22nd Annual Report 2015 16

Board of Directors (as at March 31, 2016)
Mr. R. Seshasayee, Chairman

Mrs. Kanchan Chitale
Mr. Vijay Vaid
Mr. T. Anantha Narayanan
Mr. Ranbir Singh Butola
Mr. Yashodhan Kale
Mr. Shanker Annaswamy
Dr. T. T. Ram Mohan (appointed on May 12, 2016)
Mr. Romesh Sobti, Managing Director & CEO
Company Secretary Contents Page No.

Mr. Haresh K. Gajwani
Directors’ Report ....................................................... 15
Management Discussion & Analysis ......................... 72
Corporate Governance ........................................... 109

Auditors
Price Waterhouse Chartered Accountants LLP Independent Auditor’s Report ................................ 138
252, Veer Savarkar Marg Balance Sheet ......................................................... 142
Shivaji Park, Dadar (West)
Mumbai - 400 028 3URÀW /RVV$FFRXQW ............................................. 143
Cash Flow Statement .............................................. 144
Schedules ............................................................... 145
Registrar & Share Transfer Agent 6LJQLÀFDQW$FFRXQWLQJ3ROLFLHV............................... 151

Link Intime India Pvt. Ltd.
Notes on Accounts ................................................. 158
C-13, Pannalal Silk Mills Compound
L.B.S. Marg, Bhandup (West) Disclosures under Basel III
Mumbai – 400 078 Capital Regulations .................................................. 196
Tel: 022 25946980 / 25963838 Balance Sheet in US Dollars ................................... 253
Fax: 022 25946969
Branch Network ...................................................... 254
5HJLVWHUHG2IÀFH &RUSRUDWH2IÀFH Secretarial & Investor Services

2401, Gen. Thimmayya Road 8th Floor, Tower 1, One Indiabulls Centre 731, Solitaire Corporate Park
(Cantonment) 841, Senapati Bapat Marg 167, Guru Hargovindji Marg
Pune - 411001 Elphinstone Road (W) Andheri (E), Mumbai 400 093
Mumbai – 400 013
Message from Managing Director
Dear Shareholders,
The year 2015-16 was another year of determined execution and delivery, resulting in improved all around performance of your
Bank. We expanded our branch network, launched new digital initiatives, strengthened existing ones, forged new partnerships
and intensified engagement with our customers. Our efforts to make operations more efficient, reduce credit risks and focus on
capital discipline also bore fruit. We are, thus, on course to meet our strategic goals and build a stronger IndusInd Bank in the
coming years.
As part of our efforts to provide expanded services to existing and new customers in Rural India - the new frontier of growth - we
launched a slew of banking products that are convenient and easy to use, and have moved towards tapping this important
market through our physical and digital networks. We are happy to mention that our Micro-Lending business has enriched the
lives of the rural populace and created livelihoods for them. For us, this is a great news as it inspires us to move ahead in our
Financial Inclusion goal. It is our endeavour to impact lives at all levels of banking.
The last financial year was not easy for the banking sector, but it did not deter us from posting growth across all key parameters.
While Net Profit rose 27 per cent, to ` 2,286.45 crore against ` 1,793.72 crore in FY15, Net Interest Income was up 32 per cent,
to ` 4,516.57 crore compared to ` 3,420.28 crore in the previous year. Return on Assets was 1.91 per cent against 1.90 per cent
in FY15. In addition, total advances and deposits registered a growth of 29 per cent and 25 per cent, respectively.
The Bank’s healthy profitability is a clear indication that we have run the extra distance to achieve our objectives and cement our
place as a consistent player in the banking industry.
As in previous years, expansion continued to be the focal point of our core business in FY16. We opened 199 new branches and
313 ATMs in both urban and rural areas. As of March 31, 2016, IndusInd Bank had 1,000 branches and 1,800 ATMs spread
across 623 geographical locations in the country. We are moving towards opening 1,200 branches by March 2017.
During the year, your Bank unveiled new technological initiatives, particularly in the areas of digital capabilities. In this context, we
formed a strategic partnership with PayU India, apart from launching a host of digital services like ‘QuickPay’ - an instant money
transfer solution, ‘Onthego’ social banking that lets you transfer money using social media, ‘Swiftpay’ - a one stop solution n for
easy bill payments and made the ‘IndusMobile’ app more consumer intuitive.
The Bank also launched ‘IndusInd For Sports’, its non-banking sports vertical. Under this venture we launched ‘IndusInd
of-its-kind platform exclusively designed for differently-abled sportspersons.
Umang’, a first-of-its-kind
IndusInd Bank’ss sustained performance in 2015-16 is reflected in the many accolades it earned during the
year. Your Bank moved up six ranks, to 13th place, to become the Top Riser in BrandZ Top 50 Most Valuable
Indian Brands of 2015, as adjudged by WPP and Millward Brown. IndusInd Bank was bestowed with the
‘Best Bank 2015’
5’ award by Business India.
My message would
ould be incomplete without mentioning the contribution of two of our Bank’s most important
stakeholders - our customers and our employees. To them, I offer my sincere gratitude for their unwavering
commitment to the Bank.
I would also like to thank the central and regulatory authorities and agencies for their support.
Finally, my sincere
cere appreciation to my colleagues on the Board for guiding and supporting the
management teamam in its endeavours.
Thank you.
Yours Sincerely,
y,
Romesh Sobti
obti
Managing Director
ector & CEO
Annual Report 2015-16
Key Business Highlights
Ratings
R ti
| ICRA AA+ for Lower Tier II subordinate debt program by ICRA
| ICRA AA for Upper Tier II subordinate debt program by ICRA
| CRISIL A1+ for certificate of deposit program by CRISIL
| IND A1+ for Short Term Debt Instruments by India Ratings and Research
| IND AA+ for Lower Tier II subordinate debt program by India Ratings and Research
| IND AA+ for Senior unsecured bonds program by India Ratings and Research
| IND AA for Upper Tier II subordinate debt program by India Ratings and Research
0400
Consistent delivery over the past 3 years
1.81% 1.90% 1.91% 17.48% 18.59% 16.78%
Return on Assets Return on Equity
FY14 FY15 FY16 FY14 FY15 FY16
3.71% 3.65% 3.81% 47.11% 48.09% 47.00%
Net Interest Margin Cost / Income
26.85 33.99 39.68 164.55 189.42 289.40
Earning per Share Book Value per Share

(` per share) (` per share)
0050
Awards & Accolades
Moved up 6 ranks, to 13th place from 19th place of last ‘Golden Peacock Award for Innovation Management’
year, makes us the Top Riser in the ‘BrandZ Top 50 Most presented at the 15th London Global Convention on
Valuable Indian Brands of 2015’ as adjudged by WPP Corporate Governance & Sustainability
and Millward Brown
CMO Asia 2015 award for ‘Excellence in Social Media &
Awarded as the ‘Best Bank 2015’ by Business India Digital Marketing’ for Best Integrated Digital Campaign
The most prestigious business award ‘EY for Video Branch
Entrepreneurial CEO of the Year 2015’ to Mr. Romesh
Sobti, MD & CEO at the 17th EY Entrepreneur of the Year Winner of ‘Excellent Performance in NFS ATM Network’
2015 India awards and Joint Runner-up for ‘Excellent Performance in
‘Banker of the Year’ awarded to Mr. Romesh Sobti, MD & NACH’ in Small Banks Category at the National
Payments Excellence Awards 2015
CEO at the FE India’s Best Banks Award 2015
‘Best Bank Award’ for Electronic Payment System ‘Top honors’ at the Cyber Security for Business Impact
among Mid-sized Banks by IDRBT conference organized by CSOFORUM for implementing
security projects having positive Business Impact
‘Best Cash Management Solution’, ‘Best Electronic
Implementation Solution’ & ‘Best Liquidity Management IBA Banking Technology Conference, Expo & Awards 2016
Solution’ at The Asset-Treasury, Trade and Risk
Winners in the categories
Management Awards 2015 under the Country Category
‘Best Payments Initiative’ amongst Small banks
‘Outstanding Achievement in Safety Management’ in the

‘Best Financial Inclusive Initiative’ amongst
Banking Sector - Category: Gold by GreenTech Foundation, Small banks
New Delhi & National Safety Council of Singapore
Runner-up in the category
Winner of 3 awards as ‘Best Bank Financing the Industry’ ‘Best Fraud and Risk Management Initiative’ amongst
by India Gem & Jewellery Awards 2015. Highest Finance Small banks
Sanctioned (Exports), Highest Limits Sanctioned,
Highest Growth of Limits Sanctioned
‘Excellence in Procurement Sustainability’ Runner-up
The Asian Banker Achievement Awards 2015, Technology Award in 3rd Annual CPO Forum
Implementation Awards for ‘Best CRM Project’
0600
The Core Executive Team
Romesh Sobti Paul Abraham Suhail Chander Sumant Kathpalia

Managing Chief Head - Corporate Head - Consumer
Director & CEO Operating Officer & Commercial Banking Banking
K. S. Sridhar Arun Khurana S. V. Parthasarathy Ramesh Ganesan

Senior Executive Head - Global Head - Consumer Head -
Vice President Markets Group Finance Transaction Banking
S. V. Zaregaonkar Sanjeev Anand Zubin Mody Sanjay Mallik

Country Head - Commercial Head - Human Head - Investor
&KLHI)LQDQFLDO2IÀFHU Banking & Deputy Head - Resources Relations & Strategy
Corporate & Commercial Banking
Ramaswamy Roopa Satish

Meyyappan Country Head -
Corporate, Institutions &
Chief Risk Officer Investment Banking
0070
The Year That Was

The Bank’s focus during the year 2015-16 was to sustain and maintain the Bank as a high
street brand. To attain this objective, the Bank adopted various initiatives which led to
increasing its visibility while communicating with consumers in their space, using the most
engaging approach - digital.
anytime, anywhere. It also enables transactions via
Digital & Social Initiatives
biometric authentication and secure swipe pattern
instead of PINs.
During the year, the Bank launched various IndusCube app, the one stop solution
initiatives to enhance the digital capabilities of the from IndusInd Bank that makes bill
Brand and also to stay connected with the payments easy.
new-age tech savvy customers.
IndusInd Bank on Social Media
On the social front, the Bank has been very

An Instant money transfer service wherein
active on Facebook, Twitter and LinkedIn
IndusInd Bank customers can send money to
throughout the year and stands tall today with a
their personal contacts and/or business parties
fan base of around 6.7 Lakh followers on
through SMS, e-mail and social media
Facebook, 21,000 on Twitter and 38,000 on
platforms, without having the beneficiary Bank
LinkedIn. Today, most of our followers are our
Account details.
Bank customers who use these social platforms
to communicate effectively with the Bank.
A Social Banking initiative which offers the

customers a host of banking services including
transactions through social platforms like Twitter and
Facebook. Apart from providing banking services 6,70,000 21,000 38,000
like checking account balance, enquiry of IndusInd Bank has also conducted various Online
mini-statement, locating nearest ATM/branch, users Marketing campaigns (SEO & SEM) to promote its
can also transfer money to their contacts using products & services in the online space to acquire
Facebook and Twitter. new customers along with promoting new initiatives.
Working towards better

customer relations
A Mobile Banking Application that offers a simple,
fast and secure way of banking on the go. Now
customers can check their account(s) balance(s), The Bank has continued the journey with Radian6-
transfer money, recharge mobile or DTH and enjoy a an ORM (Online Reputation Management) tool - to
multitude of other banking and payment services listen to what the customers are talking or writing on
various online platforms. This tool also helps the
Bank to know about various news articles being
written in the media about the Bank on real time
basis. Your bank has also started a Social Media
Command Centre, which works all 7 days for 12
hours to respond to all customer queries and
feedback received via various digital forums, social
channels and news portals.
0800
Focused Marketing Activities A New Jewel
The Bank also conducted a series of intense Yet another significant achievement by the Bank was
marketing activities - all with a local connect to reach to acquire the Diamond and Jewellery Financing
out to the regional audience. The Bank had a Business in India and related deposit portfolio of
nation-wide assets campaign called ‘IndusInd Royal Bank of Scotland N.V. IndusInd Bank
Loans Festival’ during the festival period from specializes in the Diamond and Jewellery financing
September to December 2015. The core idea of the business and this acquisition has enhanced its
campaign was to generate interest and create position. As the Bank was integrating the new
business opportunities during a high-involvement portfolio into the organisation, it rolled out a
period by providing attractive rates of interest on well-planned communication to different
various loan products. stakeholders involved. This enabled a smooth
transition and empowered the Bank to welcome the
Another promotional activity - ‘The Great NRI high-quality client base with much grace.
Homecoming Bonanza’ - was executed to welcome
the vast NRI population, during their calendarised Employee Engagements
homecoming season of November-December.
Smart and attractive offers were given to customers
who opened an NRI account with the Bank during The Bank acknowledges that no communication is
the said period. complete without the whole-hearted support of its
internal stakeholders. Keeping this factor in mind,
your Bank started streaming live video address of
the MD - ‘Virtual Town Hall’ - across all offices and
branches every quarter. This was appreciated and
valued by all internal stakeholders. Apart from such
quarterly town halls, the Bank continued
communication with its employees by providing
regular mailers on various developments thereby
keeping them updated on all developments.
We remained committed to reinforcing the long-term

presence for the brand by creating a series of Expanding Footprints
outdoor advertising campaigns which were planned
through the year at strategic locations.
Another significant achievement during the year was
the opening of new branches at semi-urban and
urban locations and taking the count of branch
network to 1,000 and 1,800 ATMs across 623
geographical locations
0090
Brand ‘IndusInd Bank’ Rises

in Brand Rankings The first project to have officially been launched
through the press conference is ‘IndusInd
Umang’, in association with the GoSports
A proud moment for the Bank was when it rose
Foundation. A first-of-its-kind platform, exclusively
up 6 ranks in the ‘BrandZ Top 50 Most Valuable
designed for differently-abled sportspersons, the
Indian Brands of 2015’ list as adjudged by WPP
program will provide well-structured support
and Millward Brown.
systems to encourage 15 emerging and elite
para-athletes, who have overcome challenges and
excelled in their chosen sport, against all adversity.
Moving up from the 19th rank to the 13th rank,

IndusInd Bank, with a 46% increase in the brand
value i.e. $ 1.5 billion, became the Top Riser
Brand of the year.
Creating History with IndusInd

For Sports On the day of the launch, April 7, IndusInd Bank
carried out a robust social media campaign to
7th April, 2016 would be considered as a create and encourage engagement. The Bank
watershed day in the history of IndusInd Bank. was able to generate 7,100 conversations with
For it is on this day that your Bank announced different stakeholders on Twitter and over 5 million
the launch of its non-banking, Sports Vertical – users viewed our activity through the day. The
‘IndusInd For Sports’ via a press conference twitter hashtag trended across India for 8 hours.
held in Mumbai. ‘IndusInd For Sports’ is an The press conference was telecast live on
attempt to bring out the sportsman spirit in Facebook for the first time and saw a real-time
everyone, promulgating the benefits of a viewership of over 35,000.
healthy, active lifestyle.
010
00
Sustaining today for a better tomorrow
Sustainability forms an integral part of business ethos at IndusInd Bank. Your Bank forged
synergies between economic growth, environmental stewardship and socially
responsible operations.
Through its sustainable operations, the Bank has mitigated risks and created opportunities
for long-term strategic growth.
efforts in Maharashtra. The Bank is devoted to

Deepening Tenets Of Sustainability nation’s Renewable Energy mission and has
committed to providing financial assistance to
In the second year of Corporate Social projects totalling to 2,000 MW between 2015-19.
Responsibility reporting under the statute of the Your Bank re-affirms its commitment to
Companies Act 2013, your Bank has amplified its environment sustainability and has continued its
initiatives to avenues of preventive healthcare, investment in green initiatives like virtualization of
education, sanitation, women empowerment, sports Servers, Signage timers, Thin Client Computing
and environmental conservation. During the year, and Solar ATMs.
Bank’s focus on extending inclusive banking
services to the community has sustained and it has Performing sustainably through
reached out to 2.3 million households. Disclosures & Certification
Expanding on the belief that sanitation is a basic This year your Bank has elevated its position at
necessity for all, your Bank is developing a sanitation Carbon Disclosure Project and stands at #1 in
project in eastern Uttar Pradesh while continuing the financial services sector in India, with a significant
rise from 91 points in 2014 to 99 in 2015.
Greening Facilities
In 2015, your Bank achieved LEED Gold Rating for

its Gurgaon branch. This year, your Bank is
greening IBL House at Mumbai - a facility spread
across 19,685 square feet, in accordance to LEED
Platinum rating.
011
00
Environment Management was executed on water conservation and its

management. As part of the Bank’s ‘One Quarter
with Water’ water management campaign, audits
The environment and climate change
were conducted across 250 locations of the Bank
management is a scientific and long-term practice
which identified consumption behaviour and also
and the Bank has intensified its focus on supply
devised ways to manage water effectively.
chain sustainability as well as business as its
usual activities.
Sustainable Supply Chain
Energy In order to ensure that your Bank sources from
a reliable and secure supply chain, last year
Power saving initiatives across the Bank have
supplier sustainability assessment of the large
been implemented on 16,287 laptops and
spend suppliers was completed.
desktops, which has led to a saving of 458 MW
of electricity and a reduction of 398 tons of
This year the Bank has incisively assessed the
carbon emissions.
indirect carbon emission accruing from
sourcing of products and services from these
Server Virtualisation
large spend suppliers.
877 servers have been virtualised on 73 physical
servers resulting in electricity saving of 2,182 MW
in the year. Community Development
Solar Energy Financial Inclusion

Your Bank’s fleet of 100 solar ATMs continues to
The Bank’s micro-finance initiatives (MFIs BC)
generate solar electricity enabling ATM
cover 104 districts in 11 States and through
services. Your Bank is now executing the next
various channels disbursed loans of ` 3,753 crs
phase of 100 grid tied solar ATMs. The Solar
in FY’ 15-16. Your Bank has partnered with
powered facility at Karpakkam generated 62
Asian Development Bank (ADB) and IMFR
MW of power and constitutes upto 8% of the
Capital to lend $20 million to MFIs across India.
total energy requirements.
Under this partnership, ADB and IMFR have
given a partial guarantee for $20 million of loan
Waste Management given by IndusInd Bank to MFIs. The Bank’s
Your Bank has collected 36,650 kg of e-waste for inclusive banking efforts have reached 2.3
disposal through Government authorised million households and major part of the areas
recyclers and has channelized 6,023 kg of A4 covered are below average and low in CRISIL
paper for recycling. Inclusive Index.
Water IndusInd Swachh Vidyalaya

To emphasize on the basic necessity and Lack of sanitation facilities is seen as a factor for high
availability of water for all, a pan-bank campaign drop-out rates especially among girls in rural India.
Solar Energy Server Power Saving

Generated Virtualisation Devices
62 MW Saved Saved
of power at 2,182 MW 458 MW
Karpakkam of electricity
012
00
Your Bank has forged ahead on its commitment scholarships and are chosen by means of a
to sustainability by adopting Kolhapur district in six-step selection process. YIF Fellows engaged
Maharashtra and eastern UP by constructing 56 with the social sector have moved on to
toilet blocks and benefiting 5,000 school-going represent grass-root organisations in Education
children. Furthermore, your Bank is also & Development, Arts & Culture, Agri-value chain
maintaining these toilets; sensitizing the companies, residential schools for special
students and the community on benefits of children amongst others.
health and sanitation and has appointed
Swacch Mantris in each school. Empowerment of the Differently-Abled
In partnership with Rajiv Gandhi Foundation,
IndusInd For Sports your Bank has distributed 15 specially
Your Bank launched a non-banking sports designed vehicles for differently-abled
vertical, ‘IndusInd For Sports’, to make sports through the ‘Access to Opportunities’
an integral, intrinsic and strategic element for programme. In addition to distributing
both internal and external stakeholders. Using vehicles, the programme also includes
the unique power of sports to attract, mobilise training, access to information about
and inspire, ‘IndusInd For Sports’ attempts to academic and livelihood options and
bring out the sporting best - human values, scholarship support to students with special
inclusion and sustainability. The vertical will needs.
entail year-long engagement activities for
customers, employees and the community Of the 15 sponsored beneficiaries, 10 are
through well thought-out programmes. pursuing bachelor and higher degree
qualifications while doing part-time work.
IndusInd Bank Scholarships - Young India
Fellowship Programme Legal Literacy
This year the Bank has supported Young India The Bank supports the cause of women
Fellows (YIF) of Ashoka University through empowerment by creating awareness among
comprehensive scholarships. The project is in them on their legal rights and disseminating
partnership with Ashoka University at Sonepat, legal and financial education. By partnering with
Haryana. All fellows are supported by Samhita, over 5,000 women have been trained
through the programme and aim to cover 65,000
women during the project timeline of over three
years with the objective to reduce the number of
complaints/cases of domestic violence and
013
00
female infanticide and foeticides. Currently, on social and environmental issues in the
the project covers women in 7 blocks of community. They have supported in running
Bhopal. The impact of the project will be crucial initiatives like Water Quarter campaign,
assessed after a period of three years in terms Share2Care and Biodiversity campaigns.
of the number of women who have benefitted
through our initiative. Green Commandos
To fortify efforts of Green Champions, your Bank
Contribution to Social Causes inducted a force of over 200 enthusiastic Green
The Bank has also pledged support towards Commandos who would help Green Champions
different social causes; be it promoting Indian in achieving their mission. Green Commando
culture and arts through Uttung Sanskrutik training meets were conducted pan-India where
Pariwar Trust, supporting education of they were educated on imminent environmental
meritorious needy students through IndusInd and social concerns.
Foundation, primary healthcare and education
interventions of Rajmata Vijaya Raj Scindia
Centre for Development, the cause of cancer in
children of the Tata Memorial Hospital through
the Terry Fox Run. The Bank has extended
support to ‘Little Sisters of the Poor’, an
organisation supporting the homeless aged in
Bengaluru. The Bank helped promote education
through the Parikrma Science Festival 2016.
Parikrma Festival of Science is an forum where
students from different schools get together to
learn science in an interactive and relevant
manner from eminent scientists. Campaigns
Corporate global markets operations team
Workforce Initiatives venerated the Sustainability Week across all
their locations in which every day was dedicated
to one theme such as elderly care and women
Share2Care
empowerment, wildlife conservation, education,
Your Bank continues to encourage employees differently-abled and Swacch CGMO day.
to contribute to a cause of their choice. The
NGOs supported by the Bank’s workforce focus World Environment Day, World Yoga Day, Earth
on wide range of concerns ranging from Day were celebrated across all locations with
biodiversity conservation, providing alternate various activities such as film screenings,
learning aids to under privileged children, sessions and chat-shows.
supporting the elderly and rehabilitating
children of substance abuse.
This year, your Bank supported the following

empanelled NGOs: Aaranyak, NalandaWay,
SUPPORT, Prayas, HelpAge and Samarthanam.
Green Champions
Your Bank’s team of Green Champions has
been instrumental in spear-heading awareness
014
00
DIRECTORS’ REPORT: 2015-16
The Board of Directors of the Bank have pleasure in presenting the Twenty-second Annual Report covering business
and operations of the Bank, together with the Audited Financial Statements for the year ended March 31, 2016.
The financial performance for the year ended March 31, 2016 is summarized as under:
(` in crores)
As on As on
March 31, 2016 March 31, 2015
Deposits 93,000.35 74,134.36
Advances 88,419.34 68,788.20
Operating Profit (before Depreciation and Provisions and Contingencies) 4,297.94 3,225.07
Net Profit 2,286.45 1,793.72
During the year under review, despite a pervasive weakness in the global economy and moderate growth in the
Indian economy, and a persistently challenging operating environment, the Bank improved its business with Deposits
growing by 25.45% and Advances by 28.54% over the previous year.
The Bank continued to focus on increasing earnings from core banking business, strengthening the fee income
streams, and maintaining control on operating costs.
Operating Profit (before Depreciation and Provisions and Contingencies) rose robustly by 33.27% to ` 4,297.94 crores,
as compared to ` 3,225.07 crores in the previous year.
The Net Profit of the Bank, after considering all expenses and necessary Provisions and Contingencies, was higher by
27.47% at ` 2,286.45 crores, as against `1,793.72 crores in the previous year.
Appropriations
The Directors recommend appropriation of Profit as under:
(` in crores)
Operating Profit before Depreciation and Provisions & Contingencies 4,297.94

