18. Bhattacharya S, Vaidehi N (2014) Differences
Christopoulos A, Canals M, Filizola M (2016) in allosteric communication pipelines in the
Proposed mode of binding and action of posi- inactive and active states of a GPCR. Biophys
tive allosteric modulators at opioid receptors. J 107(2):422–434. https://doi.org/10.1016/
ACS Chem Biol 11(5):1220–1229. https:// j.bpj.2014.06.015
doi.org/10.1021/acschembio.5b00712
19. Miao Y, Nichols SE, Gasper PM, Metzger VT,
9. Dror RO, Green HF, Valant C, Borhani DW, McCammon JA (2013) Activation and
Valcourt JR, Pan AC, Arlow DH, Canals M, dynamic network of the M2 muscarinic recep-
Lane JR, Rahmani R, Baell JB, Sexton PM, tor. Proc Natl Acad Sci U S A 110
Christopoulos A, Shaw DE (2013) Structural (27):10982–10987
basis for modulation of a G-protein-coupled
receptor by allosteric drugs. Nature 503 20. Fiser A, Do RKG, Sali A (2000) Modeling of
(7475):295–299. https://doi.org/10.1038/ loops in protein structures. Protein Sci
nature12595 9:1753–1773
10. Dror RO, Pan AC, Arlow DH, Borhani DW, 21. Rohl CA, Strauss CEM, Chivian D, Baker D
Maragakis P, Shan Y, Xu H, Shaw DE (2011) (2004) Modeling structurally variable regions
Pathway and mechanism of drug binding to G- in homologous proteins with rosetta. Proteins
protein-coupled receptors. Proc Natl Acad Sci 55(3):656–677. https://doi.org/10.1002/
U S A 108(32):13118–13123 prot.10629
Investigating Molecular Mechanisms of GPCR Ligand Binding 363
22. Jo S, Kim T, Iyer VG, Im W (2008) 32. Scherer MK, Trendelkamp-Schroer B, Paul F,
CHARMM-GUI: a web-based graphical user Pérez-Hernández G, Hoffmann M, Plattner N,
interface for CHARMM. J Comput Chem 29 Wehmeyer C, Prinz J-H, Noé F (2015)
(11):1859–1865. https://doi.org/10.1002/ PyEMMA 2: a software package for estimation,
jcc.20945 validation, and analysis of Markov models. J
23. Schmidt TH, Kandt C (2012) LAMBADA and Chem Theory Comput 11(11):5525–5542.
InflateGRO2: efficient membrane alignment https://doi.org/10.1021/acs.jctc.5b00743
and insertion of membrane proteins for molec- 33. Fenalti G, Giguere PM, Katritch V, Huang XP,
ular dynamics simulations. J Chem Inf Model Thompson AA, Cherezov V, Roth BL, Stevens
52(10):2657–2669. https://doi.org/10. RC (2014) Molecular control of delta-opioid
1021/ci3000453 receptor signalling. Nature 506
24. Vanommeslaeghe K, MacKerell AD (2012) (7487):191–196. https://doi.org/10.1038/
Automation of the CHARMM general force nature12944
field (CGenFF) I: bond perception and atom 34. Manglik A, Kruse AC, Kobilka TS, Thian FS,
typing. J Chem Inf Model 52(12):3144–3154. Mathiesen JM, Sunahara RK, Pardo L, Weis
https://doi.org/10.1021/ci300363c WI, Kobilka BK, Granier S (2012) Crystal
25. Vanommeslaeghe K, Raman EP, MacKerell AD structure of the micro-opioid receptor bound
(2012) Automation of the CHARMM general to a morphinan antagonist. Nature 485
force field (CGenFF) II: assignment of bonded (7398):321–326. https://doi.org/10.1038/
parameters and partial atomic charges. J Chem nature10954
Inf Model 52(12):3155–3168. https://doi. 35. Huang W, Manglik A, Venkatakrishnan AJ,
org/10.1021/ci3003649 Laeremans T, Feinberg EN, Sanborn AL,
26. Vanommeslaeghe K, Hatcher E, Acharya C, Kato HE, Livingston KE, Thorsen TS, Kling
Kundu S, Zhong S, Shim J, Darian E, RC, Granier S, Gmeiner P, Husbands SM,
Guvench O, Lopes P, Vorobyov I, Mackerell Traynor JR, Weis WI, Steyaert J, Dror RO,
AD (2010) CHARMM general force field: a Kobilka BK (2015) Structural insights into
force field for drug-like molecules compatible micro-opioid receptor activation. Nature 524
with the CHARMM all-atom additive (7565):315–321. https://doi.org/10.1038/
biological force fields. J Comput Chem 31 nature14886
(4):671–690. https://doi.org/10.1002/jcc. 36. Wu EL, Cheng X, Jo S, Rui H, Song KC,
21367 Davila-Contreras EM, Qi Y, Lee J, Monje-
27. Abraham MJ, Murtola T, Schulz R, Páll S, Galvan V, Venable RM, Klauda JB, Im W
Smith JC, Hess B, Lindahl E (2015) GRO- (2014) CHARMM-GUI membrane builder
MACS: high performance molecular simula- toward realistic biological membrane simula-
tions through multi-level parallelism from tions. J Comput Chem 35(27):1997–2004.
laptops to supercomputers. SoftwareX https://doi.org/10.1002/jcc.23702
1–2:19–25. https://doi.org/10.1016/j.softx. 37. Lee J, Cheng X, Swails JM, Yeom MS, Eastman
2015.06.001 PK, Lemkul JA, Wei S, Buckner J, Jeong JC,
28. Phillips JC, Braun R, Wang W, Gumbart J, Qi Y, Jo S, Pande VS, Case DA, Brooks CL 3rd,
Tajkhorshid E, Villa E, Chipot C, Skeel RD, AD MK Jr, Klauda JB, Im W (2016)
Kalé L, Schulten K (2005) Scalable molecular CHARMM-GUI input generator for NAMD,
dynamics with NAMD. J Comput Chem 26 GROMACS, AMBER, OpenMM, and
(16):1781–1802. https://doi.org/10.1002/ CHARMM/OpenMM simulations using the
jcc.20289 CHARMM36 additive force field. J Chem
29. Tribello GA, Bonomi M, Branduardi D, Theory Comput 12(1):405–413. https://doi.
Camilloni C, Bussi G (2014) PLUMED 2: org/10.1021/acs.jctc.5b00935
new feathers for an old bird. Comput Phys 38. Shaw DE, Deneroff MM, Dror RO, Kuskin JS,
Commun 185(2):604–613. https://doi.org/ Larson RH, Salmon JK, Young C, Batson B,
10.1016/j.cpc.2013.09.018 Bowers KJ, Chao JC, Eastwood MP,
30. Humphrey W, Dalke A, Schulten K (1996) Gagliardo J, Grossman JP, Ho CR, Ierardi DJ,
VMD: visual molecular dynamics. J Mol In K, Jl K, Layman T, Mcleavey C, Moraes MA,
Graph 14(1):33–38. https://doi.org/10. Mueller R, Priest EC, Shan Y, Spengler J,
1016/0263-7855(96)00018-5 Theobald M, Towles B, Wang SC (2008)
Anton, a special-purpose machine for molecu-
31. Delano WL (2002) The PyMOL molecular lar dynamics simulation. Commun ACM 51
graphics system. doi:citeulike-article- (7):91–97. https://doi.org/10.1145/
id:2816763 1364782.1364802
364 Kristen A. Marino and Marta Filizola
39. Raiteri P, Laio A, Gervasio FL, Micheletti C, 47. Michino M, Free RB, Doyle TB, Sibley DR, Shi
Parrinello M (2006) Efficient reconstruction of L (2015) Structural basis for Naþsensitivity
complex free energy landscapes by multiple in dopamine D2 and D3 receptors. Chem
walkers metadynamics. J Phys Chem B 110 Commun 51(41):8618–8621. https://doi.
(8):3533–3539. https://doi.org/10.1021/ org/10.1039/C5CC02204E
jp054359r 48. Angelova K, Felline A, Lee M, Patel M,
40. Tiwary P, Parrinello M (2015) A time- Puett D, Fanelli F (2011) Conserved amino
independent free energy estimator for metady- acids participate in the structure networks
namics. J Phys Chem B 119(3):736–742. deputed to intramolecular communication in
https://doi.org/10.1021/jp504920s the lutropin receptor. Cell Mol Life Sci 68
41. Sander J, Ester M, Kriegel H-P, Xu X (1998) (7):1227–1239. https://doi.org/10.1007/
Density-based clustering in spatial databases: s00018-010-0519-z
the algorithm GDBSCAN and its applications. 49. Kong Y, Karplus M (2007) The signaling path-
Data Min Knowl Disc 2(2):169–194. https:// way of rhodopsin. Structure 15(5):611–623.
doi.org/10.1023/A:1009745219419 https://doi.org/10.1016/j.str.2007.04.002
42. Beauchamp KA, Bowman GR, Lane TJ, 50. Isin B, Schulten K, Tajkhorshid E, Bahar I
Maibaum L, Haque IS, Pande VS (2011) (2008) Mechanism of signal propagation
MSMBuilder2: modeling conformational upon retinal isomerization: insights from
dynamics on the picosecond to millisecond molecular dynamics simulations of rhodopsin
scale. J Chem Theory Comput 7 restrained by normal modes. Biophys J 95
(10):3412–3419. https://doi.org/10.1021/ (2):789–803. https://doi.org/10.1529/
ct200463m biophysj.107.120691
43. Collier G, Ortiz V (2013) Emerging computa- 51. LeVine MV, Perez-Aguilar JM 2014, Weinstein
tional approaches for the study of protein allo- H N-body information theory (NbIT) analysis
stery. Arch Biochem Biophys 538(1):6–15. of rigid-body dynamics in intracellular loop
https://doi.org/10.1016/j.abb.2013.07.025 2 of the 5-HT2A receptor. In: Ortuño F,
44. Feher VA, Durrant JD, Van Wart AT, Amaro Rojas I (eds) International Work-Conference
RE (2014) Computational approaches to on Bioinformatics and Biomedical Engineer-
mapping allosteric pathways. Curr Opin Struct ing, Granada
Biol 25:98–103. https://doi.org/10.1016/j. 52. Perez-Aguilar JM, Shan J, LeVine MV,
sbi.2014.02.004 Khelashvili G, Weinstein H (2014) A func-
45. Stolzenberg S, Michino M, LeVine MV, tional selectivity mechanism at the serotonin-
Weinstein H, Shi L (2016) Computational 2A GPCR involves ligand-dependent confor-
approaches to detect allosteric pathways in mations of intracellular loop 2. J Am Chem
transmembrane molecular machines. Biochim Soc 136(45):16044–16054. https://doi.org/
Biophys Acta 1858(7, Part B):1652–1662. 10.1021/ja508394x
https://doi.org/10.1016/j.bbamem.2016. 53. LeVine MV, Weinstein H (2014) NbIT - a new
01.010 information theory-based analysis of allosteric
46. Fanelli F, Felline A (2011) Dimerization and mechanisms reveals residues that underlie func-
ligand binding affect the structure network of tion in the leucine transporter LeuT. PLoS
A2A adenosine receptor. Biochim Biophys Acta Comput Biol 10(5):e1003603. https://doi.
Biomembr 1808(5):1256–1266. https://doi. org/10.1371/journal.pcbi.1003603
org/10.1016/j.bbamem.2010.08.006
Chapter 18
Abstract
This chapter describes two powerful 3D ligand-based shape similarity and scoring methods called ROCS
and EON, their basic operation and selected validation data. The steps required to prepare a database of
molecules for successful use with ROCS and EON are described and selected examples of their application
in prospective lead discovery experiments are summarized.
Key words Lead discovery, Shape similarity, OMEGA, ROCS, EON, LBLD
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_18, © Springer Science+Business Media LLC 2018
365
366 Paul C.D. Hawkins and Gunther Stahl
2.1 Database Before any lead discovery campaign is undertaken the database of
Preparation molecules to be screened must be appropriately prepared. To gen-
erate a database suitable for use with ROCS tautomer and proton-
ation state(s) must be assigned and 3D conformers generated. For
ligand-based lead discovery methods the assignment of tautomer
and protonation state is often simpler than for structure-based
methods, as ligand-based methods do not depend on having the
correct tautomer or protonation state, but only one consistent state
across all molecules to be screened. It has been shown that genera-
tion of a single, stable tautomer for each molecule in the database
produces equivalent results to enumerating sets of tautomers [5],
and is obviously much faster for downstream processing. As such in
general, it is recommended that for LBLD with ROCS a single
tautomer state and a single protonation state be generated for each
database molecule. After tautomer and protonation state assign-
ment conformations must be generated.
2.2 Conformer Since ROCS performs its overlays rigidly, reasonable 3D conforma-
Generation tions for both the query and database molecules are required. In
our internal experiments, and in most published examples,
conformer databases to be searched with ROCS are generated
Ligand-Based Methods in GPCR Computer-Aided Drug Design 367
Fig. 1 Basic schema of 3D Ligand-based shape similarity searching: a query molecule (A) in one or more 3D
conformations is compared to every conformer of every molecule in a pre-generated database of conforma-
tions (B). The optimized overlay between the single best conformer of each database molecule and each
conformation of the query is reported together with a similarity score (C)
Fig. 2 Shape and chemical feature representation in ROCS. On the left a 3D conformation for a molecule as
usually represented. On the right is the shape and color representation from ROCS of the same molecule. Red
hatched sphere ¼ acceptor, blue hatched sphere ¼ donor, red solid sphere ¼ anion, green solid
sphere ¼ ring
2.3 3D Shape Here, we introduce shape and chemical feature similarity searching
and Feature Similarity using ROCS [10]. ROCS performs shape and feature-based over-
Searching lays of conformers of a candidate molecule to a query molecule in
one or more conformations. The overlays can be performed very
quickly based on a description of molecular shape as the sum of
atom-centered Gaussian functions [11]; on modern hardware
speeds of 50–100 molecules/CPU/second can be attained.