Less: Depreciation on Fixed Assets 156.52
Less: Provisions & Contingencies inclusive of Income Tax 1,854.97
Net Profit 2,286.45
Profit Brought forward 3,664.02
Amount available for Appropriation 5,950.47
Transfer to Statutory Reserve 571.61
Transfer to Capital Reserve 13.21
Proposed Dividend 292.62
Tax on Dividend 59.57
Balance carried over to Balance Sheet 5,013.46
Total Appropriations 5,950.47
Dividend
The Earning Per Share (EPS) of the Bank rose to ` 39.68 during the year 2015-16, from ` 33.99 in the previous year.
Considering the overall improvement in performance as well as the need to conserve capital for continued growth, the
Directors recommend Dividend of ` 4.50 per Equity Share of ` 10/- each for the year ended March 31, 2016. (Dividend
for the year 2014-15 was ` 4.00 per Equity Share of `10 each).
15
During the year, unclaimed dividend pertaining to the financial year 2007-08 was transferred to the Investor Education
and Protection Fund (IEPF) after giving due notice to the Members whose names were appearing in the list of unpaid
recipients.
Financial Performance
The year under review witnessed significant volatility in global markets with commodity prices moving to historical low
levels and the Chinese economy facing an unprecedented slowdown, while the global economic growth continued to
be fragile. The year started with RBI keeping the Policy rates steady in its first bi-monthly Policy on April 7, 2015, but
maintained an accommodative stance for future actions. The repo rate was, later in the year, reduced by 75 bps to
6.75%, which was in addition to the cut of 50 bps done prior to March 2015.
The year under review was the second year of the new Triennial Planning Cycle for the Bank (Planning Cycle 3,
for Financial Years 2015-17) with a strategy to gain ‘Market Share with Profitability’ through Diversification and
Differentiation. The Bank continued to leverage its business on the three performance planks of Productivity, Profitability
and Efficiency.
Backed by improved volumes, the Total Income of the Bank grew by 21.55% to ` 14,877.61 crores from ` 12,239.97
crores.
The healthy rise in profitability was the result of growth in Net Interest Income (NII) as well as Non-Interest Income.
Net Interest Income improved considerably by 32.05% to ` 4,516.57 crores from ` 3,420.28 crores while Non-Interest
Income rose to ` 3,296.95 crores from ` 2,548.00 crores, registering a growth of 29.39%. Core Fee Income such as
commission, exchange, loan processing and account management fees, fees on Investment Banking and distribution
of third-party products, and earnings from foreign exchange business grew by 25.95% to ` 2,809.59 crores from
` 2,230.79 crores earned during the previous year.
Yield on Advances dropped to 12.24% during the year as against 13.12% in the previous year, while the Cost of
Deposits fell to 7.25% from 7.92% in the previous year. The Net Interest Margin (NIM) for the year improved to 3.81%
as compared to 3.65% in the previous year, mainly due to the composition of the Asset Portfolio, benign interest
rate movements during the year, timely equity infusion in July - August 2015, and judicious mobilization of funding
resources through deposits and borrowings, including overseas borrowings and refinance from institutions.
The Bank expanded its branch network steadily to reach 1,000 branches, as against 801 branches at the beginning of
the year. Revenue per employee during the year remained steady at ` 34 lakhs.
The quality of the Loan Book remained stable with Net Non-Performing Assets (Net NPAs) standing at 0.36% as at
March 31, 2016, as against 0.31% a year ago. The Provisioning Coverage Ratio (PCR) stood at 58.58% as compared
to 62.61% in the previous year.
Digitizing businesses has been a key thrust area of the Bank during the year under review, and most offerings across
payments, lending, deposits, and third-party distribution products were enabled for online sales and service. The
Bank has tied up with most of the leading financial aggregator portals for online acquisition of clients, besides working
with leading e-commerce and payment services providers to offer payment solutions to its Retail, Business and
Institutional clients, including Government bodies.
The Bank introduced several new products and services for select client segments through its Consumer Banking,
Transaction Banking and Global Markets Groups. IndusMobile, a feature-rich and convenient mobile application was
launched during the year. QuickPay, SwiftPay and OnTheGo Social Banking are some of the technology-enabled
solutions launched during the year. In October 2015, the Bank became a Corporate Agent of Tata AIA Life Insurance
Company Limited. The Bank kept up its focus on deepening as well as strengthening of the fee-based income streams,
resulting in a smart growth in Non-Interest Income.
Performance of Subsidiary and Associate Company

ALF Insurance Services Private Limited, a wholly-owned subsidiary of the Bank which was set up to do the business
of Insurance Broking, is under Voluntary Winding-up. Having secured appropriate clearances from Tax and other
16
authorities, the Liquidator appointed by the subsidiary realised all the assets and settled all external liabilities. On
February 24, 2016, the said Liquidator made the final distribution to the shareholders and subsequently filed necessary
documents with the Registrar of Companies.
IndusInd Marketing and Financial Services Private Limited (IMFS) is an Associate Company of the Bank and is
engaged in the business of providing manpower services. Pursuant to Section 129(3) of the Companies Act, 2013
read with Rule 8 of Companies (Accounts) Rules, 2014, the Bank has drawn up a Consolidated Financial Statement
including the Financial Statement of its Associate Company, which also forms a part of the Annual Report.
The financial position and performance of IMFS are given in the statement containing salient features of the Financial
Statements of the Company, which form part of the Consolidated Financial Statements.
A statement containing the salient features of the financial position of the subsidiary and Associate Company in Form
AOC-1 is enclosed as Annexure I.
Share Capital
The Paid-up Equity Capital of the Bank as at March 31, 2016 consisted of 59,49,86,335 Equity Shares of ` 10/- each.
During the year under review, the Bank allotted 5,12,18,640 Equity Shares of ` 10/- each at a price of ` 845.00 per
share aggregating ` 4,327.98 crores through a Qualified Institutions Placement (QIP). Besides, the Bank also allotted
87,81,360 Equity Shares of ` 10/- each to the Promoters of the Bank at a price of ` 857.20 per share, aggregating
` 752.74 crores through a Preferential Allotment. Further, the Bank allotted 55,36,126 Equity Shares of ` 10/- each
pursuant to the exercise of Options under its Employees Stock Option Scheme, 2007.
The Bank has not issued any Equity Shares with differential voting rights.
Debentures
The Bank did not issue any debentures during the year under review. Details of Debenture Trustees are as under:
Trustee I:
Name of Debenture Trustees : GDA Trusteeship Limited
Address : GDA House, S. No.94/95, Plot No.85, Bhusari Colony (Right),
Kothrud, Paud Road, Pune – 411 038, Maharashtra, India
Website : www.gdatrustee.com
E-mail : [email protected]
Trustee II:
Name of Debenture Trustees : IDBI Trusteeship Services Limited
Address : Asian Building, Ground Floor, 17, R. Kamani Marg,
Ballard Estate, Mumbai – 400 001
Website : www.idbitrustee.com
E-mail : [email protected]
Tier II Capital
The Bank did not raise any Tier II Capital during the year.
Deposits
The Bank is a banking company governed by the Banking Regulation Act, 1949 and as such, the provisions in the
Companies Act relating to acceptance of Public Deposits are not applicable.
17
Capital Adequacy
The Bank continues to be adequately capitalized. The Capital Adequacy Ratio of the Bank, calculated under the Basel
III Capital Regulations mandated by RBI, is set out below:
March 31, 2016 March 31, 2015

i) Capital Adequacy Ratio (CRAR) 15.50% 12.09%
ii) CRAR - Core Equity Tier 1 Capital 14.92% 11.22%
iii) CRAR - Tier 2 Capital 0.58% 0.87%
Credit Ratings
Instruments Rating Rating Agency
Lower Tier II Subordinate Debt program AA+ ICRA
Upper Tier II Bond program AA ICRA
Certificates of Deposit A1+ CRISIL
Short Term Debt Instruments A1+ India Ratings and
Research
Lower Tier II Subordinate Debt program AA+ India Ratings and
Research
Upper Tier II Bond program AA India Ratings and
Research
Senior Bonds program AA+ India Ratings and
Research
Directors
The Bank’s Board comprised eight Directors as on March 31, 2016, viz., Mr. R. Seshasayee, Part-time Non-Executive
Chairman, Mr. Romesh Sobti, Managing Director & CEO, Mr. Yashodhan M. Kale, Non-Executive, Non-Independent
Director, and five Independent Directors, inclusive of Mr. Shanker Annaswamy who was appointed by the Board as
‘Additional Director’ on January 12, 2016.
The Board of Directors had, in their meeting held on May 12, 2016, appointed Dr. T. T. Ram Mohan, DIN 00008651, as
‘Additional Director’ in the category of ‘Independent Non-Executive’.
The Board, therefore, presently comprises nine Directors.
(a) Independent Non-Executive Directors
In terms of SEBI (Listing Obligations and Disclosure Requirements) Regulations, 2015 (Listing Regulations)
and based on the Declarations under Section 149(6) of the Companies Act, 2013 received by the Bank for
the financial year ended March 31, 2016, the following Non-Executive Directors are identified as Independent
Directors as on March 31, 2016:
(i) Mrs. Kanchan Chitale
(ii) Mr. Vijay Vaid
(iii) Mr. T. Anantha Narayanan
(iv) Mr. Ranbir Singh Butola
(v) Mr. Shanker Annaswamy
(b) Woman Director
In terms of the provisions of Section 149 of the Companies Act, 2013 and the Listing Regulations, specified
companies are required to have at least one Woman Director in their Board.
18
Mrs. Kanchan Chitale, who joined the Board on October 18, 2011, is an Independent Director in the Board and
Chairs some important Committees.
(c) Chairman of the Board
Mr. R. Seshasayee, DIN 00047985, has been Part-time Non-Executive, Non-Independent Chairman of the Bank
since July 24, 2007.
Shareholders had, in the 21st AGM held on August 17, 2015, approved the re-appointment of Mr. R. Seshasayee
as Part-time Non-Executive Chairman of the Bank for a period of 2 years with effect from July 24, 2015.
Reserve Bank of India had also conveyed their approval for the re-appointment of Mr. R. Seshasayee for 2 years,
until July 24, 2017.
(d) Managing Director & CEO
Mr. Romesh Sobti, DIN 00031034, has been the Managing Director & CEO of the Bank since February 1, 2008.
Shareholders of the Bank had, in the 19th AGM held on June 28, 2013, approved the re-appointment of
Mr. Romesh Sobti as the Managing Director & CEO for a period of three years.
Reserve Bank of India had also conveyed their approval for the re-appointment of Mr. Romesh Sobti as Managing
Director & CEO of the Bank for a further period of three years, i.e., from February 1, 2015 to January 31, 2018.
(e) Appointment / Re-appointment / Resignation / Retirement of Directors
In order to ensure compliance with Section 152(6) of the Act, the Board has considered Mr. R. Seshasayee, Part-
time Non-Executive Chairman and Mr. Romesh Sobti, Managing Director, as liable to retire by rotation, besides
Mr. Yashodhan M. Kale.
Mr. R. Seshasayee, DIN 00047985, Part-time Non-Executive Chairman, being longest in office, shall retire at the
ensuing AGM and being eligible, offers himself for re-appointment, for ensuring compliance with Section 152(6)
of Act.
Mr. Shanker Annaswamy, DIN 00449634, was appointed as ‘Additional Director’ in the category of ‘Independent
Non-Executive’ by the Board in its meeting held on January 12, 2016, and shall hold office up to the date of the
ensuing Annual General Meeting.
Dr. T. T. Ram Mohan, DIN 00008651, was appointed as ‘Additional Director’ in the category of ‘Independent
Non-Executive’ by the Board in its meeting held on May 12, 2016, and shall hold office up to the date of the
ensuing Annual General Meeting.
In terms of requirements of the Companies Act, 2013, approval of the shareholders is requested for appointment
of Mr. Shanker Annaswamy and of Dr. T. T. Ram Mohan in the category of “Independent Non-Executive
Director” for a period of four years with effect from their respective dates of appointment.
Mr. Ashok Kini, DIN 00812946, who had been a member of the Board as ‘Independent Non-Executive Director’
from January 30, 2008, ceased to hold office with effect from December 12, 2015, on attaining the age of 70
years, the maximum age limit prescribed for Directors.
The Directors wish to place on record their appreciation for the valuable contributions made by Mr. Ashok Kini
towards the deliberations in the Board Meetings during his tenure as Director of the Bank.
Relevant details, including brief profiles of the Directors seeking appointment / re-appointment at the ensuing
Annual General Meeting, have been furnished in the Notice of the Annual General Meeting and in the Report on
Corporate Governance (under the Section titled ‘Board of Directors’), which forms an integral part of this Annual
Report.
The Bank has received Notices in writing along with requisite Deposit amounts from Members, pursuant to
Section 160 of the Companies Act, 2013, signifying their intention to propose the candidature of the respective
persons for the office of Director.
Board and Committee Meetings
During the year, nine meetings of the Board and seven meetings of the Audit Committee were held, the details of which
are given in the Corporate Governance Report, which forms an integral part of this Report.
19
The Board has constituted the Audit Committee with Mr. T. Anantha Narayanan as Chairman and Mrs. Kanchan
Chitale, Mr. Ranbir Singh Butola, Mr. Yashodhan M. Kale and Mr. Shanker Annaswamy as Members. There have not
been any instances during the year when recommendations of the Audit Committee were not accepted by the Board.
Details of the composition of the Board and all its Committees and of the Meetings held and attendance of the
Directors at such Meetings, are provided in the Corporate Governance Report. The intervening gap between the
Meetings was within the period prescribed under the Companies Act, 2013 and the Listing Regulations.
Performance Evaluation of the Board
Pursuant to the provisions of the Companies Act, 2013 and the Listing Regulations (erstwhile Clause 49 of the revised
Listing Agreement), the Board has carried out annual evaluation of its own performance (Board as a whole), of the
Directors individually, of the Chairman, and of the working of its Committees.
The Statement indicating the manner in which the evaluation exercise was conducted is included in the Corporate
Governance Report, which forms an integral part of this Report.
The performance of the Board members, Committees of the Board and the Board as a whole has been evaluated at
the meeting of the Committee of Independent Directors, Nomination Committee, and the Board of Directors in their
meetings held on May 12, 2016.
System for Internal Financial Controls and its Adequacy
The Bank operates in a fully computerized environment with a Core Banking System supported by diverse application
platforms for handling special businesses such as Treasury, Trade Finance, Credit Cards, Retail Loans, etc. The
process of recording of transactions in each of the application platforms is subject to various forms of controls such
as in-built system checks, Maker-Checker authorizations, independent post-transaction reviews, etc. The Financial
Statements are prepared based on computer system outputs. Responsibility of preparation of Financial Statements is
entrusted to a dedicated unit which is completely independent of business, risk, audit or other functions. This unit does
not originate accounting entries except for limited matters such as Share Capital, Taxes and Transfers to Reserves. The
Bank has implemented adequate procedures and internal controls which provide reasonable assurance regarding
reliability of financial reporting and preparation of Financial Statements, and that such internal financial controls were
adequate and were operating effectively during the year.
Conservation of energy and technology absorption and foreign exchange earnings and outgo
Considering the nature of its activities as an entity in the Financial Services sector, the Bank has voluntarily taken steps
towards conservation of energy and technology absorption, thus ensuring compliance with the provisions of Section
134(3) of the Companies Act, 2013, read with the Rule 8(3) of the Companies (Accounts) Rules, 2014. Details of the
same are furnished in the Management and Discussion Analysis Report, which forms part of this Report. The Bank has
made optimum use of Information Technology in its operations. The details of foreign exchange earnings and outgo
are also mentioned in the section on Management and Discussion Analysis.
Risk Management
The Bank has an integrated Risk Management Department, independent of business functions, covering Credit Risk,
Market Risk, Assets-Liabilities Management (ALM), Operational Risk, and Information Security Risk functions.
Risk Management functions in the Bank have been aligned with best industry practices, and are being enhanced
progressively, adapting to dynamic business environment and market conditions.
The Bank has comprehensively articulated various risk policies which specify the risk appetite / strategies, risk
measurement methodologies, monitoring, and control measures for the respective business segments. The policies
have been framed keeping risk appetite as the central objective, and business strategies have been aligned to risk
policies.
The Bank has implemented “Internal Capital Adequacy Assessment Process” (ICAAP) in line with the Basel III
requirements. The Bank has set up a Board-level Committee, viz., “Risk Management Committee” to examine risk
policies and procedures developed by the Bank and to monitor adherence to various risk parameters and prudential
limits by different operating departments.
20
Details on Risk Management framework / models adopted by the Bank are furnished in the ‘Management Discussion
and Analysis’.
Vigil Mechanism
The Bank has in place the “Whistle Blower Policy” since 2009.
The said Policy is in compliance with RBI Guidelines, provisions of the Companies Act, 2013, and the SEBI (Listing
Obligations and Disclosure Requirements) Regulations, 2015. The Vigil Mechanism at the Bank requires submission
of Quarterly Reviews before the Audit Committee of the Board, and placing of Annual Reviews before the Audit
Committee and the Board of Directors.
The Policy also incorporates suggestions of the Protected Disclosure Scheme for Private Sector and Foreign Banks,
instituted by the Reserve Bank of India.
The Board of Directors of the Bank have constituted a Board-level Committee, viz., the Vigilance Committee, which
conducts overview of cases of vigilance nature arising out of actions of the employees of the Bank. The Committee
meets at least twice a year.
In compliance with RBI guidelines on “Staff Empowerment”, the Board of Directors have reviewed the Whistle Blower
Policy of the Bank during the year 2015-16.
Further details about the Vigil Mechanism are furnished in the Report on Corporate Governance, and the current
Whistle Blower Policy of the Bank is available on the Bank’s website at the under-mentioned link:
http://www.indusind.com/important-links/other-useful-information.html
Auditors
M/s Price Waterhouse Chartered Accountants LLP, Chartered Accountants, Mumbai (Firm’s Regn. No. 012754N /
N500016), who have audited the accounts of the Bank for the year 2015-16, shall retire at the conclusion of the
ensuing Annual General Meeting and are eligible for re-appointment.
Members are requested to consider the re-appointment of M/s Price Waterhouse Chartered Accountants LLP,
Chartered Accountants, as the Statutory Auditors of the Bank from the conclusion of this Annual General Meeting until
the conclusion of the next Annual General Meeting at remuneration to be decided by the Board of Directors based
on the recommendations of the Audit Committee. Their appointment is subject to the approval of the Reserve Bank
of India. A certificate has been received from M/s Price Waterhouse Chartered Accountants LLP (PW) to the effect
that their appointment, if made, would be within the prescribed limits under Section 141 of the Companies Act, 2013.
Independent Auditor’s Report
M/s Price Waterhouse Chartered Accountants LLP, Statutory Auditors of the Bank, have audited the accounts of the
Bank for the year 2015-16 and their Report is annexed. Pursuant to Section 143(3)(i) of the Companies Act, 2013, the
Statutory Auditors have also reported on the adequacy and operating effectiveness of the internal financial controls
system over financial reporting, which has been enclosed as ‘Annexure A’ to Independent Auditor’s Report.
Significant Audit observations, if any, and corrective actions taken by the Management are presented to the Audit
Committee of the Board from time to time.
There are no qualifications, reservations or adverse remarks or disclaimers made in the Auditor’s Report.
Secretarial Audit
In terms of Section 204 of the Companies Act, 2013 and the Companies (Appointment and Remuneration of Managerial
Personnel) Rules, 2014, the Bank has appointed M/s Bhandari & Associates, Company Secretaries in Practice
(CP. No. 366) to undertake Secretarial Audit. The Secretarial Audit Report submitted by M/s Bhandari & Associates is
furnished at Annexure II, and forms an integral part of this Report.
The Secretarial Audit Report submitted by M/s. Bhandari & Associates for FY 2015-16 does not contain any qualification,
reservation or adverse remark.
21
Statutory Disclosures
The information on conservation of energy, technology absorption and foreign exchange earnings and outgo, pursuant
to Section 134(3)(m) of the Companies Act, 2013 read with the Rule 8(3) of the Companies (Accounts) Rules, 2014, is
given in the Management Discussion and Analysis Report. Also, the other Statutory Information / Disclosures required
to be given under the Banking Regulation Act, 1949 and the Companies Act, 2013, as applicable to the Bank, have
been laid out in the Schedules / Notes attached and forms part of the Balance Sheet and the Profit and Loss Account.
The details pursuant to remuneration of Directors and employees in terms of Section 197(12) of the Companies Act,
2013 read with Rule 5(1) of the Companies (Appointment and Remuneration of Managerial Personnel) Rules, 2014,
are given at Annexure III and forms an integral part of this Report.
The information relating to employees required to be furnished under the Companies Act, 2013 and the Rules made
thereunder is given under the head “Particulars of Employees” later in this Report.
Employees Stock Option Scheme

The Bank had instituted an Employee Stock Option Scheme (ESOS-2007) to enable its employees, including Whole-
time Directors, to participate in the future growth of the Bank. Under the Scheme, Options can be granted, which upon
exercise could give rise to the issuance of a number of shares upto 7% of the issued Equity Capital of the Bank from
time to time. The eligibility and number of Options to be granted to an employee is determined on the basis of criteria
laid down in the Scheme and is approved by the Compensation Committee of the Board of Directors.
An aggregate of 3,75,70,300 Options, comprising 6.31% of the Bank’s Equity Capital, have been granted under the
Scheme. Statutory disclosures as required by SEBI (Share-Based Employee Benefits) Regulations, 2014 are given at
Annexure IV in this Report.
The Annual Certificate on compliance with SEBI (Share-Based Employee Benefits) Regulations, 2014, issued by
Statutory Auditors of the Bank, is being placed before Members in the AGM.
The Employees Stock Option Plan is administered by the Compensation Committee of the Board.
Directors’ Responsibility Statement

To the best of their knowledge and belief and according to the information and explanations obtained by them, the
Directors make the following statement in terms of Section 134(3)(c) and 134(5) of the Companies Act, 2013:
(i) that in the preparation of the Annual Accounts for the year ended March 31, 2016, the applicable Accounting
Standards have been followed along with proper explanation relating to material departures, if any;
(ii) that such accounting policies as mentioned in the Notes to the Financial Statements have been selected and
applied consistently and that judgements and estimates have been made that are reasonable and prudent so
as to give a true and fair view of the state of affairs of the Bank as at March 31, 2016 and of the profit of the Bank
for the year ended on that date;
(iii) that proper and sufficient care has been taken for the maintenance of adequate accounting records in accordance
with the provisions of the Companies Act, 2013 for safeguarding the assets of the Bank and for preventing and
detecting frauds and other irregularities;
(iv) that the Annual Financial Statements have been prepared on a ‘going concern’ basis;
(v) that proper internal financial controls were in place and that the financial controls were adequate and operating
effectively;
(vi) that systems to ensure compliance with the provisions of all applicable laws were in place and were adequate
and operating effectively.
22
Extract of Annual Return
The details forming part of the extract of the Annual Return in Form MGT-9, as required under Section 92 of the
Companies Act, 2013 are included in this Report as Annexure V, and form an integral part of this Report.
Particulars of Employees
The Bank had 23,060 employees on its rolls as on March 31, 2016.
89 employees employed throughout the year were in receipt of remuneration of ` 60 lakh per annum or more, and 12
employees employed for part of the year were in receipt of remuneration of ` 5 lakh per month or more.
The information containing particulars of employees pursuant to Section 197 of the Companies Act, 2013 read with
Rule 5(2) of the Companies (Appointment and Remuneration of Managerial Personnel) Rules, 2014 forms part of this
Report. However, the above Annexure is not being sent along with this Report to the Members in line with the provision
of Section 136 of the Companies Act, 2013. Members who are interested in obtaining the particulars may please write
to the Company Secretary at the Secretarial and Investor Services Office. The aforesaid Annexure is also available
for inspection by Members at the Registered Office of the Bank up to the date of this Annual General Meeting during
business hours on working days.
None of the employees hold (by himself or along with his spouse and dependent children) more than two percent of
the Equity Shares of the Bank.
Remuneration Policy
During the year under review, all the Non-Executive Directors received remuneration by way of Sitting Fees for
attending the meetings of the Board and of various Board Committees. As per the Bank’s policy, no Stock Options
were granted to the Non-Executive Directors.
Details on compensation to Whole-time Directors are given under Report on Corporate Governance which forms part
of this Report.
The Board of Directors has, on the recommendations of the HR & Remuneration Committee framed a Policy in relation
to remuneration of Directors, Key Management Personnel and Senior Management of the Bank.
The detailed Remuneration Policy of the Bank is given under “Disclosure on Remuneration” at Note No. 12.6 of the
Notes in Schedule 18 to the Financial Statements, which is an integral part of this Report.
In view of the guidelines contained in RBI Circular dated June 1, 2015 on compensation of Non-Executive Directors of
private sector banks, the Board of Directors have, in their meeting held on May 12, 2016, based on the recommendations
of Human Resource & Remuneration Committee, approved the payment of remuneration of ` 25 lakhs per annum
to Mr. R. Seshasayee, Part-time Non-Executive Chairman of the Bank (subject to approval of Reserve Bank of India)
and to the Non-Executive Directors (other than the Part-time Non-Executive Chairman) in the form of Profit-related
Commission not exceeding ` 10 lakhs per annum for each Director, in such manner as may be decided by the Board
of Directors. In compliance with the provisions of the Companies Act, 2013, the above proposals have been placed for
approval of the Members in the 22nd Annual General Meeting of the Bank.
Particulars of Loans, Guarantees or Investments outstanding

Details of Loans, Guarantees and Investments made by the Bank are given in the Notes to Financial Statements.
Consolidated Financial Statements
In accordance with Section 129(3) of the Act, Consolidated Financial Statement of the Group comprising IndusInd
Bank Limited (‘the Bank’) and IndusInd Marketing and Financial Services Private Limited (“the Associate”), has been
prepared and is included in the Annual Report.
23
In accordance with Para 30 on Transitional provision of Accounting Standard 21 on preparation of Consolidated
Financial Statements on the first occasion, comparative figures for the previous year are not required to be presented.
Consequently, the Bank has prepared the Consolidated Financial Statements of the Bank and its Associate for the
year ending March 2016, and no comparative figures for the previous year are presented in the current year’s Financial
Statements as the consolidated financials have been presented to the Board for the first time.
Indian Accounting Standards (IND AS) – IFRS Converged Standards

The Ministry of Corporate Affairs (MCA) vide its notification dated February 16, 2015 has notified the Companies
(Indian Accounting Standards) Rules, 2015 and vide its notification dated March 30, 2016 notified Companies (Indian
Accounting Standards) (Amendment) Rules, 2016.
The Bank will adopt IND AS beginning April 1, 2018, with previous year comparatives.
Corporate Social Responsibility

The Bank has voluntarily undertaken various initiatives in the area of Corporate Social Responsibility (CSR) by focusing
on sustainability-driven growth.
In terms of the requirements of Section 135 of the Companies Act, 2013 and CSR Rules 2014, the Bank has set
up a Board-level CSR Committee to look after the CSR initiatives of the Bank. The Committee is headed by Mrs.
Kanchan Chitale as Chairperson, with Mr. Vijay Vaid and Mr. Romesh Sobti as Members. The Composition of the CSR
Committee is in accordance with Section 135 of the Companies Act, 2013.
The Bank has also framed the CSR Policy and strategy that will guide and govern the Bank’s activities in focus areas
namely rural development and inclusiveness, environmental sustainability, preventive healthcare and other areas of
special interest.
During the year under review, the Bank has committed to Prime Minister’s Swachh Bharat Abhiyaan and worked
towards financial inclusion and legal literacy. The CSR initiatives / projects undertaken by the Bank are largely in
accordance with Schedule VII of the Companies Act, 2013.
Companies, on the basis of criteria prescribed under Section 135 of the Act, are required to spend at least Two
per cent of their Average Net Profits made during the three immediately preceding financial years, in pursuance of
their Corporate Social Responsibility Policy. Accordingly, the Bank was required to spend ` 42.76 crores towards
CSR activities during FY 2015-16, out of which ` 27.32 crores (i.e., 1.27% of the Average Net Profits) was utilized on
activities specified in Schedule VII of the Companies Act, 2013. Some of the CSR projects are being executed in a
phased manner.
The Report on CSR activities undertaken by the Bank is set out at Annexure VI and forms an integral part of this Report.
Details of the CSR Policy and initiatives adopted by the Bank on CSR are available on Banks website at the link
mentioned below:
http://www.indusind.com/content/csr-home.html
Related Party Transactions

All transactions entered with ‘Related Parties’ during the year under review were on “arm’s length basis” and in the
‘ordinary course of business’ and therefore do not attract the provisions of Section 188 of the Companies Act, 2013.
Further, there are no materially significant Related Party Transactions during the year with any of the Related Parties
viz., Promoters, Directors and Key Management Personnel or other related entities which may have a potential conflict
with the interest of the Bank at large.
The Policy on Related Party Transactions as approved by the Board of Directors is available on the website of the Bank
at the below given link:
http://www.indusind.com/content/home/important-links/other-useful-information.html
24
Business Responsibility Report (BRR)
The Securities & Exchange Board of India, vide their Circular dated November 4, 2015, have published revised format
of the Business Responsibility Report and have mandated the top 500 listed entities, based on market capitalization
on BSE Limited and National Stock Exchange of India Ltd., to include the ‘Business Responsibility Report’ (BRR)
as part of the Annual Report, describing the initiatives taken by the listed entity from an environmental, social and
governance perspective, in the format as specified by SEBI.
In view of the above and in compliance with Regulation 34(2) of the Listing Regulations, the Business Responsibility
Report (BRR) of the Bank has been enclosed as Annexure VII to this Report, and forms an integral part of this Report.
Corporate Governance
Pursuant to Regulation 34(3) read with Schedule V of the Listing Regulations, a separate section on Corporate
Governance practices followed by the Bank, together with a Certificate from Practising Company Secretary confirming
compliance, forms an integral part of this Report.
A copy of Certificate issued by Practising Company Secretary is attached as Annexure VIII to this Report.
Management Discussion and Analysis Report

The Management Discussion and Analysis Report, as prescribed under Regulation 34(2) of the Listing Regulations,
forms part of the Annual Report.
Significant and Material Orders passed by the Regulators or Courts

There are no significant and material orders passed by the Regulators / Courts that would impact the going concern
status of the Bank and its futures operations.
Awards and Accolades

During the year under review, the Bank has received many awards and accolades for excellence in managing Risk, in
Branding, CSR initiatives, Information Technology, and for Innovations.
Mr. Romesh Sobti, MD & CEO won the most prestigious Business Award “EY Entrepreneurial CEO of the Year 2015”
at the 17th EY Entrepreneur of the Year 2015 India Awards.
He also received the “Banker of the Year” award by FE India’s Best Bank 2015.
Brief details of various awards are covered in the initial pages of the Annual Report.
Cautionary Statement
Certain statements in the “Directors’ Report” and in the “Management Discussion and Analysis” describing the
Bank’s objectives, estimates and expectations may be ‘forward-looking statements’ within the meaning of applicable
Securities Laws and Regulations. Actual results could differ substantially from those expressed or implied. Important
factors that could make a difference include economic conditions in the domestic and overseas markets, changes in
Laws / Regulations, and other incidental factors.
Material events that have happened after the Balance Sheet date:
No material changes and commitments affecting the financial position of the Bank have occurred between the end of
the financial year to which the Financial Statements relate and the date of the Report.
Policy on Prevention, Prohibition and Redressal of Sexual Harassment of Women at Workplace

The Bank has zero tolerance for sexual harassment at the workplace, and has adopted a ‘Policy on Prevention,
Prohibition and Redressal of Sexual Harassment of Women at the Workplace’, in line with the provisions of the Sexual
Harassment of Women at Workplace (Prevention, Prohibition and Redressal) Act, 2013 and the Rules made thereunder.
25
The Policy aims to provide protection to women employees at the workplace and prevent and redress complaints
of sexual harassment and for matters connected or incidental thereto, with the objective of providing a safe working
environment.
The Bank has also constituted and notified the Internal Complaints Committees, to enquire into the complaints of
sexual harassment and recommend appropriate action.
The Bank received 20 complaints alleging sexual harassment at work place during the financial year 2015-16. The
status of the same is as under.
No. of cases received No. of cases closed No. of cases pending for
during the year during the year investigation
at the end of the year
20 20 NIL
Acknowledgements
The Directors are grateful to the shareholders of the Bank for the trust and confidence reposed by them in the Bank.
The Directors are also grateful to the Reserve Bank of India, the Ministry of Corporate Affairs, Securities and Exchange
Board of India, Insurance Regulatory and Development Authority, and the Stock Exchanges for the guidance and
support extended by them to the Bank.
The Board expresses its deep sense of appreciation to all employees for their excellent performance, strong work
ethic, and unswerving commitment, which qualities have contributed to the Bank’s continued progress in a challenging
environment.
The Board thanks its valued customers for their patronage, and looks forward to the growing of this mutually supportive
relationship in future.
For and on behalf of the Board of Directors
Place: Mumbai
Romesh Sobti Kanchan Chitale
Date: May 12, 2016 Managing Director Director
26
ANNEXURE I TO THE DIRECTORS’ REPORT
Form AOC-1
(Pursuant to first proviso to sub-section (3) of section 129 read with Rule 5 of Companies
(Accounts) Rules, 2014)
Statement containing salient features of the Financial Statement of Subsidiaries /
Associate Companies / Joint Ventures
Part “A”: Subsidiaries

The Bank did not have any subsidiary, in operation, during the year ended March 31, 2016. Hence, information in this
regards is NIL.
Notes :
1 Names of the Subsidiaries which are yet to commence operation: NIL
2 Names of the Subsidiaries which have been liquidated or sold during the year
ALF Insurance Services Private Limited (ALFIS), a wholly owned subsidiary of the Bank (till February 24,
2016); is under Liquidation and the Liquidator has repaid the entire share capital on February 24, 2016; the final
formalities for striking off the name from the Registrar of Companies are in progress.
Part “B”: Associates and Joint Ventures

Statement pursuant to Section 129 (3) of the Companies Act, 2013 related to Associate Companies and Joint Ventures
Sl. Name of Associate Companies / Joint Ventures IndusInd Marketing and Financial Services
No. Private Limited (IMFS)
1 Latest Audited Balance Sheet March 31, 2016
2 Shares of Associate / Joint Ventures held by the company
on the year end
No of Shares 3,000
Amount of Investment in Associate / Joint Venture `30,000
Extent of Holding % 30%
3 Description of how there is significant influence Extent of Equity holding in the Associate
Company exceeds 20%.
4 Reason why the Associate / Joint Venture is not consolidated Not applicable
5 Net worth attributable to the Banks’s Shareholding (` in `1.21 crores
Crores)
6 Profit / Loss for the year
i. Considered in Consolidated Financial Statement `0.28 crores
(` in Crores)
ii. Not considered in Consolidated Financial Statement Nil
Notes:
1 Names of Associates or Joint Ventures which are yet to commence operations: NIL
2 Names of the Associates which have been liquidated or sold during the year: NIL
For Price Waterhouse Chartered Accountants LLP For INDUSIND BANK LTD.
Chartered Accountants
Firm Registration No: 012754N / N500016
R. Seshasayee T. Anantha Narayanan
Chairman Director
Russell I Parera Romesh Sobti
Partner Managing Director
Membership No: 042190
Place : Mumbai S. V. Zaregaonkar Haresh Gajwani
Date : April 21, 2016 Chief Financial Officer Company Secretary
27
ANNEXURE II TO THE DIRECTORS’ REPORT
SECRETARIAL AUDIT REPORT

FORM NO. MR-3
FOR THE FINANCIAL YEAR ENDED MARCH 31, 2016

[Pursuant to Section 204(1) of the Companies Act, 2013 and Rule No. 9 of the Companies (Appointment and
Remuneration of Managerial Personnel) Rules, 2014]
To
The Members,
INDUSIND BANK LIMITED
CIN: L65191PN1994PLC076333
We have conducted the Secretarial Audit of the compliance of applicable statutory provisions and the adherence to good
corporate practices by IndusInd Bank Limited (hereinafter called “the Bank”) having CIN: L65191PN1994PLC076333.
Secretarial Audit was conducted in a manner that provided us a reasonable basis for evaluating the corporate
conducts / statutory compliances and expressing our opinion thereon.
Based on our verification of the Bank’s books, papers, minute books, forms and returns filed and other records
maintained by the Bank and also the information provided by the Bank, its officers, agents and authorized
representatives during the conduct of Secretarial Audit, we hereby report that in our opinion, the Bank has, during
the audit period covering the financial year ended on March 31, 2016 complied with the statutory provisions listed
hereunder and also that the Bank has proper Board-processes and compliance mechanism in place to the extent, in
the manner and subject to the reporting made hereinafter.
We have examined the books, papers, minute books, forms and returns filed and other records maintained by the
Bank for the financial year ended on March 31, 2016 according to the provisions of:
i. The Companies Act, 2013 (the Act) and the rules made thereunder.
ii. The Securities Contracts (Regulation) Act, 1956 (‘SCRA’) and the Rules made thereunder;
iii. The Depositories Act, 1996 and the Regulations and Bye-laws framed thereunder;
iv. Foreign Exchange Management Act, 1999 and the rules and regulations made thereunder to the extent of
Foreign Direct Investment and External Commercial Borrowings. The Bank does not have any Overseas Direct
Investment during the financial year.
v. The following Regulations and Guidelines prescribed under the Securities and Exchange Board of India Act,
1992 (‘SEBI Act’):-
a. The Securities and Exchange Board of India (Substantial Acquisition of Shares and Takeovers) Regulations,
2011;
b. The Securities and Exchange Board of India (Prohibition of Insider Trading) Regulations, 1992 and
Regulations, 2015;
c. The Securities and Exchange Board of India (Issue of Capital and Disclosure Requirements) Regulations,
2009;
d. The Securities and Exchange Board of India (Employee Stock Option Scheme and Employee Stock
Purchase Scheme) Guidelines, 1999 and The Securities and Exchange Board of India (Share Based
Employee Benefits) Regulation, 2014;
e. The Securities and Exchange Board of India (Issue and Listing of Debt Securities) Regulations, 2008;
f. The Securities and Exchange Board of India (Registrars to an Issue and Share Transfer Agents) Regulations,
1993 regarding the Companies Act and dealing with client;
28
g. The Securities and Exchange Board of India (Delisting of Equity Shares) Regulations, 2009# ; and
h. The Securities and Exchange Board of India (Buyback of Securities) Regulations, 1998# ;
# The Regulations or Guidelines, as the case may be were not applicable for the period under review.
The list of Acts, Laws and Regulations specifically applicable to the Bank are given below:
vi. The Banking Regulation Act, 1949.
We have also examined compliance with the applicable clauses of the following:
i. Secretarial Standards issued by the Institute of Company Secretaries of India.;
ii. The Listing Agreements entered into by the Company with Stock Exchange(s).
iii. The Securities and Exchange Board of India (Listing Obligations and Disclosure Requirements) Regulations,
2015 (“Listing Regulations”).
During the period under review, the Bank has complied with the provisions of the Act, Rules, Regulations, Guidelines,
Standards, etc. mentioned above, to the extent applicable.
We further report that -
The Board of Directors of the Bank is duly constituted with proper balance of Executive Directors, Non-Executive
Directors and Independent Directors. The changes in the composition of the Board of Directors that took place during
the period under review were carried out in compliance with the provisions of the Act.
Adequate notices were given to all directors to schedule the Board Meetings, agenda and detailed notes on agenda
were sent at least seven days in advance, and a system exists for seeking and obtaining further information and
clarifications on the agenda items before the meeting and for meaningful participation at the meeting.
During the period under review, decisions were carried through unanimously and no dissenting views were observed,
while reviewing the Minutes.
We further report that there are adequate systems and processes in the Bank commensurate with the size and
operations of the Bank to monitor and ensure compliance with applicable laws, rules, regulations and guidelines.
We further report that during the audit period, the Bank has undertaken following events / actions –
I. Members approval has been obtained through Postal Ballot on June 8, 2015 pursuant to the provisions of Section
42 and Section 62 of the Companies Act, 2013, to create, offer, issue and allot such number of Equity Shares,
in one or more tranches, to Qualified Institutional Buyers (“QIBs”) under the Qualified Institutions Placement
(“QIP”) route, in terms of Chapter VIII of the SEBI (Issue of Capital and Disclosure Requirements) Regulations,
2009, in the domestic or one or more international markets, whether or not such investors are members of the
Bank, through Placement Document(s) or Offer Letter(s) not exceeding 10% of the Authorised Share Capital of
the Bank, i.e., 6,00,00,000 Equity Shares of ` 10/- each, at an aggregate issue size of ` 60 crores in face value,
at such price or prices, whether at a discount or premium to the market price.
II. Members approval has been obtained through Postal Ballot on July 30, 2015 pursuant to the provisions of
Section 42 and Section 62 of the Companies Act, 2013, to offer, issue and allot on a preferential basis, up to
87,81,360 Equity Shares of ` 10/- each i.e., up to 1.5% of the Authorised Equity Share Capital of the Bank of
` 600 crores and within the limit of 10% of the Authorised Equity Share Capital of the Bank as approved by the
members through Postal Ballot on June 8, 2015.
III. Members approval has been obtained at the Annual General Meeting held on August 17, 2015 pursuant to the
provisions of Section 180(1)(c) of the Companies Act, 2013 to borrowings by the Board of Directors from time
to time such sum or sums of monies as they may deem necessary for the purpose of carrying on the business
of the Bank, so however, that apart from temporary loans obtained from the bankers in the ordinary course
of business and acceptances of deposits of money from public repayable on demand or otherwise and / or
29
temporary loans obtained in the ordinary course of business, whether in India or outside India, the total amount
of such borrowings outstanding at any time shall not exceed ` 35,000 crores.
IV. Members approval has been obtained at the Annual General Meeting held on August 17, 2015 pursuant to
the provisions of Section 42 of the Companies Act, 2013 for borrowings/raising of funds by the Bank in the
Indian / foreign currency, by way of issue of securities including but not limited to Bonds and Non-convertible
Debentures (NCDs) i.e. Long-Term Infrastructure Bonds and Subordinated Non-convertible Debentures / Bonds
eligible to be included as Additional Tier 1 (AT1) and Tier 2 (T2) Capital of the Bank, up to ` 5,000 crores on
Private Placement basis.
For Bhandari & Associates

Company Secretaries
S. N. Bhandari
Partner
FCS No.: 761; C.P. No. : 366
Place : Mumbai
Date : May 12, 2016
This report is to be read with our letter of even date which is annexed as Annexure ‘A’ and forms an integral part of
this report.
30
ANNEXURE A TO THE SECRETARIAL AUDIT REPORT
To
The Members,
INDUSIND BANK LIMITED
CIN: L65191PN1994PLC076333
Our Secretarial Audit Report for the Financial Year ended on March 31, 2016 of even date is to be read along with this
letter.
1. Maintenance of Secretarial record is the responsibility of the management of the Bank. Our responsibility is to
express an opinion on these secretarial records based on our audit.
2. We have followed the audit practices and processes as were appropriate to obtain reasonable assurance about
the correctness of the contents of the Secretarial records. The verification was done on test basis to ensure
that correct facts are reflected in Secretarial records. We believe that the processes and practices, we followed
provide a reasonable basis for our opinion.
3. We have not verified the correctness and appropriateness of financial records and Books of Accounts of the
Bank.
4. Whereever required, we have obtained the Management representation about the compliance of laws, rules and
regulations and happening of events etc.
5. The compliance of the provisions of Corporate and other applicable laws, rules, regulations, standards is the
responsibility of management. Our examination was limited to the verification of procedures on test basis.
6. The Secretarial Audit report is neither an assurance as to the future viability of the Bank nor of the efficacy or
effectiveness with which the management has conducted the affairs of the Bank.

Company Secretaries
S. N. Bhandari
Partner
FCS No: 761; C.P. No: 366
Place : Mumbai
Date : May 12, 2016
31
ANNEXURE III TO THE DIRECTORS’ REPORT
The details pursuant to Section 197(12) of the Companies Act, 2013 read with Rule 5 of the Companies
(Appointment and Remuneration of Managerial Personnel) Rules, 2014
¾ The ratio of the remuneration of each Director to the median remuneration of the employees of the Bank for the
financial year is given below:
Name Ratio
Romesh Sobti (Managing Director & CEO) 131x
All Directors, except Managing Director & CEO are “Non-Executive” and receive remuneration only by way of
Sitting Fees for attending the meetings of the Board and of the Committees of the Board.
¾ The percentage increase in remuneration of each Director, Chief Financial Officer, Chief Executive Officer,
Company Secretary, if any, in the financial year:
Name Percentage
Romesh Sobti (Managing Director & CEO) 7%
S. V. Zaregaonkar (Chief Financial Officer) 14%
Haresh Gajwani (Company Secretary) 9.4%
¾ The percentage increase in the median remuneration of employees in the financial year:
The median of fixed remuneration of the employees in the financial year was increased by around 7.5%. The
calculation of % increase in median of fixed remuneration of employees is made only for those employees who
were eligible and received increments in the financial year.
¾ The number of permanent employees on the rolls of the Bank:
There were 23,060 employees on the rolls of the Bank as on March 31, 2016.
¾ The explanation on the relationship between average increase in remuneration and performance of the Bank;
Average increase in remuneration of employees of the Bank for FY 2015-16 is based on:
$QQXDOILQDQFLDOSHUIRUPDQFHRIWKH%DQN
5%,&RPSHQVDWLRQJXLGHOLQHVIRU:KROH7LPH'LUHFWRUV&KLHI([HFXWLYH2IILFHUV5LVN7DNHUVDQG&RQWURO
function staff.
0DUNHWWUHQGVDQG,QGXVWU\EHQFKPDUNV
,QGLYLGXDO3HUIRUPDQFHUDWLQJIRU)<
2EMHFWLYHRIUHZDUGLQJDQGUHWDLQLQJFULWLFDOWDOHQWKLJKSHUIRUPHUV
Accordingly, average increase in fixed remuneration of employees is 9.4%. The calculation of % increase in fixed
remuneration is calculated only for those employees who were eligible and received increments in FY 2015-16.
¾ Comparison of the remuneration of the Key Managerial Personnel (KMPs) against the performance of the Bank:
For FY 2015-16, KMPs were paid approx 0.35% of the Profit After Tax for the year.
32
¾ Comparison of each remuneration of the Key Managerial Personnel (KMP) against the performance of the Bank:
The comparison of remuneration of each of the KMPs against the performance of the Bank is as under:
Particulars % of PAT for FY 2015-16

- Managing Director & CEO 0.21%
- Chief Financial Officer 0.11%
- Company Secretary 0.03%
¾ Variations in the market capitalisation of the Bank, price earnings ratio as at the closing date of the current
financial year and previous financial year and percentage increase over decrease in the market quotations of
the shares of the Bank in comparison to the rate at which the bank came out with the last public offer in case of
listed companies:
The Market Capitalization of the Bank has increased from `46,909.29 crores as of March 31, 2015 to ` 57,570.88
crores as of March 31, 2016. Over the same period, the price to earnings ratio moved from 26.07x to 24.39x. The
Bank’s stock price as at March 31, 2016, has increased by 2,050.22% to ` 967.60 over the last public offering,
i.e. IPO in November 1997 at the price of ` 45 per share.
¾ Average percentile increase already made in the salaries of employees other than the managerial personnel
in the last financial year and its comparison with the percentile increase in the managerial remuneration and
justification thereof and point out if there are any exceptional circumstances for increase in the managerial
remuneration:
- All employees in the Bank are classified under Managerial Role, viz., Top Management, Senior Management,
Middle Management and Junior Management, etc. Hence, this section is Not Applicable to the Bank.
¾ The details of the key parameters for any variable components of remuneration availed by the Directors:
Other than Managing Director & CEO, all other Directors are entitled to Sitting Fees and reimbursement of
expenses incurred on travelling and accommodation for attending the meetings of the Board and of the
Committees thereof, as may be decided by the Board from time to time and do not receive remuneration in any
form from the Bank.
The variable component of the remuneration for Managing Director & CEO is based on the following parameters:
- Annual performance on Bank’s business objectives approved at the beginning of the financial year by the
Board of Directors.
- Bank’s financial performance and profitability.
- The variable component of the remuneration is based on the Bank’s compensation policy designed as per
the RBI guidelines on Compensation of Whole Time Directors / Chief Executive Officers / Risk Takers and
Control function staff.
¾ The Ratio of the remuneration of highest paid Director to that of the employees who are not Directors but receive
remuneration in excess of the highest paid Director during the year:
Managing Director & CEO is the only Executive Director on the Board of the Bank, and draws remuneration from
the Bank, subject to approval of the shareholders of the Bank and Reserve Bank of India.
No employee of the Bank was in receipt of remuneration in excess of the Managing Director & CEO during the
year. Hence, this section is not applicable to the Bank.
¾ Affirmation that the remuneration is as per the Remuneration Policy of the Bank.
Yes, it is as per the Remuneration Policy.
Note:
Remuneration of KMPs is as per the Form 16 (on an annualised basis) excluding Stock Options exercised, since
Options do not form part of total cost to the Bank.
33
Statutory Disclosures Regarding ESOPs (Forming part of the Directors’ Report for the year ended March 31, 2016)
34
Sl. Particulars ESOP 2007 Options Options Options Options Options
No. (As at Granted on Granted on Granted on Granted on Granted on
March 31, May 22, July 24, September 21, November 4, January 12,
2016) 2015 2015 2015 2015 2016
1 No. of options granted 37,570,300 52,600 1,630,000 193,000 93,500 1,033,500
2 No. of options surrendered (cancelled) 1,694,854 3,000 36,000 10,000 6,000 -
3 Pricing Formula Options granted at market price, except some options granted on July 18, 2008, January 28, 2010,
February 7, 2011, January 29, 2014 and January 12, 2016 are at discount to market price.
4 No. of options Vested 29,790,351 0 8,000 - - -
5 No. of options Exercised 22,989,195 - - - - -
6 No. of shares arising as a result of 22,989,195 - - - -
exercise of options
7 Options Lapsed 0 - - - - -
8 Variation in terms of ESOP N.A. - - - - -
9 Money realised by exercise of options 26,944 - - - - -
(` In Lakhs)
10 Total No. of Options in force 12,886,251 49,600 1,594,000 183,000 87,500 1,033,500
11 Employee-wise details of options
granted to:
(a) Key managerial personnel i.e. MD 18,899,000 - - - - -
& CEO and SEVPs, etc.
Mr. Romesh Sobti (MD & CEO) - - - - - 1,000,000
(b) Any other employee who receives 3,760,000 - - 150,000 - -
a grant in any one year of options
amounting to 5% or more of the
options granted during the year.
(c) Identified employees who were Nil - - - - -
ANNEXURE IV TO THE DIRECTORS’ REPORT
granted option, during any one

year equal to or exceeding 1%
of the issued capital (excluding
outstanding warrants and
conversions) of the Bank at the time
of grant.
2016) 2015 2015 2015 2015 2016
12 Diluted Earnings per share (EPS) The Diluted EPS of the Bank calculated after considering the effect of potential equity shares arising
pursuant to issue of shares on exercise on account of exercise of options is `39.26
of option, calculated as per Accounting
Standard (AS) 20- “Earning Per Share”
13 Where the company has calculated the The Bank has charged ` 2.22 crores to the Profit and Loss account being the intrinsic value of
employee compensation cost using stock options granted for the year ended March 31, 2016. Had the Bank adopted the Black Scholes
the intrinsic value of the stock options, model based fair valuation, compensation cost for the year ended March 31, 2016, would have
the difference between the employee increased by ` 67.88 crores and the proforma profit after tax would have been lower by ` 44.39
compensation cost so computed and crores. On a proforma basis, the basic and diluted earnings per share would have been ` 38.91 and
the employee compensation cost that ` 38.49, respectively.
shall have been recognized if it had
used the fair value of options, shall be
disclosed. The impact of this difference
on profits and on EPS of the company
shall also be disclosed
14 Weighted average exercise prices and The weighted average market price of options exercised during the year is ` 877.86
weighted average fair values of options Grants whose Exercise Price equals market price:
shall be disclosed separately for options The weighted average exercise price of options granted during the year is ` 942.14
whose exercise price either equals or
The weighted average fair value of options granted during the year is ` 383.46
exceeds or is less than the market price
of the stock Grants whose Exercise price is less than market price:
The weighted average exercise price of options granted during the year is ` 886.75
The weighted average fair value of options granted during the year is ` 382.02
15 A description of the method and The fair value has been calculated using the Black Scholes Option Pricing model.
significant assumptions used during the
year to estimate the fair value of Options,
including the following weighted-
average information:
Risk Free Interest Rate 7.84% 7.82% 7.74% 7.58% 7.55%
Expected Life 4.50 4.50 4.50 4.50 4.51
Expected Volatility 36.43% 35.63% 35.26% 34.97% 32.61%
Dividend Yield 0.41% 0.42% 0.44% 0.44% 0.43%
Price of the underlying share in the 848.20 949.80 918.65 911.85 936.75
market at the time of option grant.
35
36
2016) 2015 2015 2015 2015 2016
Table “A” Any other employee who
receives a grant in any one year of
Options amounting to 5% or more of the
Options granted during the year
Name Number of Options granted:
Bijananda Pattanayak 150,000
Romesh Sobti 1,000,000
Note to “Table A”
33% of these Options will vest on 21/9/2016 12/1/2017
ANNEXURE V TO THE DIRECTORS’ REPORT
Form No. MGT-9