ROCS maximizes the rigid overlap of these Gaussian functions
and thereby maximizes the shared volume and shared features
between a single conformation of the query and a single conforma-
tion of a database molecule. The chemical features used in ROCS
are based on the work of Mills and Dean [12] and are termed
“color” features. An example of abstraction from the usual repre-
sentation of a molecule to the shape and color feature used in
ROCS is shown in Fig. 2.
Similarity in shape and color between the query and the data-
base molecule is calculated from the best match of any conforma-
tion of the query to any conformation of the database molecule.
Similarity is measured by a set of Tanimoto coefficients; by shape
alone as ShapeTanimoto, by color alone (ColorTanimoto), and by
the sum of these two measures (TanimotoCombo). The differences
between these metrics are discussed under Subheading 3.
ROCS has successfully been used in a great many prospective
lead discovery experiments. In cases where protein-ligand struc-
tures exist the cocrystal ligand is often used directly from the crystal
structure as the query [13] but in some experiments the ligand has
been substantially manually altered to improve relevance [14]. An
interesting recent trend is to use results from molecular simulation
on a protein-ligand cocrystal structure to generate structurally
novel queries that may not be related to the structure of the original
cocrystal ligand [15, 16]. Since in retrospective experiments
SBLD methods, such as docking, and ROCS have been shown to
identify different molecules [4, 17] ROCS has also been used
Ligand-Based Methods in GPCR Computer-Aided Drug Design 369
Fig. 3 Shapes and electrostatic potential for query (left) and database hit (right) as described in [24]. Red color
denotes electronegative areas, whereas blue shows electropositive areas
2.4 3D Shape An alternate way to compare small molecules is to use their shapes
and Electrostatic in combination with electrostatic similarity using EON [22]. EON
Similarity Searching combines the shape similarity score from ROCS (ShapeTanimoto)
with a field-based measure of similarity to compare the electrostatic
potential of two small molecules. This electrostatic potential is
calculated internally using Zap [23], OpenEye’s Poisson-Boltzman
(PB) electrostatics toolkit. Two ElectrostaticTanimoto (ET) mea-
sures are calculated using different outer dielectrics in the PB
calculation (outer dielectric of 80.0 and 2.0). The rationale for
using a PB electrostatic field is that the external potential is damp-
ened by orientation of aqueous solvent.
A visualization of electrostatic similarity calculations with EON
can be seen in Fig. 3. More examples of prospective EON use can
be found in the literature [25–27].
3 Notes
Fig. 4 Median AUC on DUD [29] with different levels of conformer sampling in the database. Maxconfs ¼ max-
imum number of conformations per database molecule from OMEGA
3.1 Effect First, we examine the amount of conformer sampling in the data-
of Conformer Sampling base that is required. In Fig. 4, we show the effect of changing the
number of conformations generated by OMEGA for each database
molecule (by changing the maxconfs flag in OMEGA). The median
performance for ROCS is constant as the maximum number of
conformations allowed declines from 400 to 25, with a small
decline at 10 and a further decline at only 1 conformation per
database molecule. Since performance is not degraded by using
small numbers of conformers, this allows the use of smaller data-
bases, thereby increasing search speed (ROCS’ speed is usually
limited by disk reading speed, not computation capacity) and
decreasing the burden of storage and data transfer across networks.
A good balance of speed and performance is provided by setting
maxconfs to 50; this is the setting used in all subsequent
experiments.
Further investigations on ROCS’ performance were carried out
on a newer and larger dataset for virtual screening evaluation, the
Database of Useful Decoys Enhanced or DUD-E [30]. DUD-E is a
large dataset of over 100 diverse protein targets, and for many
targets there are hundreds of active ligands and thousands of
decoys. As such, DUD-E provides high statistical power (the ability
to detect small, but genuine differences in performance between
methods [31], which is rarely considered in CADD [32]) and low
error rates (accurate prediction of performance on datasets other
than DUD-E). While not designed for evaluating ligand-based lead
discovery tools, DUD-E is appropriate for discriminating among
different settings for the same tool, while it is perhaps not appropri-
ate for discriminating among different tools. We used the recovery
of active compounds from their background of presumed decoys in
DUD-E to assess the influence of a variety of parameters in ROCS.
Ligand-Based Methods in GPCR Computer-Aided Drug Design 371
Fig. 5 The effect of using experimental ligand conformation (X-ray) or a low-energy computed conformation
(OMEGA) on virtual screening on the DUD-E database (TanimotoCombo used as similarity measure)
3.2 Effect of Query An obvious problem when performing lead discovery on classes of
Conformation proteins that have few, if any, atomic resolution crystal structures is
how to select the conformation of the protein (for SBLD) or the
ligand (for 3D LBLD). In Fig. 5 we show the effect of using an
experimentally derived conformation (from the DUD-E X-ray
structure) or the lowest energy conformation found by OMEGA
as the query when ranking the database molecules by their Tani-
motoCombo (TC) score to the query. The results for all three
similarity measures are given in Table 1. (ShapeTanimoto
(ST) alone, ColorTanimoto (CT) alone, or TanimotoCombo
(TC)). The X-ray conformation is statistically and substantively
significantly better than the OMEGA conformation when using
TanimotoCombo, in accord with intuition. However, the perfor-
mance of the OMEGA conformation is still good (median AUC is
far above 0.5), indicating that the use of a computed conformation
of the query molecule in ROCS in the absence of an X-ray confor-
mation will likely still provide good results. In contrast, when
ranking by ST and CT there is no substantive difference in perfor-
mance whether the X-ray or the OMEGA conformation is used.
The origin of the difference in sensitivity to the query conformation
for the three metrics is unclear.
372 Paul C.D. Hawkins and Gunther Stahl
Table 1
Effect of changing the origin of the query conformation on ROCS’ performance on the DUD-E dataset.
The p-value is from the Student paired t-test [33], d is Cohen’s effect size [31]. NS ¼ not significant
at p ¼ 0.05
3.3 Effect of Scoring The data in Table 1 show the effect of using different scoring
Function measures for similarity on ROCS’ performance. TC is both statisti-
cally and substantively significantly better than ST, and while TC is
numerically superior to CT, the difference is not statistically or
substantively significant (data not shown). As such, it is recom-
mended that TC be used as the similarity measure in ROCS unless
prior experimentation indicates otherwise.
The results above show that 3D similarity searching with
ROCS is remarkably insensitive to the details of the conformer
sampling used to generate either the query or the database con-
formations; an X-ray conformation of the query provides only a
small, though significant, benefit over using the lowest energy
conformer from OMEGA and even light sampling of the database
molecules (a maximum of 25–50 conformers per molecule) pro-
vides identical performance to much heavier, and therefore much
more time-consuming, sampling. This makes ROCS a fast and
powerful LBLD tool, applicable in both high information projects,
where one or more atomic resolution crystal structures are avail-
able, and in low information projects, where perhaps only one
active ligand is known.
Recently, a new database for evaluating the performance of lead
discovery tools specifically on GPCR targets, GPCR-Bench, was
released [34]. The DUD-E dataset contains only 3 GPCR datasets,
so the comparison of ROCS’ performance on GPCR-Bench to that
on DUD-E provides a useful estimate of how well predictions from
general datasets like DUD-E transfer to other more target-specific
sets. The performance of ROCS on GPCR-Bench and DUD-E is
shown in Table 2. The results from GPCR-Bench are numerically
slightly worse than from DUD-E; however, there is no statistically
or substantively significant difference between the two sets. As
such, DUD-E can be used to estimate ROCS’ performance on
other sets of targets, few of which might be represented in DUD-E.
Ligand-Based Methods in GPCR Computer-Aided Drug Design 373
Table 2
Comparison of ROCS’ performance on the DUD-E and GPCR-Bench
datasets
4 Conclusion
References
1. Tanrikulu Y, Kruger BJ, Proschak E (2013) validation using high quality structures from
The holistic integration of virtual screening in the Protein Databank and Cambridge Struc-
drug discovery. Drug Discov Today tural Database. J Chem Inf Model 50:572–584
18:358–364 7. Hawkins PCD, Nicholls A (2012) Conformer
2. Kraemer O, Hazemann I, Podjarny AD, Klebe generation with OMEGA: learning from the
G (2004) Virtual screening for inhibitors of data set and the analysis of failures. J Chem
aldose reductase. Proteins 55:814–823 Inf Model 52:2919–2936
3. Kruger DM, Evers A (2010) Comparison of 8. McGann M (2012) FRED and HYBRID dock-
structure- and ligand-based virtual screening ing performance on standardized datasets. J
protocols considering hit list complementarity Comput Aided Mol Des 26:897–906
and enrichment factors. ChemMedChem 9. Svensson F, Karlén A, Sköld C (2012) Virtual
5:148–158 screening data fusion using both structure- and
4. Berman HM, Westbrook J, Feng Z, ligand-based methods. J Chem Inf Model
Gilliland G, Bhat TN, Weissig H, Shindyalov 52:225–232
IN, Bourne PE (2000) The protein data bank. 10. Hawkins PCD, Skillman AG, Nicholls A
Nucleic Acids Res 28:235–242. http://www. (2007) Comparison of shape-matching and
rcsb.org docking as virtual screening tools. J Med
5. Milletti F, Vulpetti A (2010) Tautomer prefer- Chem 50:74–82
ences in PDB complexes and its impact on 11. Grant AJ, Gallardo MA, Pickup BT (1996) A
structure-based drug discovery. J Chem Inf fast method of molecular shape comparison: a
Model 50:1062–1107 simple application of a Gaussian description of
6. Hawkins PCD, Skillman AG, Warren GL, molecular shape. J Comput Chem
Ellingson BA, Stahl MT (2010) Conformer 17:1653–1666
generation with OMEGA: algorithm and
374 Paul C.D. Hawkins and Gunther Stahl
12. Mills JEJ, Dean PM (1996) Three-dimensional 23. Zap Toolkit 2017.Feb.1, (2016) OpenEye Sci-
hydrogen-bond geometry and probability entific Software, Santa Fe, NM. http://www.
information from a crystal survey. J Comput eyesopen.com
Aided Mol Des 10:607. https://doi.org/10. 24. Boström J, Grant JA, Fjellström O, Thelin A,
1007/BF00134183 Gustafsson D (2013) Potent fibrinolysis inhib-
13. Geldenhuys WJ, Funk MO, Van dr Schyf CJ, itor discovered by shape and electrostatic com-
Carroll RT (2012) A scaffold hopping plementarity to the drug tranexamic acid. J
approach to identify novel monoamine oxidase Med Chem 56:3273–3280
B inhibitors. Bioorg Med Chem Lett 25. Muchmore SW, Souers AJ, Akritopoulou-
22:1380–1383 Zanze I (2006) The use of three-dimensional
14. Waldner BJ, Fuchs JE, Schauperl M, Kramer C, shape and electrostatic similarity searching in
Liedl KR (2016) Protease inhibitors in view of the identification of a melanin-concentrating
peptide substrate databases. J Chem Inf Model hormone receptor 1 antagonist. Chem Biol
56:1228–1235 Drug Des 67:174–176
15. Hall DR, Enyedy IJ (2016) The use of fake 26. Markt P, Petersen RK, Flindt EN,
ligands from computational solvent mapping Kristiansen K, Kirchmair J, Spitzer G,
in ligand and structure-based virtual screening. Distino S, Schuster D, Wolber G, Laggner C,
Future Med Chem 8:1815–1822 Langer T (2008) Discovery of novel PPAR
16. Metz A, Schanda J, Grez M, Wichmann C, ligands by a virtual screening approach based
Gohlke H (2013) From determinants of on pharmacophore modeling, 3D shape and
RUNX1/ETO tetramerization to small- electrostatic similarity screening. J Med Chem
molecule protein-protein interaction inhibitors 51:6303–6317
targeting acute myeloid leukemia. J Chem Inf 27. Naylor E, Arredouani A, Vasudevan SR, Lewis
Model 53:2196–2202 AM, Parkesh R, Mizote A, Rosen D, Thomas
17. Swann SL, Brown SP, Muchmore SW, Patel H, JM, Izumi M, Ganesan A, Galione A, Churchill
Merta P, Locklear J, Hajduk PJ (2013) A uni- GC (2009) Identification of a chemical probe
fied, probabilistic framework for structure- and for NAADP by virtual screening. Nat Chem
ligand-based virtual screening. J Med Chem Biol 5:220–226
54:1223–1232 28. Hanley JA, McNeil BJ (1982) The meaning
18. Vasudevan SR, Singh N, Churchill GC (2014) and use of the area under a receiver operating
Scaffold hopping with virtual screening from characteristic (ROC) curve. Radiology 143:29
IP3 to a drug-like partial agonist of the inositol 29. Huang N, Shoichet BK, Irwin JJ (2006)
trisphosphate receptor. Chembiochem Benchmarking sets for molecular docking. J
15:2774–2782 Med Chem 49:67896801
19. Santa Cruz EC, Carecho AR, Saidel ME, Mon- 30. Mysinger MM, Carchia M, Irwin JJ, Shoichet
tanari CA, Leitao A (2017) In silico selection BK (2012) Directory of useful decoys,
and cell-based characterization of selective and enhanced (DUD-E): better ligands and decoys
bioactive compounds for androgen-dependent for better benchmarking. J Med Chem
prostate cancer cell. Bioorg Med Chem Lett 55:6582–6594
27:546–550 31. Cohen J (1988) Statistical power analysis for
20. Santos-Sierra S, Kirchmair J, Perna AM, the behavioral sciences, 2nd. Edition. Lawr-
Reiss D, Kemter K, Roschinger W, ence Erlbaum Associates: Mahwah NJ.