EXTRACT OF ANNUAL RETURN
as on the financial year ended on 31st March, 2016
[Pursuant to section 92(3) of the Companies Act, 2013 and Rule 12(1) of the Companies (Management and
Administration) Rules, 2014]
I. Registration and other details:

CIN L65191PN1994PLC076333
Registration Date January 31, 1994
Name of the Company IndusInd Bank Limited
Category / Sub-Category of the Private Sector Bank
Company
Address of the Registered office and 2401, General Thimmayya Road, Cantonment, Pune – 411001
contact details Tel. No.: 020 – 3046 1600 – 1609
Email: [email protected]
Website: www.indusind.com
Whether listed company Yes
Name, Address and Contact details of LINK INTIME INDIA PRIVATE LIMITED
Registrar and Transfer Agent, if any C-13, Pannalal Silk Mills Compound,
L.B.S. Marg, Bhandup (West),
Mumbai – 400 078
Tel No.: 022 – 2594 6980
Email: [email protected]
Website: www.linkintime.co.in
II. Principal business activities of the company

All the Business activities contributing 10% or more of the total turnover of the company are:
NIC Code of the % to total turnover of

Name and Description of main products / services
product / service the company
Banking Services 64191 100%
III. Particulars of holding, subsidiary and associate companies

Sl. Name and address of the company CIN / GLN Holding / % of Applicable
No. Subsidiary/ shares section
Associate held
1 ALF Insurance Services Private U67200TN2003PTC050551 Subsidiary 100 2(87)
Limited (Under
Add: No. 115 & 116 G N Chetty Road, liquidation)
No. 115 & 116 GN Chetty Road, T.
Nagar, Chennai – 600 017, Tamil Nadu
2 IndusInd Marketing and Financial U67190TN2002PTC048590 Associate 30 2(6)

Services Private Limited
Add: No.115 & 116 G N Chetty Road,
T Nagar, Chennai – 600017, Tamil
Nadu
37
IV. Shareholding Pattern (Equity Share Capital breakup as percentage of total Equity)
i. Category-wise Shareholding as of March 31, 2016
Category of Shareholders No. of Shares held at the beginning of the year No. of Shares held at the end of the year % Change
during the
Demat Physical Total % of Total Demat Physical Total % of Total year
Shares Shares
A. Promoters
(1) Indian
a) Individual / HUF 0 0 0 0 0 0 0 0 0
b) Central Govt. 0 0 0 0 0 0 0 0 0
c) State Govt(s) 0 0 0 0 0 0 0 0 0
d) Bodies Corp. 0 0 0 0 0 0 0 0 0
e) Banks / FI 0 0 0 0 0 0 0 0 0
f) Any Other 0 0 0 0 0 0 0 0 0
Sub-total (A)(1): 0 0 0 0 0 0 0 0 0
(2) Foreign
a) NRIs – Individuals 0 0 0 0 0 0 0 0 0
b) Other Individuals 0 0 0 0 0 0 0 0 0
c) Bodies Corp. 7,98,99,984 0 7,98,99,984 15.09 8,86,81,344 0 8,86,81,344 14.90 -0.19
d) Banks / FI 0 0 0 0 0 0 0 0 0
e) Any Other 0 0 0 0 0 0 0 0 0
Sub-total (A)(2):- 7,98,99,984 0 7,98,99,984 15.09 8,86,81,344 0 8,86,81,344 14.90 -0.19
Total shareholding of 7,98,99,984 0 7,98,99,984 15.09 8,86,81,344 0 8,86,81,344 14.90 -0.19
Promoter (A)=(A)(1)+(A)(2)
B. Public Shareholding
(1) Institutions
a) Mutual Funds / UTI 3,96,10,787 3,150 3,96,13,937 7.48 6,48,12,362 3,150 6,48,15,512 10.89 3.41
b) Banks / FI 11,88,049 562 11,88,611 0.22 15,17,960 337 15,18,297 0.26 0.04
c) Central Govt 50 0 50 0 50 0 50 0 0
d) State Govt(s) 0 0 0 0 0 0 0 0 0
e) Venture Capital Funds 0 0 0 0 0 0 0 0 0
f) Insurance Companies 68,52,422 0 68,52,422 1.29 16,19,557 0 16,19,557 0.27 -1.02
g) FIIs / FPI 22,80,03,406 0 22,80,03,406 43.06 25,76,04,939 0 25,76,04,939 43.30 0.24
h) Foreign Venture 0 0 0 0 0 0 0 0 0
Capital Funds
i) Others (specify) 0 0 0 0 0 0 0 0 0
Sub-total (B)(1):- 27,56,54,714 3,712 27,56,58,426 52.05 32,55,54,868 3,487 32,55,58,355 54.72 2.67
38
Category of Shareholders No. of Shares held at the beginning of the year No. of Shares held at the end of the year % Change
during the
Demat Physical Total % of Total Demat Physical Total % of Total year
Shares Shares
(2) Non – Institutions
a) Bodies Corp.
i) Indian 6,44,65,290 2,04,707 6,46,69,997 12.21 6,57,54,568 1,99,745 6,59,54,313 11.09 -1.12
ii) Overseas 3,76,000 11,01,000 14,77,000 0.28 8,28,000 6,49,000 14,77,000 0.25 -0.03
b) Individuals
i) Individual Shareholders 2,10,50,210 73,58,783 2,84,08,993 5.36 2,20,23,040 63,74,649 2,83,97,689 4.77 -0.59
holding nominal Share
Capital upto ` 1 lakh
ii) Individual Shareholders 83,20,832 2,38,159 85,58,991 1.62 1,07,92,737 1,82,059 1,09,74,796 1.84 0.22
holding nominal Share
Capital in excess of ` 1
lakh
c) Others (specify)
i) Clearing Member 4,48,792 0 4,48,792 0.08 14,16,784 0 14,16,784 0.24 0.16
ii) Hindu Undivided 0 0 0 0 6,88,857 0 6,88,857 0.12 0.12
Family
iii) Non Resident Indians 13,10,204 9,92,500 23,02,704 0.43 14,34,843 9,26,800 23,61,643 0.40 -0.03
(REPAT)
iv) Non Resident Indians 24,80,898 25,900 25,06,798 0.47 23,30,356 23,200 23,53,556 0.40 -0.07
(NON REPAT)
v) Foreign Nationals 0 0 0 0 425 0 425 0.00 0.00
vi) Foreign Portfolio 0 0 0 0 350 0 350 0.00 0.00
Investor (Individual)
vii) Directors / Relatives 1,00,580 0 1,00,580 0.02 580 0 580 0.00 -0.02
viii) Trusts 7,35,580 0 7,35,580 0.14 24,39,079 0 24,39,079 0.41 0.27
Sub-total (B)(2) : – 9,92,88,386 99,21,049 10,92,09,435 20.61 10,77,09,619 83,55,453 11,60,65,072 19.52 -1.09
Total Public Shareholding 37,49,43,100 99,24,761 38,48,67,861 72.69 43,32,64,487 83,58,940 44,16,23,427 74.23 1.54
(B) = (B) (1)+ (B) (2)
C. Shares held by 6,46,82,364 0 6,46,82,364 12.22 6,46,81,564 0 6,46,81,564 10.87 -1.35
Custodian for GDRs
& ADRs
Grand Total (A+B+C) 51,95,25,448 99,24,761 52,94,50,209 100.00 58,66,27,395 83,58,940 59,49,86,335 100.00 0
39
ii. Shareholding of Promoters as of March 31, 2016
Sl. Shareholder’s Shareholding at the beginning of the Shareholding at the end of the year % change in
No. Name year shareholding
No. of % of total % of Shares No. of % of total % of Shares during the
Shares Shares Pledged / Shares Shares Pledged / year
of the encumbered of the encumbered
company to total share company to total shares
1 IndusInd 6,03,99,984 11.41 0 6,70,38,208 11.27 0 -0.14#
International
Holdings Ltd.
2 IndusInd Limited 1,95,00,000 3.68 0 2,16,43,136 3.64 0 -0.04#
Total 7,98,99,984 15.09 0 8,86,81,344 14.91 0 -0.18
# During the year under review, there is a change in shareholding of the Promoters due to allotment of 87,81,360 Equity
Shares on preferential basis. The variation in terms of percentage is due to increase in Paid-up Share Capital of the
Bank on account of allotment of Equity Shares pursuant to exercise of Stock Options by the employees under ESOP
Scheme of the Bank and allotment of Equity Shares under Qualified Institutional Placement (QIP) and Preferential
basis to the Promoters of the Bank.
iii. Change in Promoters’ Shareholding (please specify, if there is no change)
Sl. Promoters Shareholding at the beginning of Cumulative Shareholding during