Glossmann H, Gersting SW, Muntau AC, 32. Hawkins PCD, Kelley BP, Warren GL (2014)
Wolber G, Lagler FB (2012) Novel pharmaco- The application of statistical methods to cog-
logical chaperones that correct phenylketon- nate docking: a path forward? J Chem Inf
uria in mice. Hum Mol Genet 21:1877–1887 Model 54:1339–1355
21. Vasudevan SR, Moore JB, Schymura Y, 33. Student (1908) The probable error of a mean.
Churchill GC (2012) Shape-based reprofiling Biometrika 6:1–25
of FDA-approved drugs for the H1 histamine 34. Weiss DR, Bortolato A, Tehan B, Mason JS
receptor. J Med Chem 55:7054–7059 (2016) GPCR-Bench: a benchmarking set and
22. EON 2.2.0.5: OpenEye Scientific Software, practitioner’s guide for G Protein-Coupled
Santa Fe, NM. http://www.eyesopen.com Receptor docking. J Chem Inf Model
56:642–651
Chapter 19
Abstract
GPCR modeling approaches are widely used in the hit-to-lead (H2L) and lead optimization (LO) stages of
drug discovery. The aims of these modeling approaches are to predict the 3D structures of the receptor-
ligand complexes, to explore the key interactions between the receptor and the ligand and to utilize these
insights in the design of new molecules with improved binding, selectivity or other pharmacological
properties. In this book chapter, we present a brief survey of key computational approaches integrated
with hierarchical GPCR modeling protocol (HGMP) used in hit-to-lead (H2L) and in lead optimization
(LO) stages of structure-based drug discovery (SBDD). We outline the differences in modeling strategies
used in H2L and LO of SBDD and illustrate how these tools have been applied in three drug discovery
projects.
Key words Structure-based drug design, Molecular dynamics, Simulation, Hit-to-lead, Lead optimi-
zation, G protein-coupled receptor, Docking
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_19, © Springer Science+Business Media LLC 2018
375
376 Alexander Heifetz et al.
Fig. 1 (a) Optimization cycle for H2L. (b) Optimization cycle for LO
378 Alexander Heifetz et al.
2 Methods
2.2 Generating 1. Having the model of the receptor in hand, the next step is often
of the GPCR-Ligand predicting of the receptor-ligand complex, this process is called
Complex molecular docking. Predicting this complex is highly important
if we want to study the interactions between the ligand and the
receptor and to guide the SBDD. As numerous docking
approaches have been reviewed in the literature [28] quite
recently, we here survey briefly the unique challenges and dock-
ing protocols relevant to GPCRs.
2. Docking protocols [28, 29] are the molecular modelling pro-
cesses aimed to explore the interaction between the ligand and
protein. The ultimate goal of any docking protocol is to predict
the bioactive conformation of the ligand and its place and
orientation inside of the receptor binding site named as “dock-
ing pose” or “binding mode”. The docking procedure consists
of two sequential tasks: first, flexible placement of the ligand in
a predefined binding site of the receptor and then scoring the
poses of the docked ligands. Both posing and scoring phases
are equally important and can be carried out by very different
methodologies depending on how exhaustive the conforma-
tional sampling of both the ligand and protein is considered.
3. Some commercial available docking suites of programs are
AutoDock [30], AutoDock Vina [31], MOE [21], FlexX [32],
GOLD [33], and Glide [34]. Different search algorithms are
designed to predict the bioactive conformation of the studied
compounds through the evaluation of the interactions between
ligands and targets [29]. An increase in the quality of the ligand
docking can be gained by consideration of flexibility of the
modeled system.
4. Scoring and re-ranking: In many of our projects (see Note 4),
we used AMBER interaction energy to rescore and re-rank
docking poses. We used the MM_PBSA/GBSA approach
[35] to calculate the AMBER interaction energy [36]. This
approach, while subject to the same limitations of all force
field-based methods, was able to accurately predict relative
binding affinities between the ligand and protein and was
therefore selected as a reliable method to rescore and to rank
docking poses [37].
Computational Methods Used in Hit-to-Lead and Lead Optimization Stages. . . 381
Fig. 4 Schematic summary of the FMO approach: (a) Workflow for PIEDA calculations and details on each of
the PIE terms that are computed (b) FMO analysis of human adenosine OX2 receptor in complex with
Suvorexant (PDB ID 4S0V [47]). The carbon atoms of the ligand are shown in light orange and for the receptor
Computational Methods Used in Hit-to-Lead and Lead Optimization Stages. . . 385
Fig. 4 (continued) are gray. Nitrogen atoms are shown in blue, oxygen in red, and chlorine in light green. The
fragmented bonds are marked as red discs. The left-hand bar plots describe the sorted PIE of the most
significant residues, and the right-hand plots describe the pair interaction energy decomposition analysis
(PIEDA) of these key interactions. PIE terms: electrostatics, dispersion, charge-transfer, and exchange-
repulsion are color-coded in yellow, blue, red, and green, respectively. The figure is adapted from our
previous publication
386 Alexander Heifetz et al.
3 Notes
Fig. 6 Summary schematic of the VAST-GPCR modeling workflow that led to the discovery of new MCH-1R
antagonists
Fig. 7 Schematic summarizing how interaction maps derived from GPCR model for potent and selective OX2
receptor antagonist
Acknowledgment
References
1. Heifetz A, Schertler GF, Seifert R, Tate CG, Hunt P, Ceska T, Hodgson S, Bodkin MJ,
Sexton PM, Gurevich VV, Fourmy D, Singh S, Law RJ, Biggin PC (2015) GPCR
Cherezov V, Marshall FH, Storer RI, structure, function, drug discovery and crystal-
Moraes I, Tikhonova IG, Tautermann CS, lography: report from academia-industry
392 Alexander Heifetz et al.
international conference (UK Royal Society) 16. Latorraca NR, Venkatakrishnan AJ, Dror RO
Chicheley hall, 1-2 September 2014. Naunyn (2017) GPCR dynamics: structures in motion.
Schmiedeberg’s Arch Pharmacol 388:883–903 Chem Rev 117:139–155
2. Shonberg J, Kling RC, Gmeiner P, Lober S 17. Guo D, Pan AC, Dror RO, Mocking T, Liu R,
(2015) GPCR crystal structures: medicinal Heitman LH, Shaw DE, IJ AP (2016) Molec-
chemistry in the pocket. Bioorg Med Chem ular basis of ligand dissociation from the aden-
23:3880–3906 osine A2A receptor. Mol Pharmacol
3. Wise A, Gearing K, Rees S (2002) Target vali- 89:485–491
dation of G-protein coupled receptors. Drug 18. Pan AC, Borhani DW, Dror RO, Shaw DE
Discov Today 7:235–246 (2013) Molecular determinants of drug-
4. Rask-Andersen M, Masuram S, Schioth HB receptor binding kinetics. Drug Discov Today
(2014) The druggable genome: evaluation of 18:667–673
drug targets in clinical trials suggests major 19. Dror RO, Arlow DH, Maragakis P, Mildorf TJ,
shifts in molecular class and indication. Annu Pan AC, Xu H, Borhani DW, Shaw DE (2011)
Rev Pharmacol Toxicol 54:9–26 Activation mechanism of the beta2-adrenergic
5. Dohlman HG (2015) Thematic minireview receptor. Proc Natl Acad Sci U S A
series: new directions in G protein-coupled 108:18684–18689
receptor pharmacology. J Biol Chem 20. Mason JS, Bortolato A, Weiss DR, Deflorian F,
290:19469–19470 Tehan B, Marshall FH (2013) High end GPCR
6. Jazayeri A, Andrews SP, Marshall FH (2017) design: crafted ligand design and druggability
Structurally enabled discovery of adenosine analysis using protein structure, lipophilic hot-
A2A receptor antagonists. Chem Rev spots and explicit water networks. In Silico
117:21–37 Pharmacol 1:23
7. Jazayeri A, Dias JM, Marshall FH (2015) From 21. Heifetz A, James T, Morao I, Bodkin MJ, Big-
G protein-coupled receptor structure resolu- gin PC (2016) Guiding lead optimization with
tion to rational drug design. J Biol Chem GPCR structure modeling and molecular
290:19489–19495 dynamics. Curr Opin Pharmacol 30:14–21
8. Cooke RM, Brown AJ, Marshall FH, Mason JS 22. Deprez-Poulain R, Deprez B (2004) Facts, fig-
(2015) Structures of G protein-coupled recep- ures and trends in lead generation. Curr Top
tors reveal new opportunities for drug discov- Med Chem 4:569–580
ery. Drug Discov Today 20:1355–1364 23. Heifetz A, Aldeghi M, Chudyk E, Fedorov
9. Congreve M, Dias JM, Marshall FH (2014) DG, Bodkin M, Biggin PC (2016) Using the
Structure-based drug design for G protein- fragment molecular orbital method to investi-
coupled receptors. Prog Med Chem 53:1–63 gate agonist-orexin 2 receptor interactions.
10. Topiol S, Sabio M (2009) X-ray structure Biochem Soc Trans 44(2):574–581
breakthroughs in the GPCR transmembrane 24. Heifetz A, Chudyk EI, Gleave L, Aldeghi M,
region. Biochem Pharmacol 78:11–20 Cherezov V, Fedorov DG, Biggin PC, Bodkin
11. Topiol S (2013) X-ray structural information of MJ (2016) The fragment molecular orbital
GPCRs in drug design: what are the limitations method reveals new insight into the chemical
and where do we go? Expert Opin Drug Discov nature of GPCR-ligand interactions. J Chem
8:607–620 Inf Model 56:159–172
12. Topiol S, Sabio M (2015) The role of experi- 25. Heifetz A, Storer RI, McMurray G, James T,
mental and computational structural Morao I, Aldeghi M, Bodkin MJ, Biggin PC
approaches in 7TM drug discovery. Expert (2016) Application of an integrated GPCR
Opin Drug Discov 10:1071–1084 SAR-modeling platform to explain the activa-
tion selectivity of human 5-HT over 5-HT.
13. Tautermann CS, Gloriam DE (2016) Editorial ACS Chem Biol 11(5):1372–1382
overview: new technologies: GPCR drug
design and function-exploiting the current 26. Storer RI, Brennan PE, Brown AD, Bungay PJ,
(of) structures. Curr Opin Pharmacol 30:8–10 Conlon KM, Corbett MS, DePianta RP, Fish
PV, Heifetz A, Ho DK, Jessiman AS,
14. Biggin PC, Aldeghi M, Bodkin MJ, Heifetz A McMurray G, de Oliveira CA, Roberts LR,
(2016) Beyond membrane protein structure: Root JA, Shanmugasundaram V, Shapiro MJ,
drug discovery, dynamics and difficulties. Adv Skerten M, Westbrook D, Wheeler S, Whitlock
Exp Med Biol 922:161–181 GA, Wright J (2014) Multiparameter optimi-
15. Tautermann CS, Seeliger D, Kriegl JM (2015) zation in CNS drug discovery: design of
What can we learn from molecular dynamics pyrimido[4,5-d]azepines as potent
simulations for GPCR drug design? Comput 5-hydroxytryptamine 2C (5-HT(2)C) receptor
Struct Biotechnol J 13:111–121
Computational Methods Used in Hit-to-Lead and Lead Optimization Stages. . . 393
agonists with exquisite functional selectivity docking of ligands to antibodies: methods and
over 5-HT(2)A and 5-HT(2)B receptors. J applications. Methods 20:280–291
Med Chem 57:5258–5269 38. Morris GM, Huey R, Lindstrom W, Sanner
27. Tautermann CS (2014) GPCR structures in MF, Belew RK, Goodsell DS, Olson AJ
drug design, emerging opportunities with (2009) AutoDock4 and AutoDockTools4:
new structures. Bioorg Med Chem Lett automated docking with selective receptor flex-
24:4073–4079 ibility. J Comput Chem 30:2785–2791
28. Bartuzi D, Kaczor AA, Targowska-Duda KM, 39. Blundell CD, Packer MJ, Almond A (2013)
Matosiuk D (2017) Recent advances and appli- Quantification of free ligand conformational
cations of molecular docking to G protein- preferences by NMR and their relationship to
coupled receptors. Molecules 22(2):E340 the bioactive conformation. Bioorg Med Chem
29. Kitchen DB, Decornez H, Furr JR, Bajorath J 21:4976–4987
(2004) Docking and scoring in virtual screen- 40. Hawkins PC, Skillman AG, Nicholls A (2007)
ing for drug discovery: methods and applica- Comparison of shape-matching and docking as
tions. Nat Rev Drug Discov 3:935–949 virtual screening tools. J Med Chem 50:74–82
30. Morris GM, Goodsell DS, Halliday RS, 41. Marino KA, Shang Y, Filizola M (2017)
Huey R, Hart WE, Belew RK, Olson AJ Insights into the function of opioid receptors
(1998) Automated docking using a Lamarck- from molecular dynamics simulations of avail-
ian genetic algorithm and an empirical binding able crystal structures. Br J Pharmacol. https://
free energy function. J Comput Chem doi.org/10.1111/bph.13774
19:1639–1662 42. Schneider S, Provasi D, Filizola M (2015) The
31. Trott O, Olson AJ (2010) AutoDock Vina: dynamic process of drug-GPCR binding at
improving the speed and accuracy of docking either orthosteric or allosteric sites evaluated
with a new scoring function, efficient optimiza- by metadynamics. Methods Mol Biol
tion, and multithreading. J Comput Chem 1335:277–294
31:455–461 43. Kaczor AA, Rutkowska E, Bartuzi D,
32. Rarey M, Kramer B, Lengauer T, Klebe G Targowska-Duda KM, Matosiuk D, Selent J
(1996) A fast flexible docking method using (2016) Computational methods for studying
an incremental construction algorithm. J Mol G protein-coupled receptors (GPCRs). Meth-
Biol 261:470–489 ods Cell Biol 132:359–399
33. Verdonk ML, Cole JC, Hartshorn MJ, Murray 44. Bartuzi D, Kaczor AA, Matosiuk D (2015)
CW, Taylor RD (2003) Improved protein- Activation and allosteric modulation of
ligand docking using GOLD. Proteins human mu opioid receptor in molecular
52:609–623 dynamics. J Chem Inf Model 55:2421–2434
34. Friesner RA, Banks JL, Murphy RB, Halgren 45. Labute P (2010) LowModeMD--implicit
TA, Klicic JJ, Mainz DT, Repasky MP, Knoll low-mode velocity filtering applied to confor-
EH, Shelley M, Perry JK, Shaw DE, Francis P, mational search of macrocycles and protein
Shenkin PS (2004) Glide: a new approach for loops. J Chem Inf Model 50:792–800
rapid, accurate docking and scoring. 1. Method 46. De Vivo M, Masetti M, Bottegoni G, Cavalli A
and assessment of docking accuracy. J Med (2016) Role of molecular dynamics and related
Chem 47:1739–1749 methods in drug discovery. J Med Chem
35. Kollman PA, Massova I, Reyes C, Kuhn B, 59:4035–4061
Huo S, Chong L, Lee M, Lee T, Duan Y, 47. Mollica L, Theret I, Antoine M, Perron-Sierra-
Wang W, Donini O, Cieplak P, Srinivasan J, F, Charton Y, Fourquez J-M, Wierzbicki M,
Case DA, Cheatham TE 3rd (2000) Calculat- Boutin JA, Ferry G, Decherchi S,
ing structures and free energies of complex Bottegoni G, Ducrot P, Cavalli A (2016)
molecules: combining molecular mechanics Molecular dynamics simulations and kinetic
and continuum models. Acc Chem Res measurements to estimate and predict pro-
33:889–897 tein–ligand residence times. J Med Chem
36. Liu S, Wu Y, Lin T, Abel R, Redmann JP, 59:7167–7176
Summa CM, Jaber VR, Lim NM, Mobley DL 48. Copeland RA (2016) The drug-target resi-
(2013) Lead optimization mapper: automating dence time model: a 10-year retrospective.
free energy calculations for lead optimization. J Nat Rev Drug Discov 15:87–95
Comput Aided Mol Des 27(9). https://doi. 49. Heifetz A, Trani G, Aldeghi M, MacKinnon
org/10.1007/s10822-10013-19678-y CH, McEwan PA, Brookfield FA, Chudyk E,
37. Sotriffer CA, Flader W, Winger RH, Rode BM, Bodkin M, Pei Z, Burch JD, Ortwine DF
Liedl KR, Varga JM (2000) Automated (2016) Fragment molecular orbital method
394 Alexander Heifetz et al.
Abstract
Cheminformatics is a broad discipline covering a wide range of computational approaches, including the
characterization of molecular similarity, pattern recognition, and predictive modeling. The unifying theme
that these apparently disparate methods have in common is the aim of extracting useable information from
the increasing amounts of data that are associated with contemporary drug discovery projects. Both
proprietary and publically available data can be exploited to help inform and improve the process of
developing novel therapeutic molecules targeting the GPCR family of proteins.
Key words Cheminformatics, G protein-coupled receptor, Library design, Reaction mining, QSAR,
Drug-likeness, Multi-parameter optimization
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_20, © Springer Science+Business Media LLC 2018
395
396 Tim James
Fig. 1 Common cheminformatics approaches and an illustration of where they are applied in the preclinical
drug discovery pipeline
3 Target Identification
Fig. 2 A decision tree to classify compounds as either promoting a good or bad sleep pattern in rats using
predicted protein-level activities. Reproduced with permission from [24]
4 Library Design
Fig. 3 An example of an evolutionary de novo design workflow of the type exemplified by the work of Besnard
et al. At each iteration, virtual enumeration according to a set of medicinal chemistry transforms is followed by
scoring and filtering to generate an elite population. After a number of generations have evolved compounds
are selected for synthesis and experimental testing, and the results are fed back in to update both the models
and the molecules for the next cycle
6 QSAR/QSPR Modeling
Fig. 4 Examples of different ways of characterizing a molecule during QSAR modeling, illustrated using the
β-adrenoceptor antagonist Atenolol. (a) Division of the molecule into R groups and a core “scaffold”, as would
be performed during Free-Wilson or matched-pairs analysis. (b) Construction of a binary fingerprint from the
molecular graph; in this case, a path-based fingerprint where each pattern sets two bits. (c) A 3D description
of the molecule using electrostatic (red—positive, blue—negative) and shape (yellow) fields
404 Tim James
Fig. 5 Examples of individual desirability functions that might be combined into an overall MPO objective. (a) A
hard cutoff at property values below two, exemplifying early binary classification schemes such as Lipinski’s
rule of five. (b) A more complicated function representing a preferred property range from 2 to 4, with
asymmetric plateaux at low and high values and a graduated penalisation between the two. (c) A desirability
function based on a pre-existing distribution of property values, as employed in the QED approach
the greater the number of properties that are considered, the greater
the overall uncertainty will be in the combined outcome [61]. Prob-
abilistic approaches to MPO are therefore much more representa-
tive of the true underlying data than hard cutoffs or filters, although
they are more complicated to implement. The functional form of
the optimization metric and the influence of uncertainties can both
be challenged using sensitivity analysis [62], which is important
when making compound prioritization decisions in order to avoid
inappropriate exclusion of potentially useful series.
One specific application of multi-parameter thinking that is
perhaps worthy of separate discussion is the characterization of
drug-likeness. Work in this area typically seeks to characterize an
area of chemical space based on the known compounds that already
display some property of interest, such as being an approved drug.
A measure of how close novel molecules are to this space is then
derived, on the assumption that revisiting historically precedented
space is more likely to yield future success. In an early and now
much imitated study, Lipinski and coworkers analyzed the physico-
chemical properties of known drugs and clinical candidates to
identify factors that were associated with passive membrane perme-
ability and oral absorption [63]. This analysis was encapsulated as a
series of individual property thresholds that became known as the
“rule of 5” because all of the thresholds are multiples of that
number. Although the philosophy remains the same, hard cutoffs
have subsequently been superseded by continuous metrics familiar
to other contemporary MPO applications, for example in the
quantitative estimate of drug-likeness (QED) parameter [64] and
the Pfizer CNS MPO score [65]. Such general metrics tend not to
be monitored continuously during a drug discovery project, where
a more tailored optimization function of the type discussed above
would likely be developed. However, they may be of use in
pre-project and early stage activities where little project-specific
information is available, such as compound library design or HTS
analysis.
408 Tim James
8 Personal Perspective
Even a cursory glance at the popular literature will tell you that we
are currently entering an era of “big data”, and drug discovery is
certainly no exception to this. We are awash with data, and this
trend only looks to continue for the foreseeable future. The task of
the cheminformatician—turning this data into information, and
the information into knowledge—therefore becomes ever more
crucial. Simple increases in data volume are relatively easily accom-
modated by improvements in processing power, but issues sur-
rounding data quality, consistency, and interpretation do not scale
so straightforwardly. Cheminformatics is principally concerned
with summarizing and presenting the relevant information to
inform and expedite decision making in drug discovery, and this is
a valuable activity. Computer algorithms are, comparatively
speaking, excellent at pattern recognition, and therefore ideally
suited to identifying statistical correlations in our sea of numbers.
However, algorithms have almost nothing to say about the mean-
ing of these correlations and, despite the enthusiasm around some-
what misleading monikers like “machine learning” and “artificial
intelligence”, this situation seems unlikely to change soon.
Cheminformatics in the Service of GPCR Drug Discovery 409
References
1. Brown FK (1998) Chemoinformatics: what is an information system for G protein-coupled
it and how does it impact drug discovery? Annu receptors. Nucleic Acids Res 44:D356–D364
Rep Med Chem 33:375–384 13. Papadatos G, Davies M, Dedman N,
2. Clarivate Analytics, Integrity, https://clarivate. Chambers J, Gaulton A, Siddle J, Koks R,
com/products/integrity Irvine SA, Pettersson J, Goncharoff N,
3. Evolvus, Liceptor Database, http://www. Hersey A, Overington JP (2016) Sure-
evolvus.com/products/databases/ ChEMBL: a large-scale, chemically annotated
liceptordatabase.html patent document database. Nucleic Acids Res
4. Elsevier, Reaxys Medicinal Chemistry, https:// 44:D1220–D1228
www.elsevier.com/solutions/reaxys/reaxys- 14. Southan C, Várkonyi P, Muresan S (2009)
medicinal-chemistry Quantitative assessment of the expanding com-
5. Bento AP, Gaulton A, Hersey A, Bellis LJ, plementarity between public and commercial
Chambers J, Davies M, Kruger FA, Light Y, databases of bioactive compounds. J Chemin-
Mak L, Overington JP (2014) The ChEMBL form 1:10
bioactivity database: an update. Nucleic Acids 15. Groom CR, Bruno IJ, Lightfoot MP, Ward SC
Res 42:1083–1090 (2016) The Cambridge structural database.
6. Wang Y, Xiao J, Suzek TO, Zhang J, Wang J, Acta Crystallogr B72:171–179
Zhou Z, Han L, Karapetyan K, Bryant SH 16. Berman HM, Westbrook J, Feng Z,
(2012) PubChem’s bioassay database. Nucleic Gilliland G, Bhat TN, Weissig H, Shindyalov
Acids Res 40:D400–D412 IN, Bourne PE (2000) The protein data bank.
7. Gilson MK, Baitaluk M, Nicola G, Hwang L, Nucleic Acids Res 28:235–242
Chong J (2016) BindingDB in 2015: a public 17. Tiikkainen P, Franke L (2012) Analysis of com-
database for medicinal chemistry, computa- mercial and public bioactivity databases. J
tional chemistry and systems pharmacology. Chem Inf Model 52:319–326
Nucleic Acids Res 44:D1045–D1063 18. Baell J, Walters MA (2014) Chemical con
8. Southan C, Sharman JL, Benson HE, artists foil drug discovery. Nature
Faccenda E, Pawson AJ, Alexander SP, Bune- 513:481–483
man OP, Davenport AP, Davies JA (2016) The 19. Aldrich C, Bertozzi C, Georg GI, Kiessling L,
IUPHAR/BPS guide to PHARMACOLOGY Lindsley C, Liotta D, Merz KM, Schepartz A,
in 2016: towards curated quantitative interac- Wang S (2017) The ecstasy and agony of assay
tions between 1300 protein targets and 6000 interference compounds. ACS Central Sci
ligands. Nucleic Acids Res 44:D1054–D1068 3:143–147
9. Roth BL, Kroeze WK, Patel S, Lopez E (2000) 20. Baker M (2016) Is there a reproducibility cri-
The multiplicity of serotonin receptors: use- sis? Nature 533:452–454
lessly diverse molecules or an embarrasment 21. Wermuth CG (2004) Multitargeted drugs: the
of riches? Neuroscientist 6:252–262 end of the “one-target-one-disease” philoso-
10. Southan C (2016) Retrieving GPCR data from phy? Drug Discov Today 1:826–827
public databases. Curr Opin Pharmacol 22. Swinney DC, Anthony J (2011) How were new
30:38–43 medicines discovered? Nat Rev Drug Discov
11. Okuno Y, Tamon A, Yabuuchi H, Niijima S, 10:507–519
Minowa Y, Tonomura K, Kunimoto R, Feng C 23. van der Horst E, Peironcely JE, Ijzerman AP,
(2008) GLIDA: GPCR—ligand database for Beukers MW, Lane JR, van Vlijmen HW,
chemical genomics drug discovery—database Emmerich MT, Okuno Y, Bender A (2010) A
and tools update. Nucleic Acids Res 36: novel chemogenomics analysis of G protein-
D907–D912 coupled receptors (GPCRs) and their ligands:
12. Isberg V, Mordalski S, Munk C, Rataj K, a potential strategy for receptor
Harpsøe K, Hauser AS, Vroling B, Bojarski de-orphanization. BMC Bioinformatics
AJ, Vriend G, Gloriam DE (2016) GPCRdb: 11:316
410 Tim James
24. Drakakis G, Wafford KA, Brewerton SC, Bod- molecule design. J Chem Inf Model
kin MJ, Evans DA, Bender A (2017) Polyphar- 51:3093–3098
macological in silico bioactivity profiling and 38. Patel H, Bodkin MJ, Chen B, Gillet VJ (2009)
experimental validation uncovers sedative- Knowledge-based approach to de novo design
hypnotic effects of approved and experimental using reaction vectors. J Chem Inf Model
drugs in rat. ACS Chem Biol 12:1593–1602 49:1163–1184
25. Arrowsmith CH, Audia JE, Austin C, Baell J, 39. Schneider N, Lowe DM, Sayle RA, Tarselli
Bennet J, Blagg J, Bountra C, Brennan PE, MA, Landrum GA (2016) Big data from phar-
Howe T (2015) The promise and peril of maceutical patents: a computational analysis of
chemical probes. Nat Chem Biol 11:536–541 medicinal chemists’ bread and butter. J Med
26. Oprea TI, Bologa CG, Boyer S, Curpan RF, Chem 59:4385–4402
Glen RC, Hopkins AL, Sklar LA (2009) A 40. National Cancer Institute, Synthetically Acces-
crowdsourcing evaluation of the NIH chemical sible Virtual Inventory (SAVI) Database,
probes. Nat Chem Biol 5:441–447 https://cactus.nci.nih.gov/download/savi_
27. Workman P, Collins I (2010) Probing the download/
probes: fitness factors for small molecule 41. Klinger F, Gastreich M, Mazanetz MP,
tools. Chem Biol 17:561–577 Dawson G, Bodkin M 2016, KNIME-ing
28. Frye SV (2010) The art of the chemical probe. through the EVOSpace of FTrees, CCG UGM
Nat Chem Biol 6:159–161 42. Boehm M, Wu T, Claussen H, Lemmen C
29. Johnson AM, Maggiora GM (1990) Concepts (2008) Similarity searching and scaffold hop-
and applications of molecular similarity. John ping in synthetically accessible combinatorial
Willey & Sons, New York chemistry spaces. J Med Chem 51:2468–2480
30. Balakin KV, Tkachenko SE, Lang SA, Okun I, 43. Lessel U, Wellenzohn B, Lilienthal M, Claus-
Ivashchenko AA, Savchuk NP (2002) sen H (2009) Searching fragment spaces with
Property-based design of GPCR-targeted feature trees. J Chem Inf Model 49:270–279
library. J Chem Inf Comput Sci 42:1332–1342 44. Besnard J, Ruda GF, Setola V, Abecassis K,
31. Evans BE, Rittle KE, Bock MG, DiPardo RM, Rodriguiz RM, Huang X, Norval S, Sassano
Freidinger RM, Whitter WL, Lundell GF, MF, Shin AI, Webster LA, Simeons FRC,
Veber DF, Anderson PS, Hirshfield J (1988) Stojanovski L, Prat A, Seidah NG, Constam
Methods for drug discovery: development of DB, Bickerton GR, Read KD, Wetsel WC, Gil-
potent, selective, orally effective cholecystoki- bert IH, Roth BL, Hopkin AL (2012) Auto-
nin antagonists. J Med Chem 31:2235–2246 mated design of ligands to
32. Schnur DM, Hermsmeier MA, Tebben AJ polypharmacological profiles. Nature
(2006) Are target-family-privileged substruc- 492:215–222
tures truly privileged? J Med Chem 45. Stewart KD, Shiroda M, James CA (2006)
49:2000–2009 Drug guru: a computer software program for
33. Bondensgaard K, Ankersen M, Thøgersen H, drug design. Bioorg Med Chem
Hansen BS, Wulff BS, Bywater RP (2004) Rec- 14:7011–7022
ognition of privileged structures by G-protein 46. Lavecchia A (2015) Machine-learning
coupled receptors. J Med Chem 47:888–899 approaches in drug discovery: methods and
34. van der Horst E, Okuno Y, Bender A, Ijzerman applications. Drug Discov Today 20:318–331
A (2009) Substructure mining of GPCR 47. Hansch C (1980) Use of quantitative
ligands reveals activity-class specific functional structure-activity relationships (QSAR) in
groups in an unbiased manner. J Chem Inf drug design. Pharm Chem J 14:678–691
Model 49:348–360 48. Free SM, Wilson JW (1964) A mathematical
35. Mason JS, Cheney DL (2000) Library design contribution to structure-activity studies. J
and virtual screening using multiple 4-point Med Chem 7:395–399
pharmacophore fingerprints. Pac Symp Bio- 49. Griffen E, Leach AG, Robb GR, Warner DJ
comput 5:573–584 (2011) Matched molecular pairs as a medicinal
36. Roughley SD, Jordan AM (2011) The medici- chemistry tool. J Med Chem 54:7739–7750
nal chemist’s toolbox: an analysis of reactions 50. Waring MJ, Bennett SNL, Boyd S, Campbell L,
used in the pursuit of drug candidates. J Med Davies RDM, Gerhardt S, Hargreaves D, Mar-
Chem 54:3451–3479 tin NG, Robb GR, Wilkinson G (2013)
37. Hartenfeller M, Eberle M, Meier P, Nieto- Matched triplicate design sets in the optimisa-
Oberhuber C, Altmann K, Schneider G, tion of glucokinase activators – maximising
Jacoby E, Renner S (2011) A collection of medicinal chemistry information content.