the year the year
No.
No. of Shares % of total No. of Shares % of total
Shares of the Shares of the
company company
1
IndusInd International Holdings 6,03,99,984 11.41 6,03,99,984 11.41
Ltd
Add Shares Allotted on Preferential 66,38,224 1.12 6,70,38,208 11.34
basis on 06.08.2015
At the end of the year (or on the – – 6,70,38,208 11.27
date of separation, if separated
during the year) (31-03-2016)
2 IndusInd Limited 1,95,00,000 3.68 1,95,00,000 3.68
Add Shares Allotted on Preferential 21,43,136 0.36 2,16,43,136 3.66
basis on 06.08.2015
At the end of the year (or on the – – 2,16,43,136 3.64
date of separation, if separated
during the year) (31-03-2016)
40
iv. Shareholding Pattern of Top Ten Shareholders (other than Directors, Promoters and Holders of GDRs and
ADRs):
Sl. For Each of the Top Remarks Date * Shareholding at the Cumulative Shareholding
No. 10 Shareholders beginning of the year during the year
No. of % of total No. of % of total
shares shares shares shares of
of the the company
Company
1 Bridge India Fund At the beginning of 01.04.2015 2,22,63,458 4.21 2,22,63,458 4.21
the year
Decrease 11.03.2016 (10,000) 0.00 2,22,53,458 3.74
Decrease 18.03.2016 (4,75,000) 0.08 2,17,78,458 3.66
Decrease 25.03.2016 (7,65,000) 0.13 2,10,13,458 3.53
At the end of the 31.03.2016 0 0 2,10,13,458 3.53
year (or on the date
of separation, if
separated during the
year)
2 Ga Global At the beginning of 01.04.2015 1,27,76,391 2.41 1,27,76,391 2.41
Investments Limited the year
Decrease 31.07.2015 (7,85,074) 0.13 1,19,91,317 2.06
Decrease 07.08.2015 (14,818) 0.00 1,19,76,499 2.02
Decrease 23.10.2015 (33,975) 0.01 1,19,42,524 2.02
Decrease 01.01.2016 (2,33,000) 0.04 1,17,09,524 1.97
At the end of the 31.03.2016 - - 1,17,09,524 1.97
of separation, if
year)
3 Hinduja Ventures At the beginning of 01.04.2015 39,60,196 0.75 39,60,196 0.75
Limited the year
Decrease 12.06.2015 (1,90,000) 0.04 37,70,196 0.71
Decrease 19.06.2015 (2,10,000) 0.04 35,60,196 0.67
Decrease 17.07.2015 (3,00,000) 0.05 32,60,196 0.56
Decrease 18.09.2015 (75,000) 0.01 31,85,196 0.54
Increase 11.12.2015 83,46,000 1.41 1,15,31,196 1.94
Decrease 18.12.2015 (7,01,000) 0.12 1,08,30,196 1.82
Decrease 25.12.2015 (1,05,000) 0.02 1,07,25,196 1.81
Decrease 18.03.2016 (5,00,000) 0.08 1,02,25,196 1.72
At the end of the 31.03.2016 0 0 1,02,25,196 1.72
of separation, if
year)
4 Afrin Dia At the beginning of 01.04.2015 1,50,05,666 2.83 1,50,05,666 2.83
the year
Decrease 10.04.2015 (2,46,809) 0.05 1,47,58,857 2.79
Decrease 04.03.2016 (25,60,294) 0.43 1,21,98,563 2.05
Decrease 11.03.2016 (3,00,000) 0.05 1,18,98,563 1.99
41
of the the company
Company
Decrease 18.03.2016 (18,92,100) 0.32 1,00,06,463 1.68
Decrease 25.03.2016 (2,18,000) 0.04 97,88,463 1.65
Decrease 31.03.2016 (2,00,000) 0.03 95,88,463 1.61
At the end of the 31.03.2016 0 0 95,88,463 1.61
of separation, if
year)
5 Franklin Templeton At the beginning of 01.04.2015 80,36,749 1.52 80,36,749 1.52
Mutual Fund A/C the year
Franklin India Prima Decrease 10.04.2015 (272) 0.00 80,36,477 1.52
Plus
Decrease 17.04.2015 (65,228) 0.01 79,71,249 1.51
Decrease 24.04.2015 (36,245) 0.01 79,35,004 1.50
Increase 01.05.2015 45,257 0.01 79,80,261 1.51
Increase 08.05.2015 49,923 0.01 80,30,184 1.52
Increase 15.05.2015 1,20,038 0.02 81,50,222 1.54
Increase 22.05.2015 71,295 0.01 82,21,517 1.55
Increase 29.05.2015 29,073 0.01 82,50,590 1.55
Increase 05.06.2015 51,145 0.01 83,01,735 1.56
Increase 19.06.2015 100 0.00 83,01,835 1.56
Decrease 26.06.2015 (2,00,798) 0.04 81,01,037 1.53
Decrease 30.06.2015 (29) 0.00 81,01,008 1.53
Increase 03.07.2015 522 0.00 81,01,530 1.39
Decrease 10.07.2015 (7,864) 0.00 80,93,666 1.39
Increase 17.07.2015 29 0.00 80,93,695 1.39
Decrease 24.07.2015 (350) 0.00 80,93,345 1.39
Increase 07.08.2015 50 0.00 80,93,395 1.37
Decrease 14.08.2015 (194) 0.00 80,93,201 1.37
Increase 21.08.2015 136 0.00 80,93,337 1.37
Increase 28.08.2015 69,129 0.01 81,62,466 1.38
Increase 04.09.2015 1,00,142 0.02 82,62,608 1.40
Increase 11.09.2015 99,834 0.02 83,62,442 1.41
Increase 18.09.2015 165 0.00 83,62,607 1.41
Decrease 25.09.2015 (3,09,328) 0.05 80,53,279 1.36
Decrease 09.10.2015 (1,382) 0.00 80,51,897 1.36
Decrease 23.10.2015 (418) 0.00 80,51,479 1.36
Decrease 30.10.2015 (12,100) 0.00 80,39,379 1.36
Increase 13.11.2015 50,000 0.01 80,89,379 1.37
Increase 20.11.2015 1,00,617 0.02 81,89,996 1.38
Increase 27.11.2015 45,000 0.01 82,34,996 1.39
Increase 04.12.2015 510 0.00 82,35,506 1.39
Decrease 11.12.2015 (19,287) 0.00 82,16,219 1.38
42
of the the company
Company
Increase 18.12.2015 528 0.00 82,16,747 1.38
Decrease 25.12.2015 (44) 0.00 82,16,703 1.38
Increase 31.12.2015 515 0.00 82,17,218 1.38
Increase 01.01.2016 367 0.00 82,17,585 1.38
Decrease 08.01.2016 (155) 0.00 82,17,430 1.38
Increase 15.01.2016 648 0.00 82,18,078 1.38
Increase 22.01.2016 50,407 0.01 82,68,485 1.39
Increase 29.01.2016 1,00,000 0.02 83,68,485 1.41
Increase 05.02.2016 20,000 0.00 83,88,485 1.41
Increase 12.02.2016 2,00,000 0.03 85,88,485 1.44
Increase 19.02.2016 3,81,000 0.06 89,69,485 1.51
Increase 04.03.2016 1,000 0.00 89,70,485 1.51
Decrease 31.03.2016 (983) 0.00 89,69,502 1.51
At the end of the 31.03.2016 0 0 89,69,502 1.51
of separation, if
year)
6 Goldman Sachs At the beginning of 01.04.2015 1,02,80,795 1.94 1,02,80,795 1.94
Investments the year
(Mauritius) I Ltd Decrease 17.04.2015 (15,273) 0.00 1,02,65,522 1.94
Increase 24.04.2015 2,50,000 0.05 1,05,15,522 1.99
Decrease 15.05.2015 (3,30,330) 0.06 1,01,85,192 1.92
Increase 22.05.2015 1,10,867 0.02 1,02,96,059 1.94
Decrease 05.06.2015 (500) 0.00 1,02,95,559 1.94
Decrease 19.06.2015 (6,000) 0.00 1,02,89,559 1.94
Decrease 26.06.2015 (7,02,500) 0.13 95,87,059 1.80
Decrease 03.07.2015 (29,750) 0.01 95,57,309 1.64
Increase 04.09.2015 4,46,169 0.08 1,00,03,478 1.69
Decrease 11.09.2015 (1,10,359) 0.02 98,93,119 1.67
Decrease 18.09.2015 (34,777) 0.01 98,58,342 1.67
Decrease 09.10.2015 (2,78,209) 0.05 95,80,133 1.62
Decrease 30.10.2015 (5,86,463) 0.10 89,93,670 1.52
Increase 06.11.2015 3,11,045 0.05 93,04,715 1.57
Decrease 15.01.2016 (1,25,000) 0.02 91,79,715 1.55
Decrease 29.01.2016 (90,120) 0.02 90,89,595 1.53
Decrease 31.03.2016 (3,21,946) 0.05 87,67,649 1.47
At the end of the 31.03.2016 0 0 87,67,649 1.47
of separation, if
year)
43
of the the company
Company
7 Hinduja Group At the beginning of 01.04.2015 82,49,117 1.56 82,49,117 1.56
Limited the year
Decrease 12.06.2015 (1,80,000) 0.03 80,69,117 1.52
Increase 19.06.2015 1,80,000 0.03 82,49,117 1.55
Decrease 17.07.2015 (4,00,000) 0.07 78,49,117 1.35
Increase 18.09.2015 4,25,000 0.07 82,74,117 1.40
Increase 30.09.2015 6,00,000 0.10 88,74,117 1.50
Increase 09.10.2015 5,00,000 0.08 93,74,117 1.58
Increase 04.12.2015 22,000 0.00 93,96,117 1.58
Increase 18.12.2015 3,25,000 0.05 97,21,117 1.64
Decrease 31.03.2016 (10,36,217) 0.17 86,84,900 1.46
At the end of the 31.03.2016 86,84,900 1.46 86,84,900 1.46
of separation, if
year)
8 Franklin Templeton At the beginning of 01.04.2015 76,06,520 1.44 76,06,520 1.44
Investment Funds the year
Increase 10.04.2015 1,75,293 0.03 77,81,813 1.47
Increase 24.04.2015 6,90,000 0.13 84,71,813 1.60
Increase 08.05.2015 3,62,000 0.07 88,33,813 1.67
Increase 15.05.2015 2,38,000 0.04 90,71,813 1.71
Decrease 20.11.2015 (3,50,000) 0.06 87,21,813 1.47
Decrease 11.03.2016 (1,73,000) 0.03 85,48,813 1.44
At the end of the 31.03.2016 0 0 85,48,813 1.44
of separation, if
year)
9 UTI – Equity Fund At the beginning of 01.04.2015 24,83,845 0.47 24,83,845 0.47
the year
Increase 10.04.2015 2,00,493 0.04 26,84,338 0.51
Decrease 17.04.2015 (3,786) 0.00 26,80,552 0.51
Increase 24.04.2015 1,55,207 0.29 28,35,759 5.36
Increase 01.05.2015 67,047 0.01 29,02,806 0.55
Increase 08.05.2015 55,724 0.01 29,58,530 0.56
Increase 15.05.2015 85,371 0.02 30,43,901 0.57
Increase 22.05.2015 43,906 0.01 30,87,807 0.58
Increase 29.05.2015 34,080 0.01 31,21,887 0.59
Increase 05.06.2015 14,211 0.00 31,36,098 0.59
Increase 12.06.2015 41,540 0.01 31,77,638 0.60
Increase 19.06.2015 31,069 0.01 32,08,707 0.60
Increase 26.06.2015 1,61,859 0.03 33,70,566 0.63
44
of the the company
Company
Decrease 30.06.2015 (55,058) 0.01 33,15,508 0.62
Increase 10.07.2015 3,76,138 0.06 36,91,646 0.63
Increase 17.07.2015 2,03,323 0.03 38,94,969 0.67
Decrease 24.07.2015 (7,896) 0.00 38,87,073 0.67
Increase 31.07.2015 41,101 0.01 39,28,174 0.67
Increase 07.08.2015 2,606 0.00 39,30,780 0.66
Decrease 14.08.2015 (28,384) 0.00 39,02,396 0.66
Decrease 21.08.2015 (11,446) 0.00 38,90,950 0.66
Increase 28.08.2015 1,14,124 0.02 40,05,074 0.68
Increase 04.09.2015 3,03,555 0.05 43,08,629 0.73
Increase 11.09.2015 32,940 0.01 43,41,569 0.73
Increase 18.09.2015 33,134 0.01 43,74,703 0.74
Increase 25.09.2015 260 0.00 43,74,963 0.74
Increase 30.09.2015 2,71,391 0.05 46,46,354 0.78
Increase 09.10.2015 1,11,808 0.02 47,58,162 0.80
Increase 16.10.2015 32 0.00 47,58,194 0.80
Increase 23.10.2015 25,960 0.00 47,84,154 0.81
Increase 30.10.2015 255 0.00 47,84,409 0.81
Increase 06.11.2015 80,000 0.01 48,64,409 0.82
Increase 13.11.2015 52,481 0.01 49,16,890 0.83
Increase 20.11.2015 27,151 0.00 49,44,041 0.83
Increase 27.11.2015 88 0.00 49,44,129 0.83
Increase 04.12.2015 11,131 0.00 49,55,260 0.84
Increase 11.12.2015 2,90,488 0.05 52,45,748 0.88
Increase 18.12.2015 2,42,049 0.04 54,87,797 0.92
Increase 25.12.2015 1,24,000 0.02 56,11,797 0.95
Increase 31.12.2015 3,53,734 0.06 59,65,531 1.00
Increase 01.01.2016 12,000 0.00 59,77,531 1.01
Increase 08.01.2016 48,175 0.01 60,25,706 1.02
Increase 15.01.2016 3,44,389 0.06 63,70,095 1.07
Increase 22.01.2016 5,36,508 0.09 69,06,603 1.16
Increase 29.01.2016 1,85,343 0.03 70,91,946 1.19
Increase 05.02.2016 3,01,562 0.05 73,93,508 1.24
Increase 12.02.2016 4,07,553 0.07 78,01,061 1.31
Increase 19.02.2016 1,43,417 0.02 79,44,478 1.34
Increase 26.02.2016 4,09,162 0.07 83,53,640 1.40
Decrease 04.03.2016 (7,650) 0.00 83,45,990 1.40
Decrease 11.03.2016 (3,632) 0.00 83,42,358 1.40
Increase 18.03.2016 1,000 0.00 83,43,358 1.40
Increase 25.03.2016 350 0.00 83,43,708 1.40
Increase 31.03.2016 3,516 0.00 83,47,224 1.40
45
of the the company
Company
At the end of the 31.03.2016 0 0 83,47,224 1.40
of separation, if
year)
10 ICICI Prudential Life At the beginning of 01.04.2015 84,62,134 1.60 84,62,134 1.60
Insurance Company the year
Ltd. Increase 10.04.2015 10,406 0.00 84,72,540 1.60
Decrease 17.04.2015 (2,70,132) 0.05 82,02,408 1.55
Increase 24.04.2015 30,744 0.01 82,33,152 1.55
Decrease 01.05.2015 (67,699) 0.01 81,65,453 1.54
Increase 08.05.2015 53,620 0.01 82,19,073 1.55
Increase 15.05.2015 25,683 0.00 82,44,756 1.56
Increase 22.05.2015 10,778 0.00 82,55,534 1.56
Increase 29.05.2015 26,565 0.01 82,82,099 1.56
Decrease 05.06.2015 (96,415) 0.02 81,85,684 1.54
Decrease 12.06.2015 (1,78,464) 0.03 80,07,220 1.51
Increase 19.06.2015 93,517 0.02 81,00,737 1.53
Decrease 26.06.2015 (79,899) 0.02 80,20,838 1.51
Increase 30.06.2015 3,129 0.00 80,23,967 1.51
Increase 03.07.2015 60,290 0.01 80,84,257 1.39
Increase 10.07.2015 34,836 0.01 81,19,093 1.40
Increase 17.07.2015 29,271 0.01 81,48,364 1.40
Increase 24.07.2015 27,008 0.00 81,75,372 1.40
Increase 31.07.2015 9,900 0.00 81,85,272 1.40
Increase 07.08.2015 6,516 0.00 8,191,788 1.38
Increase 14.08.2015 5,842 0.00 8,197,630 1.39
Increase 21.08.2015 6,808 0.00 82,04,438 1.39
Decrease 28.08.2015 (75,197) 0.01 81,29,241 1.37
Decrease 04.09.2015 (2,45,949) 0.04 78,83,292 1.33
Increase 11.09.2015 8,376 0.00 78,91,668 1.33
Increase 18.09.2015 24,592 0.00 79,16,260 1.34
Increase 25.09.2015 52,678 0.01 79,68,938 1.35
Decrease 30.09.2015 (54,441) 0.01 79,14,497 1.34
Increase 09.10.2015 2,43,027 0.04 81,57,524 1.38
Decrease 16.10.2015 (8,084) 0.00 81,49,440 1.38
Decrease 23.10.2015 (4,706) 0.00 81,44,734 1.38
Increase 30.10.2015 10,874 0.00 81,55,608 0.01
Decrease 06.11.2015 (4,873) 0.00 81,50,735 1.38
Increase 13.11.2015 6,962 0.00 81,57,697 1.38
Decrease 20.11.2015 (10,758) 0.00 81,46,939 1.37
46
of the the company
Company
Increase 27.11.2015 36,574 0.01 81,83,513 1.38
Increase 04.12.2015 22,054 0.00 82,05,567 1.38
Decrease 11.12.2015 (31,417) 0.01 81,74,150 1.38
Increase 18.12.2015 35,469 0.01 82,09,619 1.38
Decrease 25.12.2015 (847) 0.00 82,08,772 1.38
Increase 31.12.2015 21,006 0.00 82,29,778 1.39
Decrease 08.01.2016 (69,393) 0.01 81,60,385 1.37
Decrease 15.01.2016 (1,51,539) 0.03 80,08,846 1.35
Decrease 22.01.2016 (13,495) 0.00 79,95,351 1.34
Increase 29.01.2016 40,416 0.01 80,35,767 1.35
Decrease 05.02.2016 (11,599) 0.00 80,24,168 1.35
Decrease 12.02.2016 (2,91,226) 0.05 77,32,942 1.30
Decrease 19.02.2016 (1,15,327) 0.02 76,17,615 1.28
Increase 26.02.2016 18,604 0.00 76,36,219 1.28
Decrease 04.03.2016 (1,45,158) 0.02 74,91,061 1.26
Decrease 11.03.2016 (1,07,680) 0.02 73,83,381 1.24
Increase 18.03.2016 499 0.00 73,83,880 1.24
Increase 25.03.2016 37,327 0.01 74,21,207 1.25
Increase 31.03.2016 5,223 0.00 74,26,430 1.25
At the end of the 31.03.2016 0 0 74,26,430 1.25
of separation, if
year)
11 Morgan Stanley Asia At the beginning of 01.04.2015 70,52,241 1.19 70,52,241 1.19
(Singapore) Pte. the year
Decrease 10.04.2015 (1,03,048) 0.02 69,49,193 1.31
Decrease 17.04.2015 (3,309) 0.00 69,45,884 1.31
Decrease 24.04.2015 (3,67,231) 0.07 65,78,653 1.24
Decrease 01.05.2015 (2,84,119) 0.05 62,94,534 1.19
Increase 08.05.2015 11,86,778 0.22 51,07,756 0.96
Increase 15.05.2015 47,417 0.01 51,55,173 0.97
Decrease 22.05.2015 (37,413) 0.01 51,17,760 0.97
Decrease 29.05.2015 (81,648) 0.02 50,36,112 0.95
Decrease 05.06.2015 (85,827) 0.02 49,50,285 0.93
Increase 12.06.2015 24,586 0.00 49,74,871 0.94
Decrease 19.06.2015 (3,13,555) 0.06 46,61,316 0.88
Decrease 26.06.2015 (2,42,643) 0.05 44,18,673 0.83
Decrease 30.06.2015 (1,000) 0.00 44,17,673 0.83
Decrease 03.07.2015) (2,91,017) 0.05 41,26,656 0.71
Increase 10.07.2015 57,97,154 0.99 99,23,810 1.70
47
of the the company
Company
Decrease 17.07.2015 (3,53,396) 0.06 95,70,414 1.64
Decrease 24.07.2015 (3,00,792) 0.05 92,69,622 1.59
Decrease 31.07.2015 (5,65,442) 0.10 87,04,180 1.49
Decrease 07.08.2015 (72,151) 0.01 86,32,029 1.46
Increase 14.08.2015 2,80,305 0.05 89,12,334 1.51
Decrease 21.08.2015 (20,059) 0.00 88,92,275 1.50
Increase 28.08.2015 91,244 0.02 89,83,519 1.52
Increase 04.09.2015 71,651 0.01 90,55,170 1.53
Decrease 11.09.2015 (4,58,206) 0.08 85,96,964 1.45
Decrease 18.09.2015 (2,10,339) 0.04 83,86,625 1.42
Increase 25.09.2015 1,396 0.00 83,88,021 1.42
Decrease 30.09.2015 (2,81,240) 0.05 81,06,781 1.37
Decrease 09.10.2015 (30,435) 0.01 80,76,346 1.36
Increase 16.10.2015 18 0.00 80,76,364 1.36
Decrease 23.10.2015 (59,238) 0.01 80,17,126 1.35
Decrease 30.10.2015 (1,08,099) 0.00 79,09,027 0.01
Decrease 06.11.2015 (1,60,267) 0.03 77,48,760 1.31
Decrease 13.11.2015 (3,91,490) 0.07 73,57,270 1.24
Decrease 20.11.2015 (2,04,944) 0.03 71,52,326 1.21
Decrease 27.11.2015 (3,12,152) 0.05 68,40,174 1.15
Decrease 04.12.2015 (13,304) 0.00 68,26,870 1.15
Decrease 11.12.2015 (2,46,502) 0.04 65,80,368 1.11
Decrease 18.12.2015 (2,02,688) 0.03 63,77,680 1.07
Increase 25.12.2015 5,93,310 0.10 69,70,990 1.17
Increase 31.12.2015 1,59,129 0.03 71,30,119 1.20
Decrease 08.01.2016 (15,149) 0.00 71,14,970 1.20
Decrease 15.01.2016 (97,678) 0.02 70,17,292 1.18
Decrease 22.01.2016 (3,90,439) 0.07 66,26,853 1.11
Decrease 29.01.2016 (4,44,600) 0.07 61,82,253 1.04
Decrease 05.02.2016 (5,55,006) 0.09 56,27,247 0.95
Decrease 12.02.2016 (7,62,357) 0.13 48,64,890 0.82
Decrease 19.02.2016 (7,16,027) 0.12 41,48,863 0.70
Decrease 26.02.2016 (1,01,974) 0.02 40,46,889 0.68
Decrease 04.03.2016 (9,54,527) 0.16 30,92,362 0.52
Decrease 11.03.2016 (2,40,008) 0.04 28,52,354 0.48
Decrease 25.03.2016 (15,296) 0.00 28,37,058 0.48
Increase 31.03.2016 5,91,301 0.10 34,28,359 0.58
At the end of the 31.03.2016 0 0 34,28,359 0.58
of separation, if
year)
48
of the the company
Company
12 IDL Speciality At the beginning of 01.04.2015 72,81,000 1.38 72,81,000 1.38
Chemicals Limited the year
Increase 19.06.2015 4,00,000 0.08 76,81,000 1.45
Increase 24.07.2015 2,65,000 0.05 79,46,000 1.36
Decrease 18.09.2015 (3,00,000) 0.05 76,46,000 1.29
Increase 30.09.2015 7,00,000 0.12 83,46,000 1.41
Decrease 11.12.2015 (83,46,000) 1.41 0 0
At the end of the 31.03.2016 0 0 0 0
of separation, if
year)
Note: *Date of transfer has been considered as the date on which the beneficiary position was provided by the
Depositories to the Bank. Shareholding is consolidated based on Permanent Account Number (PAN) of the shareholder.
Increase = Purchase of shares of the Bank / Decrease = Sale of shares of the Bank
v. Shareholding of Directors and Key Managerial Personnel:
Sl. For Each of the Directors and KMP Shareholding at the beginning Cumulative Shareholding
of the year 01.04.2015 during the year
No.
No. of Shares % of total No. of Shares % of total
Shares of the Shares of the
company company
1 T. Anantha Narayanan, Director 580 0.00 580 0.00
At the end of the year (or on the date 0 0 580 0.00
of separation, if separated during the
year) (31-03-2016)
2 Romesh Sobti, Managing Director & 1,00,000 0.02 1,00,000 0.02
CEO
Add – 03.06.2015 ESOP Allotment 1,80,000 0.03 2,80,000 0.05
Less – 21.10.2015 Market Sale (-) 55,274 0.01 2,24,726 0.04
Less – 23.10.2015 Market Sale (-) 8,843 0.00 2,15,883 0.04
Less – 01.12.2015 Market Sale (-) 15, 883 0.00 2,00,000 0.03
Less – 09.03.2016 Market Sale (-) 50,000 0.01 1,50,000 0.02
Less – 10.03.2016 Market Sale (-) 50,000 0.01 1,00,000 0.02
Less – 11.03.2016 Market Sale (-) 1,00,000 0.02 0 0
At the end of the year (or on the date 0 0 0 0
year) (31-03-2016)
49
3 S.V. Zaregaonkar, Chief Financial 150 0.00 150 0.00
Officer
Add – 28.01.2016 ESOP Allotment 25,500 0.00 25,650 0.00
At the end of the year (or on the date 0 0 25,650 0.00
year) (31-03-2016)
4 Haresh K. Gajwani, Company 0 0.00 0 0.00
Secretary
Add – 05.11.2015 – ESOP Allotment 6,600 0.00 6,600 0.00
Less – 06.11.2015 – Market Sale (-) 1,500 0.00 5,100 0.00
Less – 09.11.2015 – Market Sale (-) 1,250 0.00 3,850 0.00
Less – 13.11.2015 – Market Sale (-) 750 0.00 3,100 0.00
Less – 16.11.2015 – Market Sale (-) 1,500 0.00 1,600 0.00
Less – 30.11.2015 – Market Sale (-) 450 0.00 1,150 0.00
Less – 01.12.2015 – Market Sale (-) 100 0.00 1,050 0.00
Less – 02.12.2015 – Market Sale (-) 200 0.00 850 0.00
Less – 03.12.2015 – Market Sale (-) 850 0.00 0 0
At the End of the year (or on the date 0 0 0 0
year) (31-03-2016)
V. Indebtedness
Statement on Indebtedness of the Company including interest outstanding / accrued but not due for
payment
` in crores
Particulars Secured Loans Unsecured Deposits Total
excluding deposits Loans * Indebtedness
Indebtedness at the beginning of
the financial year:
i. Principal Amount - 94,752 - 94,752
ii. Interest due but not paid - -
iii. Interest accrued but not due 658 658
Total (i+ii+iii) - 95,410 - 95,410
Net Change in Indebtedness during - 20,535 - 20,535
the financial year
Indebtedness at the end of the
financial year:
i. Principal Amount - 1,15,156 - 1,15,156
ii. Interest due but not paid - -
iii. Interest accrued but not due 789 789
Total (i+ii+iii) - 1,15,945 - 1,15,945
*A Bank is governed by the Banking Regulation Act, 1949 and duly licensed by Reserve Bank of India to operate as
a Scheduled Commercial Bank in India, the entire amount of Client Deposits and other borrowings are shown under
“Unsecured Loans”.
50
VI. Remuneration of directors and Key Managerial Personnel
A. Remuneration to Managing Director, Whole-time Directors and/or Manager:
In `
Sl. Particulars of Remuneration Mr. Romesh Sobti,
No. Managing Director & CEO
1 Gross Salary
i. Salary as per provisions contained in Section 17(1) of IT Act, 1961 460,52,272
ii. Value of perquisites under Section 17(2) of IT Act, 1961 89,20,056
iii. Profits in lieu of salary under Section 17(3) of IT Act, 1961 -
2 Stock Option -
3 Sweat Equity -
4 Commission -
- As % of profit
- Others
5 Others, please specify (PF, Medical) 22,10,453
6 Total # 5,71,82,781
7 Ceiling as per the Companies Act, 2013 % -
# Total of Remuneration details does not include Stock Options.
% In terms of the provisions of the Companies Act, 2013, the Remuneration payable to Managing Director &
CEO shall not exceed 5% of the Net Profit of the Bank. The remuneration paid to MD & CEO is well within the
said limit.
B. Remuneration to other Directors:
Non-Executive Directors receive remuneration only by way of Sitting Fee for attending the meetings of the
Board and of various Board Committees. As per the Bank’s policy, no Stock Options were granted to the Non-
Executive Directors.
C. Remuneration to Key Managerial Personnel other than MD / Manager / WTD
In `
Sl. Particulars of Remuneration Key Managerial Personnel
No. Company Chief Financial Total
Secretary Officer
1. Gross salary 58,99,708 2,38,28,690 2,97,28,398
Salary as per provisions contained in Section 17(1) of
the Income-tax Act, 1961
Value of perquisites u/s 17(2) Income-tax Act, 1961 53,119 32,74,309 33,27,428
Profits in lieu of salary under Section 17(3)
Income tax Act, 1961
2. Stock Option – – –
3. Sweat Equity – – –
4. Commission as % of Profit – – –
Others, specify.
5. Others, please specify 2,32,708 7,54,200 9,86,908
Total 61,85,535 2,78,57,199 3,40,42,734
(Remuneration details does not include Stock Options)
51
VII. Penalties / Punishment / Compounding of offences
Type Section Brief Details of Penalty Authority [RD / Appeal made, if
of the Description / Punishment/ NCLT/ COURT] any (give Details)
Companies Compounding
Act fees imposed
Company
Penalty None
Punishment
Compounding
Directors
Penalty None
Punishment
Compounding
Other officers in default
Penalty None
Punishment
Compounding
52
ANNEXURE VI TO THE DIRECTORS’ REPORT
ANNUAL REPORT ON CORPORATE SOCIAL RESPONSIBILITY (CSR) ACTIVITIES
SI. Particulars
No.
1 A Brief outline of the Bank’s CSR Policy, including overview of projects or programs proposed to be undertaken
and a reference to the web-link to the CSR Policy and projects or programs.
Remarks
The Bank’s CSR Policy
CSR Mission Statement
At IndusInd Bank, we believe that ‘Good Ecology is Good Economics’. We will continue to create value for all
our Stakeholders and emerge as a ‘Best-in-Class’ Bank that is committed to sustainable economic growth. We
will ensure that the Bank’s business grows consistently and responsibly, benefitting those we directly serve
while also promoting the well-being of our employees, our natural environment and the community at large.
Guiding Principles
We recognize our on-going commitment to engage with our Stakeholders to be a crucial and powerful tool
for the way we conduct business. We will pursue a process of continuous improvement of our CSR Policy
and Practices. Our vision is to be trusted, valued and respected for our financial, environmental and social
performance. We will be guided by the principles outlined in the National Voluntary Guidelines on Social,
Environmental and Economic Responsibilities of Business (NVGSEE) and the UN Global Compact as listed
below:
i. Strengthen our Governance Framework with ethics, transparency and accountability;
ii. Provide value to consumers through effective Stakeholder engagement;
iii. Promote gender equality, diversity and well-being of all employees;
iv. Respect the protection of internationally proclaimed human rights;
v. Engage with Government and Trade & Industry Associations on national and international platforms;
vi. Build inclusive, healthy and sustainable communities;
vii. Undertake initiatives to promote greater environmental responsibility; and
viii. Communicate our CSR objectives and goals to all internal and external Stakeholders.
The Bank’s CSR Projects, composition of the CSR Committee of the Board and other relevant details can be
viewed at the web link-
http://www.indusind.com/content/csr-home/our-approach/csr-policy.html
53
Focus Areas
2 The Composition of the CSR Committee.
1. Mrs. Kanchan Chitale (Chairperson)

2. Mr. Vijay Vaid
3. Mr. Romesh Sobti (Managing Director & CEO)
3 Average Net Profit of the Bank for last three financial years.
` 2,137.95 crores.
4 Prescribed CSR Expenditure (Two per cent of the amount as in item 3 above).
` 42.76 crores.
5 Details of CSR spent during the financial year:
a) Total amount to be spent for the financial year 2015-16 – ` 42.76 crores.
b) Amount unspent - ` 15.44 crores.
c) Manner in which the amount was spent during the financial year is detailed below:
54
Sl. CSR Project Sector in which Projects or Amount Amount Spent on Cumulative Amount
No. or activities the Project is Programs (1) Outlay the Projects or Expenditure Spent: Direct
identified covered Local area (Budget) Programs Sub - up to the or through
or other (2) Project or heads: (1) Direct reporting Implementing
Specify the Program- Expenditure period Agency
State and wise on Projects or (` in Lakhs)
District where (` in Lakhs) Programs (1)
Projects or Overheads (2) (3)
Programs were (4) (5)
undertaken (` in Lakhs)
1 2 3 4 5 6 7 8
1. IndusInd Rural Kolhapur 100 60 60 Through
Swachh Development & District- Implementing
Vidyalaya Inclusiveness, Maharashtra, Agencies:
Preventive Kushinagar, Society for
Healthcare Sarguja, Economic
Sonbhadra, Welfare &
Azamgarh Educational
and Chirakoot Development
districts - (SEED), Cashpor
Eastern Uttar Micro Credit
Pradesh
2. Legal Literacy Rural Bhopal and 330 38 38 Through
Programme for Development & Sagar districts, Implementing
Women Inclusiveness Madhya Agency:
Pradesh Samhita
Development
Network
3. Rehabilitation of Preventive Saphale, 240 48 48 Through
street children Healthcare & Maharashtra Implementing
addicted to imparting of Agency:
drugs Vocational Skills Society
Undertaking
Poor People’s
Onus for
Rehabilitation
(SUPPORT)
4. Pradhan Mantri Rural Pan-India 10 98 98 Direct
Jan Dhan Development &
Yojana Inclusiveness
5. IndusInd Bank Education Pan-India 500 50 50 Through
-Young India Implementing
Fellowships Agency:
Ashoka
University
6. Army Welfare Welfare of Armed Kumaon, 16 16 16 Through
for Kumaon Forces Uttarakhand Implementing
Regiment UN Agency:
Mission Krishnan
International
7. Empowerment Supporting of Pan-India 11 11 11 Through
of the Differently Differently Abled Implementing
Abled Agency:
Rajiv Gandhi
Foundation
55
8. IndusInd Paralympic Pan-India 400 51 51 Through
Umang - Para Sports Implementing
Champions Agency;
Programme Go Sports
Foundation
9. Internal Capacity Building Mumbai, 45 44 44 Direct
Capacity Maharashtra
Building
Green Environmental Direct
Champions Sustainability
10. Pan-India 50 7 7
Programme and and Awareness
Initiatives Creation
11. Developing the Awareness and Mumbai, 2 2 2 Direct
Bank’s Hum Capacity Building Maharashtra
Aur Hariyali
Microsite
12. Nature Environmental Amravati, 6 5 5 Through
Conservation Sustainability Maharashtra Implementing
and Nature Agency:
Conservation Satpuda
Foundation
13. Environmental Environmental Mumbai, 2 2 2 Through
Awareness Sustainability Maharashtra Implementing
through Walk on and Nature Agency:
the wild side Conservation Centre for
Environmental
Research &
Education
14. Solar Environmental Pan-India 130 93 93 Direct
installation/ Sustainability
operations on
ATMs.
15. Green Building Environmental Mumbai, 750 698 698 Direct
(LEED Sustainability Maharashtra
Certification)
16. Environmental Environmental Pan-India 1,500 1,431 1,431 Direct
Conservation Sustainability
with a clear
roadmap on
adopting Green
IT practices and
technology.
56
17. Energy Environmental Pan-India 9 8 8 Direct
conservation Sustainability
through
installation
of timers in
signage, Pan-
India
18. Environmental Environmental Pan-India 15 3 3 Direct
Stewardship Sustainability
19. Contribution to Promoting Culture Pan-India 60 67 67 Direct
various Social and Education
Causes
Total 4,176 2,732 2,732
6. In case the company has failed to spend two per cent of the average Net Profit of the last three financial years
or any part thereof, the reasons for not spending the amount in its Board report.
The Bank’s CSR Projects are planned and executed in a phased manner. The Bank has spent ` 27.32 crores
out of the approved budget of ` 41.76 crores, i.e., 65.42% of the outlay. As the Bank adds on new Projects and
scales up on the existing ones, there will be better absorption of the CSR Spend.
7. A Responsibility Statement of the CSR Committee that the implementation and monitoring of CSR Policy is in
compliance with CSR objectives and Policy of the company.
This note describes the CSR Policy, focus areas and Projects that the Bank has undertaken during the financial
year 2015-2016. I hereby acknowledge that this is in compliance with the Bank’s CSR Policy and Objectives.
Romesh Sobti Kanchan Chitale

Managing Director Chairperson – CSR Committee
Mumbai, May 12, 2016
57
ANNEXURE VII TO THE DIRECTORS’ REPORT
BUSINESS RESPONSIBILITY REPORT