robust organic synthesis reactions for in silico Med Chem Commun 4:657–662
Cheminformatics in the Service of GPCR Drug Discovery 411
51. O’Boyle NM, Boström J, Sayle RA, Gill A 60. Shultz MD (2013) Setting expectations in
(2014) Using matched molecular series as a molecular optimizations: strengths and limita-
predictive tool to optimize biological activity. tions of commonly used composite parameters.
J Med Chem 57:2704–2713 Bioorg Med Chem Lett 23:5980–5991
52. Cereto-Massagué A, Ojeda MJ, Valls C, 61. Segall MD, Champness EJ (2015) The chal-
Mulero M, Garcia-Vallvé S, Pujadas G (2015) lenges of making decisions using uncertain
Molecular fingerprint similarity search in vir- data. J Comput Aided Mol Des 29:809–816
tual screening. Methods 71:58–63 62. Segall MD, Yusof I, Champness EJ (2016)
53. Cramer RD, Patterson DE, Bunce JD (1988) Avoiding missed opportunities by analysing
Comparative molecular field analysis the sensitivity of our decisions. J Med Chem
(CoMFA). 1. Effect of shape on binding of 59:4267–4277
steroids to carrier proteins. J Am Chem Soc 63. Lipinski CA, Lombardo F, Dominy BW, Fee-
110:5959–5967 ney PJ (1997) Experimental and computa-
54. Gavaghan CL, Arnby CH, Blomberg N, tional approaches to estimate solubility and
Strandlund G, Boyer S (2007) Development, permeability in drug discovery and develop-
interpretation and temporal evaluation of a ment settings. Adv Drug Deliv Rev 23:3–25
global QSAR of hERG electrophysiology 64. Bickerton GR, Paolini GV, Besnard J,
screening data. J Comput Aided Mol Des Muresan S, Hopkin AL (2012) Quantifying
21:189–206 the chemical beauty of drugs. Nat Chem
55. Rodgers SL, Davis AM, van de Waterbeemd H 4:90–98
(2007) Time-series QSAR analysis of human 65. Wager TT, Hou X, Verhoest PR, Villalobos A
plasma protein binding data. QSAR Comb Sci (2010) Moving beyond rules: the development
26:511–521 of a central nervous system multiparameter
56. Ramsundar B, Kearnes S, Riley P, Webster D, optimization (CNS MPO) approach to enable
Konerding D, Pande V (2015) Massively mul- alignment of druglike properties. ACS Chem
titask networks for drug discovery. arXiv Neurosci 1:435–449
1502:02072 66. Lu G, Middleton RE, Sun H, Naniong M, Ott
57. Posner BA, Xi H, Mills JEJ (2009) Enhanced CJ, Mitsiades CS, Wong K, Bradner JE, Kaelin
HTS hit selection via a local hit rate analysis. J WG Jr (2014) The myeloma drug lenalidomide
Chem Inf Model 49:2201–2210 promotes the cereblon-dependent destruction
58. Schmidt M, Lipson H (2009) Distilling free- of ikaros proteins. Science 343:305–309
form natural laws from experimental data. Sci- 67. Ebejer J, Charlton MH, Finn PW (2016) Are
ence 324:81–85 the physicochemical properties of antibacterial
59. Hopkins AL, Keser€ u GM, Leeson PD, Rees compounds really different from other drugs? J
DC, Reynolds CH (2014) The role of ligand Cheminform 8:30
efficiency metrics in drug discovery. Nat Rev
Drug Discov 13:105–121
Chapter 21
Abstract
Despite tremendous efforts, approximately 120 GPCRs remain orphan. Their physiological functions and
their potential roles in diseases are poorly understood. Orphan GPCRs are extremely important because
they may provide novel therapeutic targets for unmet medical needs. As a complement to experimental
approaches, molecular modeling and virtual screening are efficient techniques to discover synthetic surro-
gate ligands which can help to elucidate the role of oGPCRs. Constitutively activated mutants and recently
published active structures of GPCRs provide stimulating opportunities for building active molecular
models for oGPCRs and identifying activators using virtual screening of compound libraries. We describe
the molecular modeling and virtual screening process we have applied in the discovery of surrogate ligands,
and provide examples for CCKA, a simulated oGPCR, and for two oGPCRs, GPR52 and GPR34.
Key words GPCR, Orphan GPCR, Molecular model, Homology modeling, Molecular dynamics,
Structure, Virtual screening, Surrogate ligand, CCKA, GPR34, GPR52
1 Introduction
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8_21, © Springer Science+Business Media LLC 2018
413
414 Constantino Diaz et al.
2 Materials
2.2 Homology Homology models for CCKA, GPR52, and GPR34 were built with
Modeling MOE 2015.10 [https://www.chemcomp.com/], based on NTS1
structures. The models were full-length, including extracellular and
intracellular loops.
2.3 Compounds A CCKA library with 3375 compounds, containing 117 human
Libraries CCKA agonists, 195 antagonists, and 3063 decoys, was built for
the evaluations. Agonists and antagonists were retrieved from the
2.3.1 CCKA
ChEMBL v21 database [20]. The included actives had activating or
inhibiting profile, values EC50, IC50, or Ki below 4 μM, and
molecular weights between 300 and 800 g/mol. Decoys were
collected from the DUD-E database [21]. They had size and phys-
icochemical properties similar to the actives (e.g., molecular
weight, LogP) but dissimilar topology. We randomly selected
decoys among those proposed for building a testset with a ratio
4% CCKA agonists and 96% decoys.
and molecular weights between 414 and 486 g/mol. Decoys were
randomly collected from the ZINC database [22]. They had molec-
ular weights between 300 and 600 g/mol.
2.4 Preparation The libraries were prepared through a Knime workflow containing
of the Chemical the successive ChemAxon nodes [https://www.chemaxon.com/]:
Libraries
1. Major microspecies, to keep the major tautomers, at pH ¼ 7.4,
2. Stereoisomers, to consider undefined stereocenters and gener-
ate stereoisomers, and,
3. Conformers, to build the lowest energy conformer.
2.5 Virtual Screening Docking sites in the GPCR models were defined using Site Finder
in MOE.
2.5.1 Docking
The compound libraries were docked in the GPCR models
using Gold 2016 [25] and four different scoring functions PLP,
ASP, ChemScore, and GoldScore. For each compound, ten dock-
ing poses were generated for each stereoisomer, and the best scor-
ing value among all poses and all stereoisomers was considered for
the compound. All docking parameters were those by default. No
post-docking process was done: no rescoring, and no visualization
or validation of the poses.
3 Methods
3.1.1 Active Molecular GPCRs share a common architecture: (1) an extracellular region
Model Built Using a CAM containing the N-terminus and three extracellular loops EL1-3,
(2) a transmembrane domain comprising seven α-helices H1-7,
Activation of GPCRs and (3) an intracellular region with three intracellular loops IL1-3
and the C-tail. The intracellular and extracellular regions show a
high variability in size and sequence across GPCRs, while the
transmembrane domain reveals a higher sequence conservation.
For a wild-type GPCR, binding of an agonist to parts of the
extracellular and transmembrane domains of the receptor modifies
its conformation and interaction with cytosolic effectors such as
G-proteins and β-arrestins, thus activating the downstream
signaling [28].
GPCR with constitutive activating mutations show spontane-
ous activity in an agonist-independent manner. The first CAM was
reported for the α1-adrenergic receptor [29], rapidly followed by
many other GPCRs [30]. CAMs are of considerable interest
because their study shed light on structural differences between
active and inactive GPCR conformations. It is worth noting that
naturally occurring CAMs are associated with human diseases
[31, 32].
The NTS1-V308E CAM For the NTS1 receptor, a CAM was produced by a single
V308E6.40 mutation. The spontaneous activity of the V308E6.40
mutant was eightfold higher than wild-type receptor when
expressed in COS-3 cells, and assessed for basal activity of Inositol
Phosphate production [33].
Active Molecular Model First, models for NTS1 and NTS1-V308E were built by homology
for the NTS1-V308E CAM modeling using the inactive structure of rhodopsin 1F88 [34], as
follows. Bovine rhodopsin, human NTS1, and other class-A GPCR
sequences were aligned using ClustalW. The positions of motifs in
class-A GPCRs for each TM helix were considered [35] and manual
modifications in the alignment were made where needed, produc-
ing the multi-alignment for the 7 TM helices shown in Fig. 1.
Residues in the 7 TM helices of the rhodopsin structure that were
Modeling and Deorphanization of Orphan GPCRs 417
bRhod 34 PWQFSMLAAYMFLLIMLGFPINFLTLYVTVQ
hNTS1 60 IYSKVLVTAVYLALFVVGTVGNTVTAFTLAR
hCCKA 38 EWQPAVQILLYSLIFLLSVLGNTLVITVLIR
hGPR34 51 KLLSTVLTTSYSVIFIVGLVGNIIALYVFLG
hGPR52 37 VDVCIFETVVIVLLTFLIIAGNLTVIFVFHC
bRhod 71 PLNYILLNLAVADLFMVFGGFTTTLYTSLH
hNTS1 100 TVHYHLGSLALSDLLTLLLAMPVELYNFIW
hCCKA 75 VTNIFLLSLAVSDLMLCLFCMPFNLIPNLL
hGPR34 88 SIQIYLLNVAIADLLLIFCLPFRIMYHINQ
hGPR52 75 TTSYFIQTMAYADLFVGVSCLVPTLSLLHY
bRhod 107 PTGCNLEGFFATLGGEIALWSLVVLAIERYVVV
hNTS1 138 DAGCRGYYFLRDACTYATALNVASLSVERYLAI
hCCKA 111 SAVCKTTTYFMGTSVSVSTFNLVAISLERYGAI
hGPR34 124 VILCKVVGTLFYMNMYISIILLGFISLDRYIKI
hGPR52 111 SLTCQVFGYIISVLKSVSMACLACISVDRYLAI
bRhod 150 ENHAIMGVAFTWVMALACAAPPLVG
hNTS1 182 RSRTKKFISAIWLASALLTVPMLFT
hCCKA 155 KSHALKVIAATWCLSFTIMTPYPIY
hGPR34 168 TKQSIYVCCIVWMLALGGFLTMIIL
hGPR52 155 PCRLRICIILIWIYSCLIFLPSFFG
bRhod 200 NESFVIYMFVVHFIIPLIVIFFCYGQLVF
hNTS1 233 VKVVIQVNTFMSFIFPMVVISVLNTIIAN
hCCKA 206 QQSWHTFLLLILFLIPGIVMMVAYGLISL
hGPR34 215 GEAIFNFILVVMFWLIFLLIILSYIKIGK
hGPR52 200 SAYFTGFIVCLLYAPAAFVVCFTYFHIFK
bRhod 250 VTRMVIIMVIAFLICWLPYAGVAFYIFT
hNTS1 301 GVRVLRAVVIAFVVCWLPYHVRRLMFCY
hCCKA 311 VIRMLIVIVVLFFLCWMPIFSANAWRAY
hGPR34 264 TARNSFIVLIIFTICFVPYHAFRFIYIS
hGPR52 263 YAMVLFRITSVFYMLWLPYIIYFLLESS
bRhod 286 IFMTIPAFFAKTSAVYNPVIYIMMN
hNTS1 344 YFYMVTNALFYVSSTINPILYNLVS
hCCKA 350 TPISFILLLSYTSSCVNPIIYCFMN
hGPR34 307 KTNEIMLVLSSFNSCLDPVMYFLMS
hGPR52 297 TLSFLTTWLAISNSFCNCVIYSLSN
Fig. 1 Sequence alignment for the 7TM helices of bovine rhodopsin (bRhod),
human NTS1 (hNTS1), human CCKA (hCCKA), human GPR52 (hGPR52), and
human GPR34 (hGPR34) receptors. The conserved residues for class-A GPCRs
are shown in bold. The Val308 residue in hNTS1 is in bold and underlined
a) b) H4 H2
H2
H4 2.46
H5
H3
3.43 2.43
6.40
2.46
3.46 2.43
3.43
H1
6.40
3.46
H6 H7
H3 H6 H7
c) d) H4
H2
H4 H2
H3 H3
H5 H1
H1 6.48
6.44 7.42
6.48
6.44
H5
5.47 H6 H7
5.47 7.42
H7
H6
Fig. 2 (a) Extracellular and (b) membrane views of the NTS1 homology model built using the inactive structure
of rhodopsin 1F88. Residues participating in the hydrophobic core are shown. (c) Extracellular view of the
NTS1 molecular dynamics model. (d) Extracellular view of the NTS1-V308E molecular dynamics model. Main
changes compared with the NTS1 molecular dynamics model are shown by arrows
Modeling and Deorphanization of Orphan GPCRs 419
CAMs with a Mutation at The residue X6.40 (where X is a hydrophobic residue Val, Ile, Leu,
X6.40 or Met) is a hot spot, as mutations decreasing its hydrophobicity
generated CAMs for diverse GPCRs including rhodopsin, musca-
rinic M5, histamine H1, angiotensin AT1A, and opioid receptors
[30]. The hydrophobic core that includes in particular the con-
served Leu3.43 in helix H3 and X6.40 in helix H6 was proposed to
hold H3 and H6 in place in the inactive state for class-A GPCRs.
Rearrangement of the interactions between the residues involved in
this hydrophobic core enables the movement of H6 in the activa-
tion process, with co-occurring movements of H5 and H7.
3.1.2 Active Structures The first reported structure of a GPCR was in 2000, for rhodopsin,
of GPCRs a special GPCR with a covalently bound ligand, the retinal
[34]. Seven years were necessary to develop successful receptor
stabilization and crystallization techniques for GPCRs with diffus-
ible ligands. In 2007, a structure was published for the β2-adrener-
gic receptor [36], followed in 2008 by structures of β1-adrenergic
and adenosine A2A receptors [37, 38]. Since then, there has been
an almost exponential growth in the number of published GPCR
structures (Fig. 3). In early 2016, 146 structures were available in
the PDB repository for 32 different GPCRs in class-A, -B, -C, and
-F [39]. Structural coverage of the GPCR phylogenic tree is under-
way, providing atomic details for drug discovery and drug design
using computational methods [8].
Most GPCR structures were crystallized in complex with
antagonists or inverse agonists, and are therefore in an inactive
state. GPCR structures in a semi-active state cocrystallized with
an agonist, or in a fully active state stabilized in the extracellular
and intracellular sides by, respectively, an agonist and a G protein or
a G protein surrogate, are available for rhodopsin, β2 and β1
adrenergic, adenosine A2A, muscarinic M2, serotonin 5-HT1B
and 5-HT2B, purinergic P2Y12, FFAR1, SMO, and neurotensin
NTS1 receptors [40, 41]. These structures provide invaluable tem-
plates for building increasingly accurate active models for GPCRs
and oGPCRs.
3.2.1 Listing of Potential For searching activators, active GPCR structures or validated
Templates molecular models of CAMs are needed. The GPCRdb database
[39] provides an updated list of GPCR structures.
420
Constantino Diaz et al.
Fig. 3 Bar chart showing the number of new GPCR structures deposited in the PDB database over time. Structures for new receptors are shown in gray
Modeling and Deorphanization of Orphan GPCRs 421
3.2.2 Sequence The sequences are aligned with multiple-sequences alignment tools
Alignment Between like ClustalW [42] and TCoffee [43]. Errors in the initial alignment
the Target are common, and appropriate corrections are generally required,
and the Templates based on the conserved motifs in the 7 TM helices [35], and the
conserved cysteine in EL2 loop.
3.2.4 Building of a Crude Various software packages perform the building of a homology
Homology Model model, given a 3D template and target-template sequences align-
ment. We have used MOE. In the model generation, a large num-
ber of models are built, and the best model in terms of energy is
further refined. Visual inspection terminates the building of the
crude homology model.
3.3 Structure-Based Molecular docking is a powerful technique for the discovery of new
Virtual Screening ligands, and it has been successfully applied to various GPCRs
[19]. The main steps are the definition of the docking site, and
docking and scoring of the compounds in the docking site.
The docking of a compound consists of geometrically fitting a
flexible compound into the docking site which is mostly assumed to
be rigid. The scoring assesses the interactions between the docked
compound and the receptor using force-field, empirical or
knowledge-based functions. The widely used VS programs include
Gold [25], Dock [48], Glide [49], and LigandFit [50]. The dock-
ing and scoring performances vary depending on the target protein.
Benchmarks considering sets of protein structures cocrystallized
with ligands provide objective evaluations [51].
422 Constantino Diaz et al.
4 Notes
4.1.1 VS with an Active A crude active CCKA molecular model (CCKA-MD) was built by
CCKA Model Built Using homology modeling from the NTS1-V308E MD model, according
the MD Template to the alignment in Fig. 1. The CCKA-MD model had only the
7 TM helices, the conserved Cys19645.50 of the extracellular loop
EL2, and the conserved disulfide bridge Cys1143.25-Cys19645.50
with the same geometry as the corresponding cysteine pair in
bovine rhodopsin [34]. The docking site was between the TM
helices and under Cys19645.50.
The enrichment curve resulting from the docking of the CCKA
library into the CCKA-MD model with Gold and the PLP scoring
function is shown in Fig. 4. Enrichment factor (EF) and hit rate
CCKA
100
80
% found agonists
60
40
20
0
0 20 40 60 80 100
Top % of ranked library
CCKA-MD CCKA-4BV0
CCKA-4BUO CCKA-4XES
Fig. 4 Enrichment curves obtained by docking the CCKA library into the four
molecular models CCKA-MD, CCKA-4BUO, CCKA-4BV0, CCKA-4XES with Gold
and the PLP scoring function
Modeling and Deorphanization of Orphan GPCRs 423
Table 1
Enrichment factors (EF) and hit rates (HR) for CCKA agonists resulting from the docking of the CCKA
library into the four molecular models CCKA-MD, CCKA-4BUO, CCKA-4BV0, CCKA-4XES with Gold and
the PLP, ASP, ChemScore, and GoldScore scoring functions. EF and HR are given for the top 1% of the
ranked library
4.1.2 VS with Active To be consistent with the use of a NTS1 molecular dynamics model
CCKA Models Built Using as a template for building a CCKA model for VS, here we explored
PDB Structures the use of NTS1 structures for building CCKA models for VS and
for comparing the results. The three rat NTS1 active structures
with PDB Id 4BUO, 4BV0 [52], and 4XES [53] were used for
building crude active CCKA models by homology modeling,
named respectively CCKA-4BUO, CCKA-4BV0, and CCKA-
4XES. Extracellular loops were modeled based on those of the
NTS1 structures. Importantly, the lengths of loops EL2a and
EL2b, respectively before and after the conserved cysteine in
EL2, are similar for rat NTS1 (respectively 18 and 8 amino acids)
and human CCKA (17 and 9 amino acids).
Enrichment curves for the VS of the CCKA library with the
three models and the PLP scoring function are shown in Fig. 4.
Enrichment factors and hit rates with the four scoring functions,
considering the top-scored 1% of the ranked library, are shown in
Table 1. With the PLP scoring function, similar results were
obtained for the model built using the NTS1-V308E MD tem-
plate, and the three models built using the three NTS1 active
structures. For the four models, the PLP scoring function gener-
ated the best performance. As the goal was to identify agonists, only
the 117 CCKA agonists were considered actives. The 195 CCKA
antagonists in the library were considered to be negative com-
pounds like the 3063 decoys.
Fig. 5 Enrichment curves obtained by docking the GPR52 library into the GPR52-4BV0 molecular model with
Gold and PLP, ASP, ChemScore, and GoldScore scoring functions
Table 2
Enrichment factors (EF) and hit rates (HR) for GPR52 agonists resulting from the docking of the GPR52
library into the GPR52-4BV0 molecular model with Gold and the PLP, ASP, ChemScore, and GoldScore
scoring functions. EF and HR are given for the top 1% of the ranked library
Fig. 6 Enrichment curves obtained by docking the GPR34 library into the GPR34-
4BV0 molecular model with Gold and PLP, ASP, ChemScore, and GoldScore
scoring functions
426 Constantino Diaz et al.
Table 3
Enrichment factors (EF) and hit rates (HR) for GPR34 antagonists resulting from the docking of the
GPR34 library into the GPR34-4BV0 molecular model with Gold and the PLP, ASP, ChemScore, and
GoldScore scoring functions. EF and HR are given for the top 1% of the ranked library
4.4 Perspectives The three retrospective studies show that, using the molecular
modeling and virtual screening techniques described, active com-
pounds were found in VS-lists representing 1% of the screened
libraries. These excellent results were obtained without requiring
prior knowledge of ligands for building the molecular models of
the receptors. Interestingly, among the four tested scoring func-
tions PLP, ASP, ChemScore, and GoldScore, the best results were,
on average, obtained with the PLP scoring function. Recently, a
comparison of 20 scoring functions over a set with 195 diverse
protein-ligand complexes also found Gold/PLP among the top
performers [51]. Surprisingly, the CCKA model built using the
molecular dynamics model of the NTS1-V308E CAM and the
three CCKA models built using NTS1 active structures generated
similar VS results when considering the VS-lists with 1% of the
screened library.
In a previous prospective study [57], we built a GPR34 molec-
ular model by homology to the NTS1-V308E MD model
described in the methods paragraph. The GPR34 model was
refined using active compounds found in an experimental screen-
ing, and it was used to perform the virtual screening of a corporate
library. Three inverse agonists with new chemical structures were
discovered, thus validating the use of molecular models for search-
ing modulators for orphan GPCRs.
In the last years, the almost exponential growth in the number
of published GPCR structures opens up new perspectives for build-
ing increasingly accurate molecular models for oGPCRs, and
searching surrogate ligands using VS.
References
25. Verdonk ML, Cole JC, Hartshorn MJ, Murray DC, Okada T, Stenkamp RE, Yamamoto M,
CW, Taylor RD (2003) Improved protein- Miyano M (2000) Crystal structure of rhodop-
ligand docking using GOLD. Proteins 52 sin: a G protein-coupled receptor. Science 289
(4):609–623. https://doi.org/10.1002/prot. (5480):739–745
10465 35. Baldwin JM, Schertler GF, Unger VM (1997)
26. Ballesteros JA, Weinstein H (1995) Integrated An alpha-carbon template for the transmem-
methods for the construction of three- brane helices in the rhodopsin family of G-
dimensional models and computational prob- protein-coupled receptors. J Mol Biol 272
ing of structure-function relations in G (1):144–164
protein-coupled receptors. Methods Neurosci 36. Cherezov V, Rosenbaum DM, Hanson MA,
25:366–428 Rasmussen SG, Thian FS, Kobilka TS, Choi
27. Berman HM, Kleywegt GJ, Nakamura H, HJ, Kuhn P, Weis WI, Kobilka BK, Stevens
Markley JL (2014) The protein data bank RC (2007) High-resolution crystal structure
archive as an open data resource. J Comput of an engineered human beta2-adrenergic G
Aided Mol Des 28(10):1009–1014. https:// protein-coupled receptor. Science 318
doi.org/10.1007/s10822-014-9770-y (5854):1258–1265. https://doi.org/10.
28. Venkatakrishnan AJ, Deupi X, Lebon G, Hey- 1126/science.1150577
denreich FM, Flock T, Miljus T, Balaji S, 37. Warne T, Serrano-Vega MJ, Baker JG,
Bouvier M, Veprintsev DB, Tate CG, Schertler Moukhametzianov R, Edwards PC,
GF, Babu MM (2016) Diverse activation path- Henderson R, Leslie AG, Tate CG, Schertler
ways in class A GPCRs converge near the G- GF (2008) Structure of a beta1-adrenergic G-
protein-coupling region. Nature 536 protein-coupled receptor. Nature 454
(7617):484–487. https://doi.org/10.1038/ (7203):486–491. https://doi.org/10.1038/
nature19107 nature07101
29. Cotecchia S, Exum S, Caron MG, Lefkowitz 38. Jaakola VP, Griffith MT, Hanson MA,
RJ (1990) Regions of the alpha 1-adrenergic Cherezov V, Chien EY, Lane JR, Ijzerman AP,
receptor involved in coupling to phosphatidy- Stevens RC (2008) The 2.6 angstrom crystal
linositol hydrolysis and enhanced sensitivity of structure of a human A2A adenosine receptor
biological function. Proc Natl Acad Sci U S A bound to an antagonist. Science 322
87(8):2896–2900 (5905):1211–1217. https://doi.org/10.