(AS PER SEBI CIRCULAR CIR/CFD/CMD/10/2015 OF NOVEMBER 4, 2015)
SECTION A: GENERAL INFORMATION ABOUT THE COMPANY

1. Corporate Identity Number (CIN) of the Company L65191PN1994PLC076333
2. Name of the Company IndusInd Bank Limited
3. Registered Address 2401, General Thimmayya Road, (Cantonment),
Pune – 411 001.
4. Website www.indusind.com
5. E-mail id [email protected]
6. Financial Year reported April 01, 2015 – March 31, 2016
7. Sector(s) that the Company is engaged in (Industrial Division 64 – Code 64191
activity code-wise) IndusInd Bank Limited is a Company governed by
the Banking Regulation Act, 1949.
8. List three key Products / Services that the Company - Banking and para-Banking services, including
manufactures / provides (as in Balance Sheet) accepting of Deposits such as Savings
Accounts, Current Accounts, Fixed Deposits,
and including Banking solutions to large Indian
and multinational corporates.
- Granting of Loans to various segments,
including Industries, Business and Retail
Loans.
- Financing wide range of Vehicles / equipment
to individuals and Priority Sector Lending.
9. Total number of locations where business activity is 1,000 Branches across India, Corporate Office,
undertaken by the Company. Regional Offices and Back Offices.
i. Number of International Locations (Provide Representative Offices in
details of major 5) - Dubai
- Abu Dhabi
- London.
ii. Number of National Locations 1,000 branches across India, Corporate Office and
Back Offices.
10. Markets served by the Company – Local / State / All
National / International
SECTION B: FINANCIAL DETAILS OF THE COMPANY
1. Paid-up Capital (INR) - ` 594.99 crores
2. Total Turnover (INR) - ` 14,877.61 crores
3. Total Profit After Taxes (INR) - ` 2,286.45 crores
4. Total Spending on Corporate Social Responsibility The Bank has spent ` 27.32 crores on various social
(CSR) as percentage of Profit After Tax (%). and environmental activities, in the areas of Rural
Development and Inclusiveness, Environmental
Sustainability, Preventive Healthcare, Education and
Paralympic Sports during the year 2015-16, which is
1.19 % of Average Net Profit of the last three financial
years ended March 31, 2013, March 31, 2014 and
March 31, 2015, towards CSR activities.
58
Preventive Healthcare:
,Q )< WKH %DQN FRQVWUXFWHG
refurbished sanitation facilities in Kolhapur and
districts of Eastern Uttar Pradesh that impacted
close to 5,000 children.
,Q&ROODERUDWLRQZLWK6833257WKH%DQNKHOSV
in the rehabilitation and skill development of
drug-addicted rehabilitated street children
in Mumbai, making them employable and
independent through Vocational Skill-building
programmes.
Rural Development:
,QSDUWQHUVKLSZLWKRXU%XVLQHVV&RUUHVSRQGHQW
the Bank is currently carrying out a Legal
literacy programme for marginalized women in
Bhopal and Sagar districts of Madhya Pradesh.
In FY 2015-16, 6,300 women were trained. The
Bank is currently in the second year of the
project.
7KURXJKWKH,QFOXVLYH%DQNLQJ*URXSDQGRXU
team of Business Correspondents, the Bank
has reached out to marginalized communities
in rural India by providing them with micro-
loans, empowering them for, changing their
lives and raising them above the Poverty Line.
7KH%DQNKDVEHHQLQVWUXPHQWDOLQSURSDJDWLQJ
financial literacy through the Pradhan Mantri
Jan Dhan Yojana by conducting literacy camps
and awareness campaigns for customers.
7KURXJK WKH ,QFOXVLYH %DQNLQJ *URXS WKH
Bank reached out to the Base-of-Pyramid
(BOP) segment, specifically to women. The
loans that the Bank provides, along with other
financial services, have empowered women
and considerably improved their standard of
living.
Education and Other areas:
7KH %DQN VXSSRUWV GHVHUYLQJ PHULWRULRXV
students of Ashoka University through the
Young India Fellowship Programme, renowned
for introducing several young entrepreneurs in
the social sector.
,Q )< WKH %DQN VXSSRUWHG WKH ¶3DUD
Champions Programme’ in association with
Go-Sports Foundation, a programme involving
selection and training of 15 Para Champions
pan-India, representing at the Paralympics.
59
5. List of activities in which expenditure in 4 above has Activities include:
been incurred:- a. Energy conservation
b. Renewable Energy
c. Environment
d. Rural Development
e. Preventive Healthcare and Social Causes
f. Education
g. Paralympic Sports
SECTION C: OTHER DETAILS
1. Does the Company have any Subsidiary Company / ALF Insurance Services Private Limited (ALFIS) is a
Companies? wholly owned subsidiary of the Bank. The Company
is currently under the process of winding up.
2. Do the Subsidiary Company / Companies participate Not applicable, since the subsidiary is under winding
in the BR Initiatives of the parent company? If yes, then up.
indicate the number of such subsidiary company(s).
3. Do any other entity / entities (e.g. suppliers, distributors No
etc.) that the Company does business with, participate
in the BR initiatives of the Company? If yes, then
indicate the percentage of such entity / entities? [Less
than 30%, 30-60%, More than 60%].
SECTION D: BR INFORMATION
1. Details of Director / Directors responsible for BR
a) Details of the Director / Directors responsible for
implementation of the BR Policy / Policies.
DIN Number 00031034
Name Mr. Romesh Sobti
Designation Managing Director & CEO
b) Details of the BR head:
DIN Number (if applicable) Not Applicable
Name Mr. Adwait Hebbar
Designation Head - Corporate Services
Telephone number +91 22 6106 9280
e-mail id [email protected]
60
2. Principle-wise (as per NVGs) BR Policy / Policies
a. Details of Compliance (Reply in Y/N)
Sl. Questions Business Product Well- Stake- Human Environ- Public Inclusive Customer
No. Ethics Responsi- being holder Rights ment Policy Growth
bility of Relations
engage- and
employment Equitable
ees Develop-
ment
P1 P2 P3 P4 P5 P6 P7 P8 P9
1. Do you have a Policy / Policies Y Y Y Y Y Y Y Y Y
for....
2. Has the Policy being formulated Y Y Y Y Y Y Y Y Y
in consultation with the relevant
stakeholders?
3. Does the Policy conform to Y Y Y Y Y Y Y Y Y
any national / international The Policies are in line with Reserve Bank of India, Ministry of Corporate Affairs (MCA) guidelines and
standards? If yes, specify? (50 other regulations / guidelines as applicable.
words)
4. Has the policy being approved Y Y Y Y Y Y Y Y Y
by the Board?
Is yes, has it been signed by
MD / owner / CEO / appropriate
Board Director?
5. Does the company have a Y Y Y Y Y Y Y Y Y
specified committee of the Board
/ Director / Official to oversee the
implementation of the policy?
6. Indicate the link for the policy to Policies are hosted on the Bank’s Intranet and those related to P7 & P9 above, are hosted on the Bank’s
be viewed online? website.
http://www.indusind.com/content/csr-home/our-approach/csr-policy.html
http://www.indusind.com/content/home/footer/customer-care/grievance-redressal.html
7.
Has the policy been formally Y - Y Y Y Y Y - Y
communicated to all
relevant internal and external
stakeholders?
8. Does the company have in- Y Y Y Y Y Y Y Y Y
house structure to implement
the Policy / Policies?
9. Does the Company have a Y - Y - Y - - - Y
Grievance Redressal Mechanism
related to the Policy / Policies
to address Stakeholders’
grievances related to the Policy
/ Policies?
10. Has the company carried out Y Y Y Y Y - Y N Y
Independent Audit / Evaluation
of the working of this Policy by
an internal or external Agency?
61
b. If answer to Sr. No. 1 against any principle, is ‘No’, please explain why: (Tick upto 2 options)
Sl. Questions P1 P2 P3 P4 P5 P6 P7 P8 P9
No.
1 The company has - - - - - - - - -
not understood the
Principles
2 The company is not at a - - - - - - - - -
stage where it finds itself
in a position to formulate
and implement the
policies on specified
principles
3 The company does - - - - - - - - -
not have financial or
manpower resources
available for the task
4 It is planned to be done - - - - - - - - -
within next 6 months
5 It is planned to be done - - - - - - - - -
within the next 1 year
6 Any other reason (please - - - - - - - - -
specify)
3. Governance related to BR
Indicate the frequency with Annually.

which the Board of Directors,
Committee of the Board or CEO
to assess the BR performance of
the Company. Within 3 months,
3-6 months, Annually, More than
1 year
Does the Company publish a The Bank publishes the BR Report annually.
BR or a Sustainability Report?
The hyperlinks to view the report are:
What is the hyperlink for viewing
this report? How frequently it is
http://www.indusind.com/content/csr-home.html
published? http://www.indusind.com/investor/reports-and-presentation/annual-
reports.html
Section E: Principle-wise performance

Principle 1
1. Does the Policy relating to Ethics, Bribery and Corruption cover only the company? Yes / No. Does it
extend to the Group / Joint Ventures / Suppliers / Contractors / NGOs / Others?
Policy relating to Ethics, Bribery and Corruption covers the Bank, the Suppliers / Contractors / Others, and is
embedded in the Bank’s Human Resources Policy, Code of Conduct and Discipline, Employee Service Rules
as well as Outsourcing Agreements with the vendors and contractors. The Bank strictly ensures that none of its
business processes or its vendors and suppliers support child, forced or compulsory labour. Most of the Bank’s
requirements are sourced from corporates, generally where highly skilled labour is employed.
62
2. How many Stakeholders complaints have been received in the past financial year and what percentage
was satisfactorily resolved by the management? If so, provide details thereof, in about 50 words or so.
No complaints were received with respect to Ethics, Bribery and Corruption from any of the stakeholders.
Principle 2
1. List up to 3 of your products or services whose design has incorporated social or environmental concerns,
risks and / or opportunities.
Investment in Renewable Energy & Priority Sector Lending
Priority Sector Lending includes Bank’s initiatives in Agricultural Business Finance and Inclusive Banking that
support the economic development of the rural sector. The Bank’s Project Finance Group encourages renewable
energy projects, specifically wind and solar energy.
Microfinance
The Bank provides micro loans to weaker sections of the society through the ‘Business Correspondent Model’
involving micro-finance institutions that are geographically diversified across the country. These loans have
helped support Micro-Enterprises such as Saree trading, Snack stores, Tea stalls and Bicycle repair shops.
Micro-loans accompanied by provision of additional financial services have empowered women to improve
their standard of living. The Bank has introduced Micro RD product this year to help inculcate and promote the
savings habit for this clientele and expanding to all partners and locations. The minimum amount is as low as
` 50/- to encourage customers to start saving.
2. For each such product, provide the following details in respect of resource use (energy, water, raw
material etc.) per unit of product (optional):
i. Reduction during sourcing / production / distribution achieved since the previous year throughout the
value chain?
Not Applicable.
ii. Reduction during usage by consumers (energy, water) has been achieved since the previous year?
Not Applicable
3. Does the company have procedures in place for sustainable sourcing (including transportation)?
The Bank’s Procurement Policy guides sourcing, whereby preference is given to suppliers that have local
presence, raw material sourcing and have a Supplier Code of Conduct.
i. If yes, what percentage of your inputs was sourced sustainably? Also, provide details thereof, in about 50
words or so.
Supplier sustainability assessment of the large spend suppliers is completed. The IT and equipment vendors
were assessed on their environment, carbon and resource management practices. It was found that over 75%
of responding suppliers measure their carbon footprint, of which 50% have set emission reduction targets.
Over 80% of responding suppliers have obtained Third-Party Certification for products, such as Energy Star
Certification.
4. Has the company taken any steps to procure goods and services from local & small producers, including
communities surrounding their place of work?
If yes, what steps have been taken to improve their capacity and capability of local and small vendors?
Not Applicable.
63
5. Does the company have a mechanism to recycle products and waste? If yes, what is the percentage of
recycling of products and waste (separately as <5%, 5-10%, >10%) Also, provide details thereof, in about
50 words or so.
The Bank is committed to dispose of electronic and toxic waste through authorized e-waste vendors. In 2015-
16, the Bank has recycled about 36,650 kgs. of e-waste. In a continued effort to recycle waste paper, the Bank
has tied up with ITC Ltd through their Wealth-out-of-Waste (WOW). Waste Paper Collection Arrangement and a
couple of other partners pan-India. Through this initiative, the Bank has recycled close to 6,023 kgs. of papers.
Principle 3
1. Please indicate the Total number of employees.
The Bank had 23,060 (including permanent employees as well as contractual and interns) employees as at
March 31, 2016.
2. Please indicate the total number of employees hired on temporary / contractual / casual basis.
The Bank had 2,335 employees at March 31, 2016 hired on temporary / contractual / casual basis.
3. Please indicate the Number of permanent women employees.
The Bank had 4,002 permanent women employees at March 31, 2016.
4. Please indicate the Number of permanent employees with disabilities.
The Bank had 7 permanent employees with disabilities.
The Bank evaluates and addresses the special infrastructure needs of differently - abled employees and
facilitates their seamless integration into the system. For the visually impaired employees, the Bank has procured
special software which converts text into voice for the employee to understand and respond. Likewise, in the
case of hearing-impaired employees, the Bank provides training in “sign-language” to their reporting managers
and colleagues, which help ease communication. Fellow colleagues are sensitized regarding their needs and
requirements as well.
5. Do you have an employee association that is recognized by management?
The Bank does not have any Association of Employees.
6. What percentage of your permanent employees is members of this recognized employee association?
Not Applicable.
7. Please indicate the Number of complaints relating to child labour, forced labour, involuntary labour,
sexual harassment in the last financial year and pending, as on the end of the financial year.
Sl. Category No of complaints filed No of complaints pending as

No. during the financial year on end of the financial year
1 Child labour/ forced labour/ Nil Nil
involuntary labour
2 Sexual harassment 20 Nil
3 Discriminatory employment Nil Nil
The Bank’s Policy on Sexual Harassment encourages women employees to notify any anxiety arising out of
gender differences, which is then escalated for quick investigation and the case is considered by a Committee
of Experts comprising female social workers and senior female Executives.
The Bank had organized exhaustive workshops for some of the employees on sexual harassment, who in turn
percolated these learnings to other women employees.
64
8. What percentage of your undermentioned employees were given safety & skill up-gradation training in
the last year?
3HUPDQHQW(PSOR\HHV
3HUPDQHQW:RPHQ(PSOR\HHV
&DVXDO7HPSRUDU\&RQWUDFWXDO(PSOR\HHV
(PSOR\HHVZLWK'LVDELOLWLHV
Employee Training on Fire Safety
The Bank’s Workplace Health and Safety Policy lays down safety measures, escalation mechanisms and ways to
handle emergency situations to ensure a safe work environment. The Bank has an e-learning module on Workplace
Safety with the aim of creating awareness on various potential hazards and accidents at the workplace. In FY 2015-16,
the Bank conducted Fire-Safety Training Sessions for about 8,200 employees through 558 sessions, achieving 16,400
man-hours. The sessions comprised Evacuation Drill sessions and Fire Safety Training.
Training on Women Safety
Training sessions on Women Safety were conducted for women employees during which they were trained on various
self-defense techniques using common implements and accessories for protection and were sensitized on common
safety issues / incidents that could affect them. In FY 15-16, 820 women employees have been trained through 28
such sessions achieving 3,280 man-hours.
Skill Upgradation Training
Total Employee No. of Total no. of Total Man hrs. Average Man hrs. Average Man
Strength programs participants achieved per participant days achieved
23,060 1,374 1,32,571 7,14,209 32 4
Principle 4
1. Has the Company mapped its internal and external stakeholders? Yes / No
Yes, The Bank has mapped its internal and external stakeholders and has clear engagement processes with
them. Description of the processes has been provided in the Sustainability Report.
2. Out of the above, has the company identified the disadvantaged, vulnerable & marginalized
stakeholders.
Reserve Bank of India has prescribed guidelines on Financial Inclusion, Priority Sector Lending, lending to
Weaker Sections, etc., which direct the Bank’s assistance to the disadvantaged, vulnerable and marginalised
stakeholders.
3. Are there any special initiatives taken by the company to engage with the disadvantaged, vulnerable and
marginalized stakeholders? If so, provide details thereof, in about 50 words or so.
The Bank took up the responsibility of providing financial services to the most remote and marginalized
communities. The Inclusive Banking Group adopts a collaborative approach by partnering with suitable
intermediaries / institutions for offering the Financial Inclusion (FI) products and services in a phased manner,
with requisite risk management systems and controls. The program was initiated with micro-credit (less than
` 50,000) and has been expanded to basic savings accounts. 100% of the target segment is women. The
business model involves thorough interaction with the members’ households, including visits to their houses
and business places to assess the level of economic activity. The lending methodology involves forming Joint
Liability Groups, through which the members are closely aligned with each other and share each other’s
responsibilities. These groups enhance the member-connect with each other, share their issues / concerns, etc.
for collective addressing. The program has an embedded component of financial literacy which educates the
members on various components of financial services being offered. The member interaction keeps happening
as frequently as a week to a month.
65
Internally, the Bank focuses on providing special infrastructure needs for differently-abled employees and
facilitates their seamless integration into the system. The Bank has been conducting Women’s Safety Awareness
Training Sessions for its women employees.
As a part of a Community Development Initiative, in partnership with a Business Correspondent, the Bank
conducts a legal literacy programme for marginalized women in Madhya Pradesh, educating them on legal
awareness, domestic violence and gender discrimination. As part of the social initiatives, the Bank supports the
rehabilitation and vocational skill building of street children and young adults addicted to drugs, in partnership
with SUPPORT.
Principle 5
1. Does the policy of the company on human rights cover only the company or extend to the Group / Joint
Ventures / Suppliers / Contractors / NGOs / Others?
The Policy on Human Rights covers only the Bank.
2. How many Stakeholders’ complaints have been received in the past financial year and what percent was
satisfactorily resolved by the management?
The Bank has not received any complaints pertaining to human rights during the financial year.
Principle 6
1. Does the policy related to Principle 6 cover only the company or extends to the Group / Joint Ventures /
Suppliers / Contractors / NGOs / others.
While the policy related to Principle 6 is applied across the Bank, the Bank’s endeavor is to empanel the vendors
who follow best environment practices. The Bank is working towards a Sustainable Value Chain and has initiated
sustainability assessments with vendors and suppliers.
2. Does the company have strategies / initiatives to address global environmental issues such as climate
change, global warming, etc? Y/N. If yes, please give hyperlink for webpage etc.
The Bank recognizes that climate change and global warming will impact businesses in the long term. The Bank
has taken action and is monitoring and managing its direct and indirect emissions. The Bank has developed
and implemented strategies to reduce energy consumption and invests in renewable technologies. The Bank is
governed by an Environment Policy and environment disclosures are reported in the Sustainability Report.
The Bank’s Sustainability Report is available at the link: http://www.indusind.com/content/csr-home/
sustainability-report.html
3. Does the Company identify and assess potential environmental risks? Yes / No
Not Applicable
4. Does the company have any project related to Clean Development Mechanism? If so, provide details
thereof, in about 50 words or so. Also, if Yes, whether any environmental Compliance Report is filed?
Not Applicable
5. Has the company undertaken any other initiatives on – clean technology, energy efficiency, renewable
energy, etc. Y/N. If yes, please give hyperlink for web page etc.
The Bank’s Sustainability Report is available at the link: http://www.indusind.com/content/csr-home/sustainability-
report.html
Paper Consumption and Recycling:
The Bank’s strategies to reduce paper consumption at the Bank include the use of recycled paper products,
66
bagasse-based products etc. The Bank enables its customers to make choices that reduce paper consumption
downstream of its own operations by actively enlisting and incentivizing e-statement registrations and offering
several other e-facilities like on-line and mobile banking.
In a continued effort to recycle waste paper, the Bank has channelized 6,023 kgs. of A4 size paper for recycling.
E-waste:
The Bank has recycled 36,650 kgs. of e-Waste through Government authorized recyclers.
Energy Conservation and Efficiency:
Energy Reduction Electricity Saved* Emissions Reduced (in

Scale
Initiative Reduction (in MWh) MT of CO2)
222 thin clients pan-India 66.0 46
Solar energy generated at
Regional office 61.8 43
Karapakkam facility
Solar ATMs and Solar Powered Premises:
The Bank’s Solar-powered facility at Karapakkam generated 61.8 MWh of power and contributes to 8% of the total
energy demand of the facility. The Bank is in the process of rolling out 100 additional solar ATMs that will function
based on Grid-Tied Technology, where Grid power will be supplemented by Solar Energy, thus reducing the net power
drawn from the grid.
Renewable project Finance
The Bank has a Project Finance team, with focus on specific sectors like Wind, Solar, Roads, Port, Logistics and Power
transmission.
LEED Certified Premise
The Bank is in the process of setting up a LEED Platinum-certified office building in Mumbai with an area of 19,685 sq.
ft. The building design incorporates several sustainable and energy efficient features; use of efficient waste segregation
and management system, network of drip irrigation for landscaping, well defined rainwater harvesting system, using
solar energy to power the building, to name a few.
Carbon Disclosure Project
The Bank prepares an annual carbon inventory in accordance to ISO14064:2006 framework and obtained external
assurance for FY 15-16. The Bank was adjudged #1 in Financial Services Sector in India by CDP in 2015.
6. Are the Emissions / Waste generated by the company within the permissible limits given by CPCB /
SPCB for the financial year being reported?
Not Applicable.
7. Number of show cause / legal notices received from CPCB / SPCB which are pending (i.e. not resolved
to satisfaction) as on end of Financial Year
Not Applicable.
Principle 7
1. Is your company a member of any trade and chamber or association? If Yes, Name only those major ones
that your business deals with:
The Bank is a member of various trade bodies and associations, viz.,
a. Confederation of Indian Industry (CII)
b. Indian Merchants Chambers (IMC)
c. Bombay Chamber of Commerce & Industry (BCCI)
67
d. Indian Banks Association (IBA)
e. Indian Institute of Banking and Finance (IIBF)
f. International Chamber of Commerce (ICC)
2. Have you advocated / lobbied through above associations for the advancement or improvement of public
good? Yes/No; if yes specify the broad areas ( drop box: Governance and Administration, Economic
Reforms, Inclusive Development Policies, Energy security, Water, Food Security, Sustainable Business
Principles, Others)
No.
Principle 8
1. Does the company have specified programmes / initiatives / projects in pursuit of the policy related to
Principle 8? If yes details thereof.
In line with the Bank’s Mission Statement and focus areas as per our CSR Policy, the Bank has undertaken
several projects that critically impact communities and the environment around us.
Environmental Sustainability has always been the Bank’s major focus area and in the past year too, the Bank
has undertaken several internal and external environmental initiatives.
Environmental Sustainability
([WHUQDOHQYLURQPHQWSURMHFWVLQFOXGLQJQDWXUHFRQVHUYDWLRQDQGFRPPXQLW\GHYHORSPHQWLQLWLDWLYHVDW
Melghat and Pench tiger reserves, environmental education to school children through ‘Walk on the Wild
Side’, a book designed to re-connect children with urban biodiversity.
7KURXJKLWVLQWHUQDOHQYLURQPHQWLQLWLDWLYHVWKH%DQNHQVXUHVWKDWLWPLWLJDWHVWKHLPSDFWRILWVRSHUDWLRQV
its interventions include solarizing its ATMs and office premises, virtualizing servers, installing power
saving devices to conserve energy, recycling paper and e-waste. This year, the Bank is in the process of
setting up a LEED platinum rated office premise in Mumbai.
7KH %DQN EHOLHYHV LQ EXLOGLQJ FDSDFLWLHV RI LWV HPSOR\HHV WKURXJK WKH *UHHQ &KDPSLRQV DQG *UHHQ
Commandos Programmes that enable them to become sustainability leaders / champions not only at
their workplace but also in their own communities and societies. All of the Bank’s adopted sustainable
initiatives are spearheaded by the Green Champions pan-India who are ably supported by the army of
green commandos.
Preventive Healthcare:
'XULQJ WKH SUHYLRXV ILQDQFLDO \HDU WKH %DQN FRQVWUXFWHG UHIXUELVKHG VDQLWDWLRQ IDFLOLWLHV LQ .ROKDSXU
and districts of Eastern Uttar Pradesh that impacted close to 5,000 children. The Bank will maintain the
toilets for a year and then hand them over to the School Sanitation Management Committee comprising
teachers, PTA members and members from the Panchayat. The project creates awareness on health,
hygiene and good sanitation practices within the local community and schools.
,QDQRWKHURQJRLQJSURMHFWZLWK6833257WKH%DQNVXSSRUWVWKHUHKDELOLWDWLRQDQGVNLOOGHYHORSPHQWRI
drug-addicted street children in Mumbai, making them employable and independent through Vocational
Skill-building programmes.
Rural Development:
,Q SDUWQHUVKLS ZLWK LWV %XVLQHVV &RUUHVSRQGHQW 6DPKLWD WKH %DQN LV FXUUHQWO\ FDUU\LQJ RXW D /HJDO
literacy programme for marginalized women in Bhopal and Sagar districts of Madhya Pradesh. So far,
6,300 women have been trained. The Bank is in the second year of the project and aims to cover 65,000
women by the end of 4 years.
7KH%DQN·V,QFOXVLYH%DQNLQJFKDQQHODGRSWVFROODERUDWLYHDSSURDFKE\SDUWQHULQJZLWKVXLWDEOHLQWHUPHGLDULHV
institutions for offering the FI products and services in a phased manner, with strong risk management systems
68
and controls. The entire target segment are women. The program was initiated with micro-credit (less than
` 50K) and has now been expanded to basic savings accounts. The business model involves thorough
interaction with the member’s household, visit to their houses and business place to assess the level
of economic activity. The lending methodology involves forming joint liability group through which the
members are closely aligned with each other and share each other’s responsibilities. These groups
enhance the member connect with each other, share their issues/concerns etc. for collective addressing.
The program has an embedded component of financial literacy which educates the members on various
components of financial services being offered. The member interaction keeps happening as frequent as,
a week to a month. Through the Inclusive Banking Group and team of business correspondents, the Bank
reaches out to marginalized communities in rural India by providing them with micro-loans, empowering
them, changing their lives and raising them above the poverty line.
7KH%DQNKDVEHHQLQVWUXPHQWDOLQSURSDJDWLQJILQDQFLDOOLWHUDF\WKURXJKWKH3UDGKDQ0DQWUL-DQ'KDQ
Yojana by conducting literacy camps and awareness campaigns for customers.
Education and Other Areas:
7KH %DQN VXSSRUWV GHVHUYLQJ PHULWRULRXV VWXGHQWV RI $VKRND 8QLYHUVLW\ WKURXJK WKH <RXQJ ,QGLD
Fellowship Programme, renowned for introducing several young entrepreneurs in the social sector.
,Q )< WKH %DQN VXSSRUWHG WKH ¶3DUD &KDPSLRQV 3URJUDPPH· LQ DVVRFLDWLRQ ZLWK *R6SRUWV
Foundation, a programme involving selection and training of 15 Para Champions pan-India, representing
the country at the Paralympics.
7KH %DQN·V SD\UROO JLYLQJ VFKHPH ¶6KDUHFDUH· LV DQ LQLWLDWLYH ZKLFK DOORZV LWV HPSOR\HHV WR GRQDWH
to NGOs who work for social and environmental causes, leveraging their resources and expertise to
bring about positive change. In the past year, employees have raised funds for SUPPORT, Nalandaway
Foundation, Samarthanam, Aaranyak, HelpAge India and Prayas and their contributions have made a
huge difference in the areas of Education, Children, Empowerment of Women, Differently-abled, Nature
Conservation and Elderly Care.
2. Are the programmes / projects undertaken through in-house team / own foundation / external NGO /
government structures / any other organization?
The programmes / projects / initiatives are undertaken through in-house team, business correspondents,
NGOs, Implementation Agencies and Environmental Consultants.
3. Have you done any impact assessment of your initiative?
Yes, the Bank continuously monitors and assesses the impact of its initiatives to gauge the effectiveness of its
interventions.
The legal literacy programme in Madhya Pradesh has successfully educated women on physical abuse and
violence; pre and post tests conducted on the respondents proved that 83% of the women were now aware
of protection measures, women helpline number and the procedure to file a complaint in their police stations.
They could now openly talk about cases of domestic violence in their households and were completely aware
of methods to deal with domestic and sexual violence.
The Swachh Vidyalaya initiative impacted close to 5,000 children. Interactions with the children post the Bank’s
interventions revealed that the children are not only aware of good hygiene practices but have also influenced
their parents and community members regarding the importance of hygiene and good sanitation practices.
Each of the classes in the schools has a ‘Swachh Mantri’ who drives the agenda and motivates peers to follow
good practices.
4. What is your company’s direct contribution to community development projects- Amount in INR and the
details of the projects undertaken?
The Bank has spent ` 27.32 crores on various social and environmental activities during the year 2015-16, which
is 64% of the outlay as per the Companies Act 2013. The Bank values its community at large and supports
69
them through various financial and non-financial initiatives. The details of the Bank’s community development
initiatives have been highlighted in Point 1 of Principle 8.
Apart from the Bank’s community development initiatives, every year, the Bank reaches out to households from
the Base-of-the-Pyramid (BOP) segment through direct and indirect channels. During FY 15-16, the Bank has
reached out to around 2.3 million households from the Base of the Pyramid (BoP) Segment both through Direct
and Indirect Channels, spread across 26 States, 420 Districts. Out of the same, the Bank has Directly reached
out to 12,78,703 loans clients spread out in 11 States & 104 Districts covering more than 13,860 villages and 209
slums. Majority of the areas are from under banked districts and districts which rank low on the CRISIL Financial
Inclusion Index and moreover 100% of these loans were to Women organised in Joint Liability Groups (JLG);
various studies internationally have shown that such loans extended along with other financial services in a
responsible manner would help improve the quality of lives and help empower the women over a period of time.
It is the Bank’s endeavour to deepen the engagement with these clients to help them move out of poverty and
improve their standard of living and do it in a sustainable manner. In terms of socio-economic composition, 71%
of the population belonged to BC / SC and ST category, with SC / ST category constituting 36% by number and
amount. 100% of these loans were to Women organised in Joint Liability Groups and around 46% of the loan
are towards Agri and Agri allied with balance towards Micro Enterprises (Manufacturing, Trade and Service).
Activities covered under these include Vegetable Cultivation, Release of land Mortgaged with Money lenders,
Bore well digging, Pumpset, Land Development, Livestock loans – Buffalo, Cows, Sheep rearing, Kitchen poultry
units etc. On the Micro Enterprises activities i.e. Saree Trading, Fruits Business, Kirana stores, Snacks stores,
Road Side Dhabas, Cycle repair shops, Tea Stalls, Agarbathi making, Tailoring etc. In the process, the Bank has
touched more than 1,200 activities, thus touching virtually every aspect of clients at the BoP segment. Over 55%
of the loans are for amounts below ` 15,000.
5. Have you taken steps to ensure that this community development initiative is successfully adopted by the
community? Please explain in 50 words, or so.
As highlighted in point 3, the Bank continually assesses and monitors the impact of its initiatives. The communities
targeted are the Bank’s major stakeholders in community interventions, and the Bank ensures that the projects
undertaken have complete participation and support from the community to ensure that they are sustainable
and generate the necessary impact.
Principle 9
1. What percentage of customer complaints / consumer cases are pending as on the end of financial year.
1.78% customer complaints were pending at the end of financial year (FY 2015-16), which got resolved in April
2016.
2. Does the company display product information on the product label, over and above what is mandated
as per local laws? Yes / No / N.A. / Remarks (additional information).
Not Applicable.
3. Is there any case filed by any stakeholder against the company regarding unfair trade practices,
irresponsible advertising and/or anti-competitive behaviour during the last five years and pending as on
end of financial year? If so, provide details thereof, in about 50 words or so.
No.
4. Did your company carry out any consumer survey/ consumer satisfaction trends?
The Bank regularly carries out surveys to assess satisfaction levels and track performance on customer needs
and expectations.
In FY 2015-16, the Bank had conducted transactional E- Surveys month-on-month for customer touch points,
viz., – ATM, Contact Centre & Net banking.
70
ANNEXURE VIII TO THE DIRECTORS’ REPORT
CERTIFICATE ON COMPLIANCE OF CONDITIONS OF CORPORATE GOVERNANCE

To
The Members of IndusInd Bank Limited
We have examined the compliance of conditions of Corporate Governance by INDUSIND BANK LIMITED (“the Bank”)
for the year ended 31st March, 2016 as stipulated in Clause 49 of the Listing Agreement executed by the Bank with
the BSE Limited (‘BSE’) and the National Stock Exchange of India Limited (‘NSE’) for the period from April 1, 2015 to
November 30, 2015; and as stipulated in Chapter IV of the Securities and Exchange Board of India (Listing Obligations
and Disclosure Requirements) Regulations, 2015 (“LODR”) for the period from December 1, 2015 to March 31, 2016.
The compliance of conditions of Corporate Governance is the responsibility of the Management. Our examination was
limited to procedures and implementation thereof, adopted by the Bank for ensuring compliance with the conditions
of Corporate Governance. It is neither an audit nor an expression of opinion on the Financial Statements of the Bank.
In our opinion and to the best of our information and according to the explanations given to us, we certify that
the Bank has complied with the conditions of Corporate Governance as stipulated in the above mentioned Listing
Agreement / LODR.
We further state that such compliance is neither an assurance as to the future viability of the Bank nor the efficiency or
effectiveness with which the Management has conducted the affairs of the Bank.

Company Secretaries
S. N. Bhandari
Partner
FCS No.: 761; C.P. No.: 366
Place : Mumbai
Date : May 12, 2016
71
Management Discussion
& Analysis
Macroeconomic Scenario & CPI, which averaged around 4.9% in FY16 as

Banking Environment against 6.25% in FY15 on the back of a steep fall in
Commodity and Crude prices and better food
The financial year 2015-16 witnessed significant
supply management, despite the second straight
volatility in global markets with commodities
year of deficient rainfall. The CPI has been well
moving to historical low levels and the Chinese
within RBI’s projected range, providing room for
economy facing an unprecedented slowdown.
interest rate cuts and maintaining of an
Global macro growth has been fragile, despite
accommodative stance to aid growth. The IIP data
some momentum at the start of the year. The US
has been erratic throughout the year, and did not
Federal Reserve finally increased the Fed Funds
yield any definite trend in manufacturing, though
rate by 25 bps in its December 2015 Monetary
the Infrastructure Output Index showed a nascent
Policy, and maintained a dovish tone for future.
recovery. Indian Rupee moved lower to
The Commodities market saw huge selling
September 2013 levels of 68.12 against the US
pressure in fiscal 2016 due to oversupply worries
Dollar, due to continued strengthening of the US
and muted demand in China. Brent Crude price
Dollar and depreciation of the Yuan, though on
touched a 12-year low of $27.36 on the back of
relative basis it was one of the best performing
continued OPEC supply as well as expectation of
currencies in the Emerging market. As on March
increased production from Iran. However, prices
31, 2016, USD-INR was trading at 66.56. India’s
stabilised at around $40 levels on rumours of
forex reserves were at about $354bn, up from
planned production cuts by Russia and Saudi
$340bn last year.
Arabia. China’s economy grew at its slowest rate in
25 years, increasing pressure on Beijing to
The year started with RBI keeping the policy rates
address fears of a prolonged slowdown and ease
steady in its first bi-monthly policy on April 7, 2015
the jitters affecting global markets. The full-year
but maintained an accommodative stance for future
growth of 6.9% was only just short of Government
actions. The repo rate was, later in the year, reduced
expectations of 7%, but well below the growth rate
by 75 bps points to 6.75%, which was in addition to
of 7.3% in 2014. The European Central Bank cut
the cut of 50 bps done prior to March 2015.
interest rates in the Eurozone to zero, expanding
its Assets Purchase programme to €80bn a month,
RBI also undertook steps to tackle the growing NPA
and reduced a key deposit rate further into
problem in the banking system, with the banks being
negative territory to 0.4% as it sought to revive the
asked to make provisions for all the bad loans and
economy and fend off deflation. The Bank of
clean up the books by March 2017. Against this
Japan also surprised markets by adopting
backdrop, banks have managed productivity and
negative interest rates in January, more than a
efficiency levels through liquidity and resource
year and a half after the European Central Bank
mobilisation strategies that proactively factor in the
became the first major institution of its kind to
changing market conditions. The Debt Markets
venture below zero. By February 2016, more than
outperformed their Equity peers with the Ten-Year
$7 trillion of Government Bonds worldwide offered
benchmark yields moving lower owing to reduction
yields below zero.
in rates by RBI and the benign net Central
Government borrowing target for the next fiscal. GOI
India recorded a GDP growth of 7.5% which was
10-year yield closed at 7.46% as of March 2016, as
marginally lower than initial Government
against 8% as of April 2015.
projections. The positive news has been on the
072
00
Bank’s Performance
during 2015-2016
Business Performance
The salient features of the Bank’s operating performance during the year 2015-16 are summarized in the
table below:
(` in crores)
Particulars FY 2015-16 (Actual) FY 2014-15 (Actual) Y-o-Y (Growth)
Interest Earned 11,580.66 9,691.97 19.49%
Interest Expended 7,064.09 6,271.69 12.63%
Net Interest Income 4,516.57 3,420.28 32.05%
Non-Interest Income 3,296.95 2,548.00 29.39%
Revenue 7,813.52 5,968.28 30.92%
Payment to Employees 1,236.09 980.48 26.07%
Other Expenses 2,436.01 1,889.58 28.92%
Operating Expenses 3,672.10 2,870.06 27.95%
Operating Profit 4,297.94 3,225.07 33.27%

(before Depreciation and Provisions and Contingencies)
Operating Profit 4,141.42 3,098.22 33.67%
Provisions and Contingencies 672.16 389.05 72.77%
Profit Before Tax 3,469.26 2,709.17 28.06%
Provision for taxes 1,182.81 915.45 29.21%
Net Profit 2,286.45 1,793.72 27.47%
Though the operating environment was quite 33.27% to ` 4,297.94 crores, as compared to
challenging during most of the financial year, Net ` 3,225.07 crores in the previous year.
Profit, after considering all expenses and Provisions
and Contingencies, rose by 27.47% to ` 2,286.45 The Net Interest Income of the Bank improved
crores as against ` 1,793.72 crores in the previous robustly by 32.05% to ` 4,516.57 crores from
year. The Operating Profit (before Depreciation and `3,420.28 crores. Yield on Advances dropped by
Provisions and Contingencies) rose robustly by 88 bps to 12.24%, while the Cost of Deposits
073
00
showed a drop of 67 bps at 7.25%. Net Interest sector in particular, were under severe stress, the
Margin for the year improved well at 3.81% as asset quality at the Bank remained stable, with Net
compared to 3.65% achieved in the previous year, Non-Performing Assets (Net NPAs) at 0.36% as at
mainly due to the composition of the Asset Portfolio, March 31, 2016 as against 0.31% a year ago.
benign interest rate movements during the year, Provision Coverage Ratio (PCR) was maintained at
timely equity infusion in July - August 2015, and 59%, as compared to 63% in the previous year.
judicious mobilisation of funding resources through
deposits and borrowing, including overseas Return on Assets (ROA) was placed at 1.91% for the
borrowings and refinance from institutions. current year, as against 1.90% in the previous year.
Fee and Miscellaneous Income at ` 3,296.95 crores, During the year under review, the Bank allotted
as compared to ` 2,548.00 crores for the previous 5,12,18,640 equity shares of ` 10/- each at a price
year, showed strong growth of 29% y-o-y. Core Fee of ` 845.00 per share, aggregating ` 4,327.98
Income from revenue streams like Commission, crores through a Qualified Institutions Placement
Exchange, Fees on distribution of Third-Party (QIP). The Bank also made a Preferential Allotment
products and earnings from foreign exchange of 87,81,360 equity shares of ` 10/- each at a price
business, etc., rose to ` 2,809.59 crores as against of ` 857.20 per share to its Promoters,
` 2,230.79 crores, registering a growth of 25.95%. aggregating ` 752.74 crores. Further, the Bank
allotted 55,36,126 shares, pursuant to the exercise
The Bank expanded its branch network steadily to of Options under its Employees Stock Option
reach 1,000 branches, as against 801 branches at Scheme, 2007. Consequently, the Capital
the beginning of the year. Revenue per employee Adequacy Ratio (CRAR) of the Bank under Basel III
remained steady at ` 33.88 lakhs. Capital Regulation issued by RBI showed
significant improvement at 15.50% as at March 31,
Though the economy in general, and the corporate 2016 as against 12.09% as at March 31, 2015.
Business Performance Highlights
1HW3URÀWURVHE\ 27.47% to ` 2,286.45 cr
2SHUDWLQJ3URÀWURVHE\ 33.67% to ` 4,141.42 cr
Net Interest Income rose by 32.05% to ` 4,516.57 cr
Other Income rose by 29.39% to ` 3,296.95 cr
074
00
Consumer Banking
During 2015-16, the Bank's Consumer Banking The partnership emerged as one of the fastest
business showed healthy growth in revenue, on growing bancassurance relationships in the
the back of robust growth of 47% in overall assets. country, with coverage of over 19,000 lives and an
The Bank's strategy of driving growth in Savings aggregated Protection Cover of ` 3,000 crores
Bank deposits continued to show results, with 33% provided to clients in a short span of six months.
y-o-y growth driven by the segmented client
approach and a growing distribution network. The Business Banking Group achieved Assets
growth of 35% during the year.
The Bank has taken up Digitalizing of its
businesses as a key thrust area and has enabled Growth of assets continued to be a strong focus
most offerings across Payments, Lending, for the Consumer Bank, particularly from branch
Deposits and Third-Party Distribution products for distribution. A structural change was implemented
online sales and service. The Bank has tied up with to give the desired focus to scale up business from
most of the leading financial aggregators' portals branches. To further cater to business from large
for online acquisition of new-to-bank clients. segments, the concept of ‘BBG Strategic Clients’
Further, the Bank has tied up with leading was implemented, and from small segments, the
e-commerce and payment services providers to ‘Small Business Banking’ policy was launched.
offer payment solutions to its Retail, Business and
Institutional clients, including Government bodies. The ‘Loans Against Property’ (LAP) business
clocked another strong, consistent performance in
The Bank entered into a Corporate Agency the year, with 42% growth in the Loan Book, i.e.,
agreement with Tata AIA Life Insurance Company addition of ` 1,560 crores. To further expand the
Limited in the month of October 2015 to distribute business footprint while deepening engagement
their Life products across its branches and with existing customers, a separate Branch Team
channels. The partners have collaborated to has been set up last year. Its impact is evident from
provide a wide range of solutions to address the 50% q-o-q rise in LAP originations through the
Protection, Savings and Wealth creation needs of branch network. Home Loans distribution tie-up
the Bank’s customers. The Life Insurance with HDFC Limited remains one of the key Assets
business for the Bank saw a y-o-y growth of 80% products distributed through the branch network.
post the creation of the partnership. The
partnership has launched best-in-class products, The Business Loan product has created a healthy
technology, processes and training inputs to Assets Book, with about 3,000 clients on board,
ensure an excellent client experience. spread across the MSME segment.
Overall Assets Business Banking

grew by Assets grew by
Savings Book Loan Against

up by Property up by
47% 42%
33% 35%
075
00
Analytics-powered Client Gujarat and Madhya Pradesh. The portfolio has

Engagement and Campaign helped in growing exposure in ‘Priority Sector
Management Lending’ and ‘Weaker Sections Lending’.
The Bank is committed to building lasting and
valuable relationships with customers.
Innovations
Understanding the Clients’ financial needs and As an extension to the Bank’s ingrained theme of
offering them relevant products and services in a responsive innovation, multiple digital platforms
timely and seamless manner is critical to have been launched during the financial year.
achieving this. IndusMobile, the Bank’s Mobile Banking
application has been re-launched as a new and
The Bank is building a scalable cognitive platform improved App, which enables clients to do
towards this objective, by combining advanced banking transactions in a simple, fast and secure
analytical models with a state-of-the-art Campaign manner. The Banking App comes with smart
Management System. This will allow us to features like biometric verification, instant Money
understand and proactively serve our clients Transfers, quick and easy recharges of mobile or
across human and digital channels in a focused DTH, and is truly an invitation to the next
and scalable manner. We aim to leverage this generation for new-age banking.
capability to engage with our clients and build
lasting relationships by making attractive offers at Another launch in digital service is QuickPay, a
the right time, another vital step to fulfilling our Payments facility, which enables transfer of funds
promise of “Aapne Chaha Hamne Kiya”. from customers’ accounts to the beneficiary,
without even knowing the latter’s Bank Account
Kisan Credit Card (KCC) - Indus details. This 24X7 Digital payment service provides
Kisan Term Loans and Overdraft the Bank’s customers the convenience of instant
transfer of funds using the IMPS facility.
Retail Agri Business, which was launched during
the financial year, also witnessed sturdy growth
In synergy with enhanced usage of social media
through expansion into key markets. Since its
platforms by Indian consumers, the Bank has
launch, the Bank has built a highly diversified
launched ‘OnTheGo Social Banking’ which
portfolio, ranging from funding of traditional
enables customers to do banking transactions on
agricultural activities to high-tech farming /
Social Media platforms like Facebook and Twitter.
Agri-allied activities. The Bank penetrated into
SwiftPay, another innovative App-based service,
new rural / semi-urban locations in the States of
facilitates the Bank’s customers to pay their utility
Punjab, Haryana, Rajasthan, Maharashtra,
bills through an electronic platform.
The convenient way to pay your bills is here.
076
00
Distribution The Bank also expanded the ATM network to 1,800
ATMs, by opening 313 new ATMs. The Bank has
The Bank opened 199 branches during the year as
also partnered with White-Label ATM Operators to
part of its strategy of expanding its banking
set up co-branded ATMs.
network to different locations in the country, taking
the total branch count to 1,000.
200 additional branches are planned to be opened
during the year 2016-17 in select geographies.
The milestone Thousandth Branch was opened in
Kala Nagar, Mumbai, in March 2016.
across
BRANCHES ATMs
geographical locations
Credit Cards
The Bank’s Credit Cards business, acquired from sophisticated Payment solutions for Corporates to
Deutsche Bank in 2011, has scaled up and grown in meet some of their critical B2B payment
distribution and profitability while remaining focused requirements. The integrated MIS solutions have
on the quality of customer receivables. The business significantly simplified customers’ expense
has enhanced its online and digital presence. management systems.
The branch infrastructure is being effectively

leveraged towards new account bookings and
cross-sell initiatives. The business has also
leveraged its strong relationships with marketing
partners and service providers towards creating
strong customer-centric promotions while driving
the portfolio growth and customer spends -
enhancement agendas.
The Commercial Cards Business, which was

launched in the last quarter of FY15, has grown
and is adding significant value to the Bank’s
Corporate clients. The program provides
077
00
Customer receivables have grown 53%. The Credit actions, were undertaken during the year.
Bureau continues to be a key guide in Risk
underwriting, and astute use of the Bureau data The Bank has tie-ups with all the three leading
along with strong analytics as a tool, has ensured network partners, Master Card, Visa and Amex.
that the portfolio continues to perform well. Attractive EMI programs facilitating customer
Multiple portfolio actions, including Credit Line convenience are offered.
Consumer Finance
The Consumer Finance Division (CFD) extends while maintaining portfolio quality, despite the
funding for a wide range of Vehicles and industry slowdown. Used Vehicles loans
Equipment, including Commercial Vehicles, viz., disbursed grew 26% to ` 3,499 crores.
Heavy, Light and Small vehicles used both for
goods and passenger applications, Passenger In the new vehicles segment, loans for commercial
Cars, Utility Vehicles, Two-wheelers and vehicles registered growth of over 50% to ` 6,924
Construction Equipment such as, Excavators, crores, higher than the industry rise. Loans for
Loaders, Tippers, Cranes, etc. Finance is Two-wheelers grew by 5%, disbursements for cars
extended for both new and used assets in all the 20% and Tractor loans disbursements rose
grew 20%,
above segments. Tractor funding, a major 250% to touch ` 857 crores, up sharply from
initiative towards Priority Sector Lending and ` 245 crores during 2014-15.
Financial Inclusion, was launched pan-India.
The Division also earned Commission Income of
The latter part of the year 2015-16 witnessed ` 30.74 crores through distribution of various
revival in the automobile segment, after two Third-Party insurance products of Cholamandalam
successive years of slowdown, registering growth MS General Insurance, strategic partner of the
of 3.78%. Commercial Vehicles segment recorded Bank for bancassurance in the General
robust growth of 29.91% [Previous Year: (-) Insurance segment.
2.83%], but the sale of LCV segment continued to
be stagnant. Three-wheelers, stagnant until the The operations of this Division are efficiently
third quarter of 2015-16, recorded growth of 1% in supported by the Document Storage and Retrieval
the last quarter. Two-wheelers grew by a mere Facility at the Bank’s Karapakkam Unit (near
3.01% in 2015-16 (Source - SIAM data). Chennai), which handles processing of Loan
Documents and maintenance of records. This Unit
Aggregate disbursements made during the handled nearly 2 million Loan bookings and
year rose about 31% to ` 20,369 crores. New closure transactions and 26 million customer
loan accounts, numbering 10.30 lakhs, were service / accounting transactions during the year
onboarded, as against 9.78 lakh loans in 2015-16. The facility is equipped with
2014-15. The focus during the year was on state-of-the-art devices in terms of data /
optimizing the product mix to maximize yields, equipment protection mechanisms, and access
078
00
rights with sensors to facilitate monitoring of During the year, Tab-based application for
document movement within the Centre. Two-wheeler loans sourcing was launched to
improve Turn-Around-Time (TAT) in the credit
The Bank has a Data Centre within the Airtel Data delivery process. Hand-Held Terminals have been
Centre facility, with a backup at the Bank’s G. N. deployed pan-India to handle CFD’s collection
Chetty Road premises, as part of Business activity. These initiatives have significantly
Continuity Planning. enhanced process efficiencies.
Corporate and Commercial