30. Tehan BG, Bortolato A, Blaney FE, Weir MP, 1126/science.1164772
Mason JS (2014) Unifying family A GPCR 39. Isberg V, Mordalski S, Munk C, Rataj K,
theories of activation. Pharmacol Ther 143 Harpsøe K, Hauser AS, Vroling B, Bojarski
(1):51–60. https://doi.org/10.1016/j. AJ, Vriend G, Gloriam DE (2016) GPCRdb:
pharmthera.2014.02.004 an information system for G protein-coupled
31. Schöneberg T, Schulz A, Biebermann H, receptors. Nucleic Acids Res 44(D1):
Hermsdorf T, Römpler H, Sangkuhl K D356–D364. https://doi.org/10.1093/nar/
(2004) Mutant G-protein-coupled receptors gkv1178
as a cause of human diseases. Pharmacol Ther 40. Cooke RM, Brown AJ, Marshall FH, Mason JS
104(3):173–206. https://doi.org/10.1016/j. (2015) Structures of G protein-coupled recep-
pharmthera.2004.08.008 tors reveal new opportunities for drug discov-
32. Tao YX (2008) Constitutive activation of G ery. Drug Discov Today 20(11):1355–1364.
protein-coupled receptors and diseases: https://doi.org/10.1016/j.drudis.2015.08.
insights into mechanisms of activation and 003
therapeutics. Pharmacol Ther 120 41. Shonberg J, Kling RC, Gmeiner P, Löber S
(2):129–148. https://doi.org/10.1016/j. (2015) GPCR crystal structures: medicinal
pharmthera.2008.07.005 chemistry in the pocket. Bioorg Med Chem
33. Diaz C, Leplatois P, Angelloz-Nicoud P, 23(14):3880–3906. https://doi.org/10.
Lecomte M, Josse A, Delpech M, Pecceu F, 1016/j.bmc.2014.12.034
Loison G, Shire D, Pascal M, Ferrara P, Ferran 42. Larkin MA, Blackshields G, Brown NP,
E (2011) Differential virtual screening (DVS) Chenna R, McGettigan PA, McWilliam H,
with active and inactive molecular models for Valentin F, Wallace IM, Wilm A, Lopez R,
finding and profiling GPCR modulators: case Thompson JD, Gibson TJ, Higgins DG
of the CCK1 receptor. Mol Inf 30 (2007) Clustal W and clustal X version 2.0.
(4):345–358. https://doi.org/10.1002/minf. Bioinformatics 23(21):2947–2948. https://
201000180 doi.org/10.1093/bioinformatics/btm404
34. Palczewski K, Kumasaka T, Hori T, Behnke 43. Notredame C, Higgins DG, Heringa J (2000)
CA, Motoshima H, Fox BA, Le Trong I, Teller T-coffee: a novel method for fast and accurate
Modeling and Deorphanization of Orphan GPCRs 429
A B
A1A adenosine receptor (A1AAR) ...................... 55, 60–62 Ballesteros and Weinstein (BW) .......... 76–78, 81, 84, 85,
A2A adenosine receptor (A2AAR) .............. 4, 6–9, 14, 26, 91, 95, 96, 98, 99, 102, 185, 189, 200, 299, 416
35, 36, 41, 55, 56, 59–62, 67, 143, 144 Ballesteros and Weinstein residue numbering
A3 adenosine receptor (A3AR) ......................... 25, 53–55, scheme..................76, 78, 84, 200, 273, 338, 339
59–62, 67, 143, 144 BED-ROC ..................................................................... 236
A3AR agonists .................................................... 59–61, 67 Biased ligands ...................... 98, 139, 287, 298, 321–331
ACPYPE ........................................................................ 309 Biased molecular dynamics simulations .............. 351–361
Activation................. 3, 53, 74, 123, 134, 185, 198, 241, Binary switches ..................................................... 282, 284
267, 303, 322, 352, 380, 416 Binding energy .............................................................. 184
Adaptive sampling ................................................ 323–326 Binding kinetics...........................59, 133, 136, 141, 198,
Adenosine receptor (AR)..................................25, 26, 46, 279, 330
141, 143, 275, 282, 291, 292, 336, 341, 342, Binding pose.................30, 36, 116, 128, 140, 151, 199,
358, 385, 417 352, 353, 356–358, 379
Adrenergic β1 receptor (β1AR).................. 185, 187, 188, Binding site (B site) ....................5, 24, 50, 74, 115, 134,
268, 270, 280, 281, 311 164, 199, 209, 241, 265, 301, 327, 336, 352,
Adrenergic β2 receptor (β2AR)................ 2, 4, 5, 7–9, 17, 379, 400
185, 187, 192, 268–270, 272, 273, 275–283, BindingDB ........................................................... 237, 396
287–289, 322, 326 BioAssay......................................................................... 396
Agonist....................... 4, 27, 46, 95, 116, 134, 185, 198, Biophysical mapping (BPM) ....................................25, 52
244, 265, 298, 326, 336, 352, 381, 414 BLAST .................................................................... 28, 123
Allosteric mechanism .................144, 146, 305, 306, 311 BMS-986187.......................................353, 356–358, 360
Allosteric modulation ............................55, 67, 144, 298,
304, 305, 311, 312, 383 C
Allosteric modulators ........................................15, 46, 55, C4XD.................................................................... 381, 382
62, 67, 74, 83, 84, 92, 99, 249, 251, 297–314, Cambridge Structural Database (CSD) ......................160,
352, 357, 400
176, 397
AMBER ............................. 140, 237, 284, 360, 380, 388 CANVAS........................................................................ 237
AMBER10:EHT ........................................................... 185 Carazolol ................................6, 277–279, 287, 326, 328
AMBER/Slipids ............................................................ 308
CATALYST ................................................................... 237
AMD11070 ................................................................... 311 C-C chemokine receptor type 2 (CCR2) ............ 5, 6, 76,
Angiotensin II receptor, type 1 (AT1) .............27, 31, 34, 85, 246, 352
38, 39, 84, 96, 97, 327, 417
C-C chemokine receptor type 5 (CCR5) .............. 16, 91,
Angiotensin II receptor, type 2 (AT2) ................... 27, 28, 92, 246
31, 34, 35, 38, 39, 84 C-C chemokine receptor type 9 (CCR9) ...................5, 6,
Antagonist .......................... 4, 27, 47, 85, 134, 185, 199,
246, 252, 352
207, 244, 265, 310, 341, 353, 381, 403, 414 Cencriviroc .................................................................... 246
β-Arrestin ......................5, 9, 17, 98, 312, 322, 324, 327, CHARMM ........................................ 152, 284, 307, 308,
352, 389, 416 353–355, 414
ASP ...............................................................415, 423–426
CHARMM-GUI Membrane Builder........................... 308
ATI-2341....................................................................... 310 ChemAxon .................................................................... 415
AutoDock ...................................120, 237, 280, 380, 381 ChemBioBase ................................................................ 237
AutoDock Vina ..........................136, 280, 281, 380, 385
ChEMBL ................................ 92, 97, 99, 119, 237, 396,
Automated topology builder (ATB) ............................ 309 402, 414
AZD1283 ............................................................. 9, 56, 64 Chemical fingerprints.................................................... 404
Alexander Heifetz (ed.), Computational Methods for GPCR Drug Discovery, Methods in Molecular Biology, vol. 1705,
https://doi.org/10.1007/978-1-4939-7465-8, © Springer Science+Business Media LLC 2018
431
COMPUTATIONAL METHODS FOR GPCR DRUG DISCOVERY
432 Index
Cheminformatics................................... 99, 102, 396–409 DOCK ............................................................95, 237, 324
Chemogenomics .......................... 73–102, 242, 248, 398 Docking ............................13, 27, 48, 98, 117, 136, 208,
ChemPLP ...................................................................... 275 235, 265, 306, 322, 336, 348, 351, 378, 400, 415
ChemScore ..................................... 35, 36, 415, 423–426 Docking protocols ......................... 34, 35, 380, 381, 388
Cholecystokinin receptor (CCKA)..................... 414, 417, Dopamine D2 receptor (D2R).....................277–279, 327
422–424, 426 Dopamine D3 receptor (D3R).........................8, 275, 313
Cinacalcet ...................................................................... 298 Dopamine D4 receptor (D4R)...................................... 290
Clarivate Analytics’ Integrity database ......................... 237 DOPE-HR scoring function .......................................... 36
Clustering ......................... 36, 84, 85, 92, 120, 123, 125, 3D-QSAR .................................................... 366, 382, 404
268, 291, 312, 324, 338, 357, 358 3D-RISM........................... 120, 125, 171, 237, 385, 386
CNS disorders ...................................................... 233, 249 Drive signaling bias ..................................... 322, 329, 330
CoINPocket .................................................................... 92 Drug Guru .................................................................... 402
Collective variables (CVs)................. 140, 141, 145, 151, Drug-likeness or Drug-like ...................65, 67, 119, 239,
199, 286, 356 240, 271, 312, 406–408
ColorTanimoto (CT).................................. 368, 371, 372
Comparative structural analysis ......................... 76–81, 83 E
Computer-aided drug discovery (CADD) ............ 45, 47, Electrostatic Maps ........................................164–171, 176
50–55, 58–62, 64–67, 306, 312, 351, 365–373
ElectrostaticTanimoto (ET) ......................................... 369
Conformational space ....................... 123, 128, 282, 299, Enhanced sampling ............................136, 137, 139–141,
322–324, 326, 328, 331, 338, 342, 376 145, 199, 351
Conformational universe ..................................... 322–326 Enrichment factor (EF) ............................. 236, 268, 278,
Constitutively activated mutant (CAM) .....416–418, 426
279, 312, 415, 422–426
Contact statistics ........................................................... 176 EON ..................................................................... 366, 369
Contract research organizations (CROs) .................... 348 Epik .................................................................................. 35
Corticotropin-releasing factor receptor 1
Epinephrine ................................185, 186, 268, 279, 287
(CRF1R)........................5, 6, 76, 82, 99, 251, 310
CPU ................. 137, 182, 212, 227, 228, 236, 368, 385 F
Cresset .................................................................. 120, 237
CRISPR ......................................................................... 399 FASTA .................................................................... 28, 122
CWxP motif................................................................... 146 Fenoterol ....................................................................... 279
CWxP toggle switch ......................................................... 8 Fingerprint similarity ........................................... 243, 249
C-X-C chemokine receptor type 4 (CXCR4) ...........9, 76, Fingerprints (FPs) .................................... 84, 90, 98, 237,
81, 82, 116, 134, 244, 275, 310 239, 241, 265, 267–276, 280, 288, 312, 329,
331, 357, 358, 366, 403, 404
D Flexible docking .......................................... 379, 381, 388
FlexX ............................................................ 237, 270, 380
Dahliawaterscore .................................................. 220, 224 Flibanserin ..................................................................... 290
Data fusion ............... 235–237, 243, 246, 247, 249, 253
FMO-DFTB ......................................................... 182, 385
Data mining................ 99, 234, 235, 237, 238, 246, 252 FMO-MP2 .................................................................... 182
Decision trees (DT) .................................... 241, 280, 398 Force field (FF) .........................140, 147, 180, 182, 208,
δ-opioid receptor (DOR) ............................ 92, 353, 354,
209, 215, 223, 307, 308, 312, 338, 354, 360,
356–358, 360, 361 380, 383, 414, 421
De novo design.....................................327, 329, 401–403 Fragment-based drug discovery (FBDD)..................... 52,
Density functional theory (DFT)................................. 291 182, 378
Density-functional tight-binding (DFTB) ......... 182, 385
Fragment molecular orbital (FMO)................... 179–192,
Deorphanization .................................................. 413–426 378, 379, 383–385
(D/E)RY motif ............................................................. 267 FRED............................................................................. 237
DESMOND ................................................ 137, 237, 284
Free-electron laser (XFEL) ............................................. 53
Dimensionality reduction .................................... 322–325 Free-energy............................24, 27, 30–33, 38, 40, 117,
Dipalmitoylphosphatidylcholine (DPPC) 125, 135, 139, 140, 145, 166, 265, 280, 281,
bilayer........................................................ 135, 151
285–287, 346, 356–358, 386
Directory of Useful Decoys (DUD) ...........................235, Free energy perturbation (FEP).......................27, 31, 32,
370–373, 414 38, 40, 207, 208, 346
Dissociation pathway ........................................... 201–203 Free-Wilson analysis ...................................................... 403
Dissociation rate................................................... 201, 202
COMPUTATIONAL METHODS FOR GPCR DRUG DISCOVERY
Index 433
G 5-Hydroxytryptamine 2A (5-HT2A) receptor ... 249, 290,
329, 389
GAFF force field................................................... 208, 215 5-Hydroxytryptamine 2B (5-HT2B) receptor ..... 3, 9, 92,
Gaussian...............................................286, 354, 368, 382 116, 324, 329, 388, 389, 417
General Atomic and Molecular Electronic Structure 5-Hydroxytryptamine 2C (5-HT2C) receptor ... 388, 389
System (GAMESS) ................................... 183, 291
GLIDA............................................................92, 281, 396 I
GLIDE....................... 41, 120, 136, 237, 270, 280, 312,
353, 380, 421 Induced fit docking (IFD)........... 36, 237, 243, 279, 381
GOLD .................................... 30, 35, 36, 136, 151, 237, Integrity (Clarivate Analytics 2017) ............................ 237
380, 381, 388, 389 Interaction fingerprints (IFPs) ...98, 237, 243, 244, 249,
GoldScore .....................................................415, 423–426 251, 253, 267–274, 276, 312, 329, 357, 358
GPCRdb .......................39, 79, 81, 92–97, 99, 102, 118, Interconversion ............................................................. 265
119, 122, 128, 146, 272, 340, 396 Ionic lock 3, 7, 16, 77, 79, 99, 140, 141, 143, 146, 267,
GPCR-likeness assessment score (GLAS)...................338, 287
379, 381 Isoproterenol ................................................................. 279
GPCR-lipid interactions ..................................... 143, 146, I-TASSER ...................................................................... 237
147, 149, 150 IUPHAR/BPS ..................................................... 118, 396
GPCRM.................................................................. 39, 272
K
GPCR-ModSim....................................28, 29, 31, 36, 38,
39, 41, 119, 129 KiDB ................................................................................ 92
GPCR SarFari................................................................ 237 Kinetics ........... 9, 17, 59, 133, 136, 141, 142, 198, 199,
GPR34 ........................................414, 415, 417, 425, 426 201–203, 207, 208, 279, 305, 322–325, 330,
GPR52 .................................................414, 417, 423, 424 335, 358, 376, 381, 383, 385
Graphics processing units (GPUs) ..................... 137, 207, KNIME................... 81, 97, 99, 102, 237, 379, 386, 387
236, 312, 345
GRID ..................................................164–166, 208, 209, L
227, 228, 237, 249
Lead discovery...................................................... 365–372
GRID-type methodology ............................................. 165
Lead optimization (LO) .. 115–117, 121, 126, 183, 204,
GROMACS ...........................34, 42, 137, 152, 208–210,
239, 279, 375, 376
213, 215, 284, 286, 354, 355, 390
Lead-like ...................................................... 239, 277, 280
GROMOS ..................................................................... 308
Lennard-Jones van der Waals energies................ 164, 166
GSK812397................................................................... 311
Library curation ............................................................ 234
Library design ............................................. 399, 400, 407
H
Liceptor ......................................................................... 396
HADDOCK ..............................................................30, 36 Ligand-based drug design (LBDD)............................. 382
HGMP-C4XD............................................................... 381 Ligand-based lead discovery (LBLD) 365, 366, 371, 372
Hierarchical GPCR modeling protocol Ligand-based virtual screening (LBVS).... 235, 239, 241,
(HGMP) ......................... 336, 378–382, 387–390 249, 252, 253
High-throughput screening (HTS) ..................... 65, 198, Ligand binding pathway ...................................... 142–145
234, 238, 249, 252, 313, 331, 365, 376, 387, Ligand dissociation .............................................. 197–204
405–407, 414 Ligand-receptor vibrational modes..................... 288, 289
Hit rate (HR) .................................... 13, 60, 62, 98, 249, Ligand repurposing................................... 84, 85, 92, 102
251, 271, 275, 276, 280, 388, 399, 400, 415, LigandScout .................................................................. 237
422–426 LigPrep .............................................................35, 36, 237
Hit-to-lead (H2L)...............................183, 198, 375–391 Lipid Builder ................................................................. 308
Homology modeling ...........................14, 26, 28, 29, 31, Lipophilicity ......................................................... 239, 404
34, 36, 64, 65, 81, 98, 102, 115, 119–121, 123, 3–7 Lock........................................................................ 267
128, 129, 237, 244, 252, 253, 272, 328, 338, Long-time scale MD ................................... 135, 138, 139
354, 379, 390 Low-mode molecular dynamics (LowModeMD) ....... 383
5-HT2C agonists .................................................. 388, 389 LY2033298 .......................................................... 298, 299
H€uckel Theory ..................................................... 171, 176 Lysophosphatidylserine (LPS)...................................... 425
5-Hydroxytryptamine 1A (5-HT1A) receptor ............134,
270, 271, 290, 291, 329
COMPUTATIONAL METHODS FOR GPCR DRUG DISCOVERY
434 Index
M Nucleotides......................25, 46, 56, 64, 65, 73, 76, 413
Numbering framework ...................................... 76–81, 83
MACCS keys ................................................................. 404 Numbering schemes ....................... 7, 76, 77, 79, 81, 84,
Machine learning....... 90, 237, 239, 241, 243, 246, 268, 97, 99, 102, 185, 273, 338, 339
290–292, 403, 405, 408
Maraviroc................................................................ 91, 298 O
Markov state models (MSMs) .. 138, 322–326, 328, 354,
358, 383 Off-rate (koff)............................................... 203, 207, 383
Markush patterns .......................................................... 396 Oliceridine (TRV130) ................................ 143, 298, 330
Matched-pairs................................................................ 403 OMEGA ..............................................237, 367, 369–372
MATLAB .............................................................. 120, 125 On-rate (kon) ................................................................. 198
Maximum Unbiased Validation (MUV)...................... 235 OPLS-AA................................................... 31, 39, 42, 338
Melanin-concentrating hormone-1 receptor (MCH-1R) Orexin receptors................................................... 117, 389
387, 388 Orphan GPCRs (oGPCR)............. 85, 93, 248, 398, 413
MemProtMD database ................................................. 151 Orthosteric HUB site .................................................9, 14
Metadynamics54, 59, 140, 141, 145, 151, 199, 203, 265, Orthosteric ligands ..............................2, 46, 57, 62, 200,
285–287, 352, 354–358, 383 298, 299, 301, 303–305, 352, 358, 360
Metastable states ........................323, 324, 326, 357, 358 Orthosteric pocket ...................................... 8, 9, 144, 310
Method validation......................................................... 234
P
MM_PBSA/GBSA........................................................ 380
M2 muscarinic receptor (M2R) ........................... 312, 352 P2Y receptors .................................................................. 66
M3 muscarinic receptor (M3R) .................................... 353 P2Y1 receptor (P2Y1R).........................51, 53, 57, 62, 64
Model development ............................................. 234, 243 P2Y12 receptor (P2Y12R) ............................ 9, 48, 51, 53,
Model generation.........................................115–129, 421 57, 62, 64, 65, 67, 417, 425
MODELLER .............................119, 237, 338, 353, 354 P2Y13 receptor (P2Y13R) ............................................... 48
Molecular dynamics (MD) simulations4, 7, 99, 133–152, P2Y1R allosteric modulators ....................................58, 67
199–204, 236, 265, 284, 285, 304, 306, 311, P2Y14 receptor (P2Y14R) .................................. 48, 64–66
327, 328, 346, 351 Pair Interaction Energies Decomposition Analysis
Molecular fingerprints ............... 265, 267–273, 275, 276 (PIEDA)............................................................. 384
Molecular operating environment (MOE)........ 119, 120, Pair interaction energy (PIE) .................... 180, 181, 184,
124–126, 338 188, 384
Monte Carlo (MC) simulations ................................... 386 Pair interaction energy decomposition analysis
MSMBUILDER............................................................ 358 (PIEDA)...................................180, 181, 188, 189
Multi-parameter optimisation (MPO)........402, 406–408 Pan-Assay INterference compounds (PAINS) ............ 239
Multiple sequence alignment (MSA) ..............28, 38, 336 PARAFIT....................................................................... 237
Multiple-walker metadynamics............................ 355–357 Periodic boundary conditions (PBC) ................... 29, 152
μ-opioid receptor (MOR).......... 352–354, 358, 360, 361 Pharmacophore ...2, 13, 56, 84, 85, 90, 91, 95, 96, 102,
119, 120, 126, 127, 142, 160, 163, 171–176,
N 235, 237, 239–241, 248, 249, 251–253, 312
NAMD.................................................237, 284, 354, 355 Pharmacophore annotation ......................................93, 99
Nanobody4, 55, 137, 143, 146, 147, 287, 307, 355, 358, Pharmacophore 3D....................................................... 163
360 Pharmacophore screening ...........................171–175, 241
N-body Information Theory (NbIT) analysis.... 309, 358 Pharmacophore search ................................ 174, 176, 366
Negative allosteric modulator (NAM) 7, 57, 84, 99, 116, Phase ..................................... 3, 12, 40, 52, 59, 116, 237,
249, 251, 252, 312, 313, 352 244, 376, 380, 391
Network correlation analysis .......................265, 281–285 PIF motif .............................................................. 137, 151
Network of binary switches .......................................... 282 Pipeline-Pilot ................................................................. 387
Neuropeptide-Y (NPY) receptor..............................25, 27 PLANTS ........................................................................ 276
NIH Molecular Libraries .............................................. 399 Plerixafor........................................................................ 298
NMR ............................................................ 2, 29, 52, 381 PLP ...............................................................415, 422–426
Non-classical H-bonds..................... 54, 57, 86, 200, 273 Plumed........................................................................... 286
Non-intuitive interactions ............................................ 180 PLUMED ............................................................. 140, 354
NTS1 receptor...................................................... 416, 417 Poisson-Boltzman (PB) ................................................ 369
Nucleosides.................................................. 46, 53, 56, 61 Poisson–Boltzmann Equation (PBE) .........164–167, 176
COMPUTATIONAL METHODS FOR GPCR DRUG DISCOVERY
Index 435
Polarizable continuum solvent model (PCM) ............ 184 S
POPC.......................... 29, 143, 146, 149, 270, 285, 355
Positive allosteric modulator (PAM)...................... 62, 99, Scaffold .............................26, 33, 36, 38, 60, 63, 67, 84,
116, 143, 249, 252, 312, 352, 353, 357, 358 85, 126, 174–176, 238, 239, 246, 248, 249, 272,
PRIME........................................................................... 237 273, 276, 280, 308, 313, 378, 385, 403
Principal component analysis (PCA).................. 288–290, Screening ............................ 5, 23, 48, 84, 117, 160, 198,
309, 323 234, 268, 304, 322, 346, 365, 376, 414
Principal components (PC) ................................. 309, 323 SDFile .............................................................................. 35
Probe dependence................................................ 298–300 Sequence alignment .........28, 29, 38, 76, 77, 79, 84, 85,
PRODRG ...................................................................... 309 96, 97, 99, 118–123, 244, 336, 338, 379, 417, 421
ProS ............................................................. 338, 379, 381 ShapeScreen................................................................... 237
Protein data bank (PDB) .................................... 6, 9, 116, Shape search ......................................................... 239, 240
119, 123, 159, 199, 200, 202, 203, 241 Shape similarity............................................ 366, 367, 369
Protein–ligand interaction fingerprints ShapeTanimoto (ST)...........................368, 369, 371, 372
(IFPs) ................................ 98, 267, 268, 312, 329 Signal transduction ........................ 74, 79, 134, 147, 248
Protein–ligand interactions........................ 24, 93, 98, 99, Signaling bias......................................... 61, 312, 329–331
142, 146, 159–176, 180, 192, 267, 268, 271, Signaling network ......................................................... 282
272, 329, 330, 348 Site-directed mutagenesis (SDM) ..................56, 62, 202,
Protonate3D......................................................... 174, 185 327, 329, 335–342, 380
PubChem.............................................................. 237, 396 SMILES ......................................................................... 240
PyEMMA..................................................... 324, 354, 358 Sodium site ........................................................................ 7
PyMemDyn ...............................................................29, 39 Structural interaction fingerprint (SIFt) ...................... 268
PyMOL ........................... 30, 34, 40, 208–210, 219, 339, Structure-activity relationships (SAR) ................... 15, 27,
340, 354, 355 29, 31, 33, 38, 40, 45, 56, 58, 64, 83, 84, 117,
120, 127, 128, 180, 249, 252, 253, 289, 348, 387
Q Structure-based drug design (SBDD) ................. 60, 136,
182, 198, 204, 310–313, 335
Quantitative structure-activity relationships Structure-based virtual screening (SBVS) ..................234,
(QSAR) ............................25, 126, 183, 289, 291, 271, 275, 306, 312, 313, 328, 329, 421
366, 378, 382, 403–405 Supervised molecular dynamics (SuMD) .............. 62, 65,
Quantitative structure-property relationships 143, 144
(QSPR) ..................................................... 403–405 SureChEMBL....................................................... 396, 415
Quantum mechanics (QM) ....................... 180, 182–184, Surflex ................................................................... 237, 270
354, 383 Surflex-Sim .................................................................... 237
SWISS-MODEL ........................................................... 237
R
Switches ...............................................267, 271, 282, 285
RDKit ............................................................................ 237 SZMAP ................................................................. 237, 249
Reaction mining ................................................... 401–403
Reaxys Medicinal Chemistry ........................................ 396 T
RECAP .......................................................................... 238 Tanimoto coefficient (Tc) .................................... 268, 368
Receiver operating characteristic (ROC) .............. 96, 236 TanimotoCombo (TC)............................... 368, 371, 372
Receptor-ligand interactions .............................. 187, 322, Target identification............................................. 397–399
329, 330, 383, 385 Temperature-accelerated molecular dynamics
Receptor plasticity ................................................... 51, 61, (TAMD)............................................................. 202
136, 207 Time-dependent Independent Component Analysis
Residence time (RT) ............................59, 197, 279, 336, (tICA) ................................................................ 323
383, 385, 391 Tiotropium ...................................................199–201, 353
RESP charges ................................................................ 309 Toggle switch ...................... 7, 8, 79, 140, 267, 281, 287
RNAi .............................................................................. 399 TopolGen....................................................................... 309
Robust Initial Enhancement (RIE).............................. 236 Transmission switch ............................................... 99, 267
ROC EF......................................................................... 236 Trp rotamer toggle switch............................................ 267
ROCS.......................................... 237, 366, 368–373, 382 TRV-130....................................139, 143, 352, 353, 355,
ROSETTA ..................................................................... 353 357, 358, 360
Rule of 5 ............................................................... 239, 407 Tyr rotamer toggle switch ............................................ 267
COMPUTATIONAL METHODS FOR GPCR DRUG DISCOVERY
436 Index
U WaterMap ......................... 120, 208, 209, 222–227, 237,
249, 385, 386
Unbiased molecular dynamics simulations .................. 198 Water perturbation.................................33, 40, 183, 207,
UniProt.................28, 31, 78, 81, 91, 99, 118, 122, 123 208, 346
V X
Virtual libraries.............................................238, 401–403 X-ray crystallography .............................45, 59, 134, 135,
Virtual screening (VS) ...................... 13, 24, 52, 95, 117, 143, 252, 310, 322, 348, 375
160, 233, 270, 304, 322, 365, 376, 414
VMD ....................................................151, 289, 330, 354 Z
W Zinc .............................................................. 238, 277, 301
ZM241385 ...........................................7, 26, 53, 56, 143,
WaterDock............................................................ 141, 385 144, 201–204
WaterFLAP ................................. 208–223, 227–231, 385