Banking Group
Corporate Banking products, foreign exchange products and

Investment Banking activities.
The Corporate & Investment Banking Team provides
Universal Banking Solutions to several large Indian t A special focus group to serve the MNC client
and multinational corporates. Over the years, this requirements has been initiated, which has brought
Unit has become a banker to almost all the large in significant number of new-to-bank clients.
corporate houses and large market cap companies,
and actively participates in their short-term and t Over the years, the group has built a quality portfolio
longer-term financing requirements. by minimizing exposure to high risk industries.
t The Unit has maintained a strong reputation as a The Unit’s business grew well during the year in
provider of innovative solutions to complex funding both, Assets and Liabilities. Focus on cross-sell
requirements, with quick turnaround times. increased the fees from Trade and Forex, along
Structured solutions in the Trade Finance and with growth in CASA and Term Deposits.
Foreign Exchange hedging have been developed
by the group to suite specific client needs. Investment Banking (IB)
t This Unit has increased penetration in the top t Debt Capital Markets (DCM), Advisory (M&A
corporate groups through a variety of funded and Private Equity) and Structured & Project
and non-funded transactions including trade Finance are the three main businesses of
079
00
Investment Banking group. The group enables across the globe, which helped in scaling up of
the Bank to partner with growth oriented the Trade and Treasury businesses of the Bank
corporates throughout their life cycles. and ensured seamless execution of
cross-border deals.
t The Bank helps corporates raise funds through
innovative structures that meet varied needs.
t The Group has also successfully raised foreign
Strong origination and structuring skills of IB
currency resources from key correspondents
Group have helped the Bank to strengthen
which helped support the lending book in
relationships with top business houses as a
trusted Investment Bank. Foreign Currency, thus augmenting the Bank’s
liquidity and facilitating reduction in costs.
t During the year, the Bank successfully
underwrote and sold down loans to various Financial Services Group
investors and secured for itself an enviable
position amongst Private Sector banks in the t Financial Services Group was launched to
Loan Underwriting League Tables. handle the relationship of Financial Services
players in India, i.e., NBFCs, Insurance
t With strong domain expertise in Wind, Companies, Mutual Funds and other Financial
Solar, Roads, Ports, Logistics and Power
Institutions in Public and Private Sector.
Transmission sectors, the Project Finance
team was able to win Project Underwriting
and Syndication mandates from several
t The Group has achieved significant success by
large corporates. winning Escrow / CMS mandates from renowned
names in the industry and established trade
t The ‘Real Estate Group’ was launched during partnerships with NBFCs and FIs.
the year to meet client needs in Commercial
and Residential real estate space. The Group Capital & Commodities Markets Division
has developed strong relationships with leading
players in all major markets. t The Capital and Commodity Markets Division
focuses on serving Capital and Commodity
Public Sector Group Exchanges and their Members.
t The Group handles relationships with more
than 150 Public Sector clients, including t The Bank currently has membership with all
Maharatnas and Navratnas. Stock and Commodity Exchanges in the
country and is a Clearing-cum-Settlement
t The Group was successful in winning large
Banker to both NSE and BSE in the Capital and
collection mandates in issues of Tax-Free
Futures Market segments.
Bonds of many Public Sector Units (PSUs). The
Group successfully executed several
E-Procurement mandates from key PSUs, by Commercial Banking Group
providing reliable technology-based solutions.
Set up with a view to target the ‘sweet spot’ of the
Financial Institutions Group Indian corporate space, the Commercial Banking
t Financial Institutions Group manages Group focuses on companies in the fast growing
relationships with domestic and international mid-Market segment. The Bank’s initiatives in
banks and Financial Institutions. The Group has Supply Chain Finance (SCF), Agri Business
intensified its geographical coverage and Finance (ABF) and Inclusive Banking are also
expanded its network of correspondent banks housed within this business unit.
080
00
The broad business theme of the Group is centred by others in the Industry. The Program is now
on the following: geographically well-diversified and currently
spread to 104 Districts across 11 States, with a
t Offering a full bouquet of customized products
network of 478 MFI branches.
to clients, for their working capital and Term /
Structured Finance requirements;
t This Group actively works with more than
23,27,000 clients, out of which 18,50,000 clients
t Increasing the client-base to broadbase the have been reached directly, and the remaining,
earnings stream of the Bank; about 4,77,000 clients, through indirect
channels. All of them are women and are
t Increase cross-sell through alignment of provided micro loans for productive purposes.
Relationship Managers and the Product
Groups, i.e., the Transaction Banking, Global t The Group proposes to deepen the
Markets and Investment Banking; engagement this year by building a sustainable,
scalable and profitable business through a
t Offering structured solutions through bouquet of financial products and services to
Transactional and Investment Banking products the credit-worthy unbanked low-income rural,
to clients for specific needs; and semi urban and urban households.
t Meeting the stipulated PSL requirements t The range of financial services envisaged are as
through its Inclusive Business Group and Agri under:
Business Group initiatives.
Basic Banking Services –
The highlights of the year are: Savings, Remittance.
t Focus had been on building a sustainable Full range of Credit products to the
working capital client portfolio and the year enterprising clientele at the base of the
saw further strengthening of this position. pyramid - Micro Credit, Affordable
The Group’s lending business crossed Housing, MSME and Agri Business (Dairy,
` 16,180 crores; Seed, Equipment).
t The Group has been widening its client base for Agri Business Group (ABG)
higher growth and greater diversification of risk; The Group offers products such as Pledge
Finance, Agri Promoter finance, and Agri
t The Group successfully concluded Infrastructure finance. Its presence is spread over
investment banking transactions, 14 States and 59 locations, providing services to
evidencing the focus on capturing nearly 1,350 plus active clients. Its funding covers
opportunities in this high growth segment; 8 broad categories of commodities, which includes
71 approved commodities. It has also entered into
t Newer kinds of structured deals were initiatives like Lending against Electronically
successfully originated and concluded; Generated WHR on NCDEX-COMTRACK.
t Special focus was laid on CA by opening of TRA The Bank has 9 Collateral Managers. AG SME,
accounts, giving good float. an arm of ABG, provides specialized services to
clients in the Agriculture segment. It has a team
The Inclusive Banking arm of the Group was the of specialized Agriculture Finance professionals
Market leader in launching the ‘Business to cover all segments of the Agriculture value
Correspondent Model’, with Microfinance chain. This Division has scaled up innovative and
Institutions providing micro loans to weaker compliant products such as Agri Project
sections of society. The model is being replicated
081
00
Finance, Agri Trade Finance and Agri The SCF Vertical provides Inventory Finance to
Infrastructure Finance. In its two years of 280 Dealers of 13 corporates having program size
operations, the vertical has been able to of ` 730 crores Under VF, the Group provides
establish itself as a significant player in the Dairy tailor-made solutions to the vendors of different
and Agri Infrastructure segments. corporates. There are 12 programs running under
VF with Program Size of ` 715 crores. The Group
Supply Channel Finance (SCF) also caters to the Working Capital requirements of
The SCF Group has 3 products under its ambit: the Dealer and Vendor Community.
Vendor Finance, Channel Finance Non-Auto
(Inventory Funding), and Working Capital.
Global Markets Group
Global Markets Group (GMG) comprises three undertaken long-term Currency and Interest Rate
main functions: Asset Liability Management (ALM), Swaps and executed large size deals with
Trading in Rates, Foreign Exchange and established market counterparties. The Desk has
Derivatives, and Client Risk Solutions (CRS). established itself as an active market-maker in INR
Rates (MIFOR) and has significantly added
The Asset Liability Management Unit manages the volumes to FCY / INR options, which had
regulatory requirements relating to Cash Reserve commenced trading in the previous year.
Ratio (CRR) and Statutory Liquidity Ratio (SLR),
Funds Management, and Transfer Pricing. The Credit Trading Desk was actively involved
in originating, syndicating and underwriting
The Bank's resource mobilisation strategy Debt products, including Non-Convertible
proactively addressed the structural liquidity risk Debentures, Commercial Papers, Debentures
conditions, and achieved a significant efficiency in with warrants, etc. The Desk had originated
Bank’s sources of funds with an optimal mix of tailor-made Debt structures to suit the needs of
Term Deposits, Market Borrowings, and Clients and the Investors, thus enhancing client
Refinance. With the increased thrust of RBI on value and fee income.
management of Intra-day Liquidity (IDL), Liquidity
Coverage Ratio (LCR), and High Quality Liquid The Client Risk Solutions (CRS) Team in the
Assets (HQLA), the ALM Desk has been Global Markets Group advises Institutional,
judiciously balancing the resourcing and Corporate and Consumer segment clients on
deployment of funds. their foreign exchange, and structures solutions
in currency and interest rates to hedge their
The Trading Desk in Rates and Foreign Exchange exposure. The team works on a hub- and-spoke
has been taking proprietary positions in the Rates model with Zonal Offices in Gurugram
and Rupee Market as well as G-7 currencies. The (Gurgaon), Kolkata, Bengaluru and Mumbai,
Interest Rate Trading Desk had increased trading with branches in major cities.
volumes in SLR securities and revenue, besides
dealing in Exchange-Traded Interest Rate Futures Exchange-Traded Currency Derivatives (ETCD)
(IRF) to optimise profits. The Derivatives Desk had are a new asset class f or d i versi f i cati on o f
082
00
investments for resident Indians. The ETCD Desk Given the dependency on system and trading
is a Trading-cum-Clearing Member ber in NSE, and platforms, the Bank has been conducting
offers a web-based platform across client Business Continuity Plan drills at regular
segments for hedging currency exposures.
xposures. intervals. The Bank has implemented Calypso,
an integrated Treasury application interfaced
The Bank completed the acquisition
tion of the Gems with the Risk monitoring system. The application
& Jewellery business from Royal Bank of covers all Client and Trading products of the
lientele and the
Scotland N.V., India, and the clientele Global Markets business.
products provided considerable e synergy to the
ank. During the
existing product suite of the Bank.
-tenor Currency
year, the team executed long-tenor
and Interest Rate Swap dealss with Financial
Institutions / PSU clients. The Bank has
established a relationship withh a large client
s.
group through novation of trades.
perational policy
The Bank has well laid-out operational
olicies, including
guidelines, risk management policies,
nd appropriate
Client Suitability Policy, and
ransactions and
systems support to monitor transactions
risk on real-time basis.
Transaction Banking
nking Group
Transaction Banking Group (TBG) provides banks for cross-border flows under IMPS.
agement, Trade
solutions under Cash Management,
Services, Supply Chain Finance,nance, Global The Bank grew its e-Commerce Card acquiring
nd the Gems &
Remittances, Digital Banking, and business with Worldpay, one of the largest
Jewellery sector. Payment Gateway providers globally,
globally by adding
new merchants. The Bank also launched new
The Bank continued to be a leading player in products such as Money Transfer Service Scheme
Rupee Drawing Arrangements, acting as a (MTSS) account credits, partnering with the largest
preferred bank for over 60 partners worldwide. The Money Transfer company globally, and also
year also saw revenue under this product increase obtained approval for OPGSP (Online Payment
by over 74%, as the Bank started offering real-time Gateway Service Provider) services.
cross-border payments using the NPCI-promoted
IMPS facility. Our Bank is among the topmost
083
00
Under the umbrella of Cash Management Services The Bank continues to assist clients to
(CMS), the Bank offers customized and participate in domestic and global trade and
differentiated products to its Corporate and capital flows in an effective manner. The Bank
also provides custom-made solutions to its
Consumer Banking customers, to improve their
clients that assist them to improve their
Receivables and Payables management. This efficiencies. The Cash Management Team and
offering assists the Bank to grow its Current the Global Markets Group complement the trade
Account base, as well as generate fee income. offerings and facilitate providing of best services
under one umbrella to clients. This
CMS throughput witnessed a significant increase multi-pronged approach has enabled d the Bank
during the year, with several new mandates added. to deliver a consistent and strong business
The year saw the Bank pursue performance despite a challenging ng macro
technology-focused solutions for the corporates, environment. Fee Income in the Trade e business
Mutual Funds industry, Public Sector enterprises grew 22% during the year. The Bank is also in the
process of commencing business from om Gujarat
and NBFCs, thus solving their critical receivables
International Finance Tech City (GIFT), ), which is
management and reconciliation issues. The Bank expected to open new Trade businesss avenues.
is developing a Corporate Mobile App for its
corporate customers to digitally access banking est-in-class
The Bank endeavors to offer best-in-class
and payment services. secured, efficient and technologically advanced
online platforms to its clients to meet their entire
Trade finance needs, and is at an advanced
The Bank, in its constant endeavor to stay ahead
stage of implementation of the same. e. This will
in the digital space, has launched a full-fledged eamlessly,
enable the Bank’s clients to transact seamlessly,
Application Programming Interface (API) platform resulting in significant financial and operational
to host various services, including Collection and efficiencies to them.
Payment services targeted at corporate customers
as well as third-party solutions providers. The utions offer
The Bank’s Supply Chain Finance Solutions
the suppliers cost-effective financing of Trade
Bank also introduced new products in the space of
Receivables, enhanced by integrated ed online
domestic Money Transfer, to increase its revenues nging from
operation. Clients across sectors ranging
from digitization initiatives. Automobile to Agri-Processing are e offered
utions and
customized Supplier Financing Solutions
The Bank received multiple Awards from ‘The orates are
dealers / distributors of large corporates
Asset’, an independent leading Asian business eading to a
offered Channel Financing Solutions, leading
king Capital
competitive source of funding and Working
journal, under the following categories:
management to carry out the business efficiently.
Best Cash Management Solution
Best Liquidity Management Solution
Best Electronic Management Solution
Best Country Solution – Trade Finance
084
00
Gems and Jewellery Segment With the acquisition of the Diamond & Jewellery
On April 10, 2015, the Bank had announced entering business from RBS, the Bank became one of the
into an agreement to acquire the Diamond & largest banks financing this business in India.
Jewellery financing business and the related This acquisition was part of a strategy of creating
Deposits portfolio of Royal Bank of Scotland N.V. Scale with Profitability in select business
(RBS) in India, subject to regulatory approvals. On segments. The acquired Business Unit has
July 27, 2015, the Bank completed the acquisition paved the way for large cross-selling
and seamless migration of the entire business possibilities, as the Diamond & Jewellery
portfolio of RBS in India. The acquired loan portfolio industry provides employment to more than a
was approximately ` 41 billion. million skilled artisans.
A critical success factor in Diamond Financing is

global client knowledge, and this is being
achieved through a Long-Term Partnership
Agreement with ABN AMRO Bank N.V. This
strategic relationship will facilitate deeper
industry and client insight, and in turn lead to
improved client-servicing, enhanced revenue
opportunities and better risk management.
Proactive client monitoring has kept the Bank
ahead of competition even in difficult market
conditions.
The Bank has also been recently honored with three awards from the Gems and Jewellery Export
Promotion Council under the aegis of Ministry of Commerce.
Best Bank Financing the Industry
Highest Growth of Highest Finance Highest Limits

Sanctioned Limits Sanctioned (Exports) Sanctioned
085
00
Priority Sector Lending
The Bank has achieved the aggregate Approach to Priority Sector Lending
RBI-prescribed target for Priority Sector Advances.
The Bank continues to pursue Priority Sector
Priority Sector Advances aggregated ` 29,908.82
advances, including those relating to Agriculture /
crores as at the end of March 2016, representing
Micro and Small Enterprises / Weaker Sections.
43.03% of the Adjusted Net Bank Credit (ANBC) of
the previous year, as compared to 40.71% at the
Business Units in Corporate, Commercial, and
end of March 2015.
Consumer Banking Groups have built specialized
teams to significantly enhance the Bank’s footprint
Advances to Agriculture in the PSL segments.
During the year, the Bank financed over
14,93,370 agriculturists, and its Aggregate Specific plans and strategies for achieving targets
Agricultural Advances stood at ` 11,021.82 crores, and sub-targets under Priority Sector Lending
representing 15.86% of ANBC as at the end of have been formulated, some of which are
March 2016. As per current guidelines, the indicated below:
distinction between Direct and Indirect Agricultural
Advances has been removed by RBI. t Financing farmers / JLGs against hypothecation
of agricultural produce.
t Financing farmers for transport of their own

agricultural produce.
t Financing farmers for supply of various Agri and

Allied commodities, viz., Sugarcane, Oilseeds,
Milk, Rubber, etc.
t Financing Agri and Allied Projects, viz.,

Horticulture, Dairy Farming, Poultry Farming,
Bee-keeping, Aquaculture, Floriculture, etc.
t Financing Agri Infrastructure, viz., warehouses,

cold storages, godowns, market yards, silos, etc.
Advances to other segments
of Priority Sector t Financing farmers / entities engaged in
plantations of coffee, tea, rubber, and paper pulp.
The Bank’s finance to ‘Weaker Sections’
increased by ` 2,464.12 crores and stood at `
t Finance upto ` 5 crores per borrower to dealers
7,209.23 crores, representing 10.37% of ANBC
/ sellers of fertilizers, pesticides, seeds, cattle
as at March 2016.
feed, poultry feed, agricultural implements and
other inputs.
Finance to Small Enterprises represented 18.41%
of the ANBC as at March 2016.
t Financing dairy segment for capital expansion
and working capital requirements.
086
00
t Investments in Rated Asset Pools meeting the t Loans to MFIs for on-lending to farmers for
eligibility criteria for Priority Sector. agricultural and allied activities eligible for
Priority Sector.
t Direct lending through Service Providers under
the Partnership Model for meeting the Agri,
MSME and Weaker Sections.
Risk Management
Banking business is exposed to a wide spectrum

of risks, and it is imperative that the various risks t Credit and other risk policies aligned with
faced by the Bank are effectively measured, business strategies. The policies are reviewed
monitored and managed. A robust in line with changes in RBI guidelines, economic
Enterprise-wide Risk Management (ERM) environment and operating outlook;
framework enables effective and proactive t Gauging Credit Risk at the time of credit approval by
management of various risks, while supporting means of risk-rating models implemented for
business growth. ERM helps reduce volatility in different segments of obligors;
earnings and enhances shareholder value.
t Credit Portfolio Management analysis to
The Bank has an integrated Risk Management monitor credit quality, composition of portfolios,
Department, independent of business functions, concentration risk, yield monitoring and
covering Credit Risk, Market Risk, business growth;
Assets-Liabilities Management (ALM) and
Operations Risk, including Information Security t Measurement and monitoring of credit quality
risk functions. Risk management practices have regularly by means of Weighted Average Credit
been aligned with the best industry practices and Rating (WACR) of the credit portfolio;
are adaptable to a dynamic operating environment t Prudential internal limits prescribed for
and market conditions. assuming exposures on counterparties,
industries, sectors, etc.;
Credit Risk Management
Credit Risk is managed both at transactions level t Measurement of credit quality of Consumer Finance
as well as portfolio level. portfolios by means of Behaviour Modelling;
t Management of exposures to counterparty banks

The key objective of Credit Risk management is to and countries by setting exposure limits basis their
maintain credit quality within the defined risk risk profiles and monitoring the exposures regularly;
appetite, while achieving appropriate return in
relation to risks assumed. Various measures t Stress Testing of credit portfolios to measure shock
adopted for management of Credit Risk are absorbing capacity under multiple stressed
mentioned hereunder: scenarios and assessment of impact of potential
credit losses on profitability and capital adequacy,
thus enabling initiation of appropriate risk
mitigation measures.
087
00
Despite the challenging environment, the Bank Coverage Ratio (LCR), Dynamic Liquidity
has been able to maintain its credit growth and the monitoring, Liquidity Ratios analysis, Behavioural
quality of its portfolio. The Bank’s restructured analysis of liabilities and assets, and prudential
assets are among the lowest in the industry, with limits for negative gaps in various time buckets.
the Corporate as well as the Retail Loan Books
having remained resilient. t Interest Rate Sensitivity is monitored
through prudential limits for Rate Sensitive
The Bank has been introducing wider range of Gaps, Earning at Risk, Modified Duration of
Retail products, to have larger share of wallet Equity and other risk parameters.
and to meet customers’ needs. Such products
are governed by structured product t Interest Rate Risk on Investment portfolios is
programmes specific to the business, which monitored through, PV01, VaR and Modified
details out the criteria on customer selection and Duration on a daily basis. Optimum risk is
underwriting standards. assumed through duration, to balance between
risk containment and profit generation from
Market Risk Management market movements.
Market Risk arises from changes in interest rates,
exchange rates, equity prices and risk-related Detailed analysis of liquidity position, interest rate risks,
factors such as market volatilities. product mix, business growth versus budgets, interest
rate outlook, etc., is presented to Asset-Liability
The Bank manages Market Risk in trading Management Committee (ALCO) which meets
portfolios through a robust market risk frequently and deliberates on liquidity position and
management framework prescribed in its Market interest rate risk and reviews the business strategies.
Risk Management Policy.
ALCO provides directional guidance to Business
The Bank has implemented state-of-the-art Units towards effective management of liquidity
Market Risk Management System, which will position, while achieving Business goals. The Bank
enable adoption of Internal Model Approach assesses its structural liquidity position on a daily
for computation of Capital Charge towards basis for managing liquidity in a cost-effective
market risk. manner.
A robust Market Risk framework is in place, Stress Testing – Liquidity Risk

incorporating the new evolvements in Market risk The Bank carries out stress tests on liquidity
management domain. The Market Risk system position regularly to simulate impact of stressed
supports VaR, Stress Testing, and Capital liquidity scenarios on funding and liquidity
Computation Framework, helping manage market position. Stress tests help to be better equipped to
risk in volatile market conditions. The framework meet stressed situations and have contingency
includes monitoring of Value-at-Risk (VaR) limits funding plans in place.
PV01 limits, for Forex, Investments, Equity and
Derivatives portfolios, besides Stop-Loss limits, Contingency Funding Plan
Exposure limits, Deal-size limits, etc. Contingency Funding Plans have been developed
to respond swiftly to any anticipated or actual
Asset-Liability Management (ALM) stressed market conditions.
The Bank’s Asset-Liability Management system
supports effective management of liquidity risk and The Bank reviews its contingency plans
interest rate risk, covering all assets and liabilities. considering the evolving market conditions.
Contingency funding plan covers available
t Liquidity Risk is managed through Structural sources of funds to supplement cash flow gaps in
Liquidity Gaps, Liquidity Simulation, Liquidity
088
00
the event of stressed scenarios, roles and
responsibilities of those involved in execution of
contingency plans and the contingency triggers.
Interest Rate Risk on Banking

Book (IRRBB)
Interest Rate Risk on Banking Book largely arises
on account of:
tRe-pricing Risk;
tOptionality;
tBasis Risk;
tYield Curve Risk.
Banks today face unprecedented number of new
From an economic value perspective, it is the and emerging risks that can threaten their
Bank’s policy to minimise sensitivity to changes in businesses. Thus, the Bank’s Risk Management
interest rates on assets and liabilities. Interest Rate Department keeps a close watch on the strategic,
Risk is measured based on the re-pricing operational and external risks and provides
behaviour of each items under asset, liability and necessary direction, and undertakes various
off-Balance Sheet products. The Bank’s Assets initiatives under its Operational Risk Management
and Liabilities Management Policy has laid down (ORM) Framework for mitigation of such risks. The
limits based on the risk appetite and the impact on ORM Framework encompasses Policy guidelines,
NII and Economic Value of Equity (EVE) for a given Risk and Control Self-Assessment (RCSA), Loss
change in Interest Rate. Data Analysis, Key Risk Indicators (KRIs), Risk
Profiling of branches, implementation of Basel III
The Bank has put in place necessary framework to norms and RBI Guidelines, etc. The Bank
measure and monitor Interest Rate Risk on constantly endeavours to enhance its ORM
Banking Book using the Duration Gap Approach, framework to ensure compliance with regulatory
besides the Traditional Gap Approach. norms and deliver greater strategic value.
Operational Risk Management RCSA of all major operations functions have been
carried out and appropriate risk mitigation plans
The Risk landscape for banks today is undergoing have been designed and implemented. Loss Data
substantial changes. Analysis, based on internal as well as external loss
data, is carried out periodically to identify trends
Operational Risk is the risk of incurring loss due to and reinforce operational controls. An Incident
failure of systems, technology, processes, Reporting tool has been designed and
employees, projects, disasters, external factors, implemented for reporting operational risk
frauds etc., including legal and regulatory risks. incidents across the Bank and monitoring actions
Operational Risk arises on account of human error, thereon for mitigation of risks.
failed processes, inadequate systems, frauds,
damage to physical assets, improper behaviour, or The Bank has initiated scenario-based
external events. The Bank aims to ensure that key assessment of identified plausible operational
operational risks are managed in a timely and risks. The scenario analysis will be used in creation
effective manner through a meticulous framework of statistical models with respect to computation of
of policies, standard operating processes and operational risk capital charge under Advanced
procedures and tools to identify, assess, monitor Measurement Approach of Basel II.
and control such inherent risks in its businesses.
089
00
Annual Re
Report 2015-16
New products / processes are rated in a t Treat Information Security Risk in line with
transparent manner so as to enable risk-based Business, Regulatory & Legal requirements;
decision-making for introduction of the same.
All new products / processes are approved by t Ensure Availability, Integrity, Confidentiality of
the Operational Risk Management Committee Information, establish Accountability & provide
(ORMC), which identifies the risks inherent in Assurance;
the products and prescribes necessary
controls to mitigate such risks. The products t Focus on People, Process & Technology for
and processes risks are subjected to review implementation;
post introduction / implementation to ensure
proper risk management. t Apply least privilege, need to know / use
principles;
The Bank’s audit mechanism covers a gamut of
activities such as periodical on-site audit, t Promote Information Security Awareness to
concurrent audits and off-site surveillance enabled create security-aware culture within employees,
by Bank’s advanced technology driven processes contractors, third parties and customers;
and the Core Banking System.
t Deal with exceptions and violations appropriately;
The acceleration in unfolding events both
domestic and global has further strengthened t Policy is spread across 14 domains, 171
the Bank’s Business Continuity Framework. The subdomains – 101 operational & 70 technical;
Bank has implemented a comprehensive
Bank-wide Business Continuity Plan to ensure t Focus on Information Security Governance,
continuity of its critical functions during Assurance & Evolution to ensure suitability,
disruption / disaster situations. adequacy and effectiveness;
Systems Risk t Participation of security team during initial stages

The Bank’s Information Security Policy provides of system acquisition & development;
the security framework upon which all
subsequent security efforts are based, and to t Structured approach towards Information
guide the development and maintenance of a Security Awareness;
comprehensive information security program. It
deals with security of information in various t Integrated Framework based on Deming’s
forms like spoken, written, printed and PDCA Cycle;
electronic or any other medium and handling of
information in terms of creation, viewing, t Organization of Information Security aligned with
transportation, storage or destruction. It the Framework.
contains the principles that direct managerial
decision-making and facilitates secure business The Bank is utilizing structured data on its
operations. It is designed to enable system for Anti-Money Laundering &
management of the Bank to ensure the Enterprise-wide Fraud Management system, risk
security of information assets and maintain analytics, enterprise BI. The Bank has also
accountability. It also defines the appropriate started aggregating unstructured data like
and authorized behaviour for personnel customer IPs, devices ID, and various social /
approved to use the Bank’s information media in its repository to increase risk
assets. The policies and procedures are built management capabilities.
around the following principles:
090
00
Financial Restructuring and
Reconstruction Group
All activities relating to recovery of non-performing During the year, the Bank recovered an amount of
loans and restructuring of stressed assets are ` 60.46 crores in written-off accounts.
handled by the Financial Restructuring and
Reconstruction Group (FRRG). The Net NPAs of the Bank stand at 0.36% of
the Total Advances, while the ratio of Gross
The Bank has actively utilized the NPA as percentage of Total Advances amount
Securitization and Reconstruction of Financial is 0.87%.
Assets and Enforcement of Security Interest
Act, 2002 for recovering its dues, wherever
considered appropriate.
Banking Operations
The Bank has strengthened the policy framework The Bank is a member of Banking Codes and
on “Know Your Customer” (KYC) norms and “Anti Standard Board of India (BCSBI), which was set up
Money Laundering” (AML) measures from time to to ensure that banks in India adhere to a voluntary
time, in line with the policies of Reserve Bank of Code, which sets minimum standards for fair
India. The Bank has implemented a simplified treatment to customers availing of banking
procedure of “Know Your Customer” which will services. The Bank has made a commitment to
benefit lower income group persons to open adhere to all the provisions of the Code prescribed
accounts with minimal documentation. by BCSBI. The Bank has taken steps to implement
the provisions of the Code of Commitment to the
The Bank had implemented a state-of-the-art Customers (Individuals). The Code is displayed at
Workflow and Imaging System for account all the branches and the same is also posted on
opening, booking fixed deposits and Bank's website in thirteen languages. The Code
processing trade finance transactions as also had been further revised in January 2014, and was
Third-Party Products sales operations and adopted by the Bank with the approval of the
branch expenses processing. Board of Directors.
The System enables faster turnaround times, and The Bank has also adopted the “Code of
movement of work from branch locations across Commitment to Micro and Small Enterprises” (MSE
the country to the Central Operations Unit in Code) issued in June 2008 for customers belonging
real-time, thus cutting out the time that physical to Micro and Small Enterprises segment. This Code
forms would take to arrive through courier. This was further revised in 2015 by BCSBI and duly
has helped in freeing up manpower at the adopted by the Board of Directors. It sets the
branches to tend to customer service as well as minimum standards of banking practices.
help provide online status of processing of
customer requests / new applications.
091
00
The Bank has also formulated the Policy on The Bank has framed the “Citizen’s Charter” to
‘Financing to Micro, Small and Medium Enterprises’, promote fair banking practices and to give
and the same is hosted on the Bank’s website. information in respect of various activities
relating to customer service.
The Bank is participating in clearing through
Cheque Truncation System (CTS). As on March The Bank has put in place a “Compensation
31, 2016, the Bank had 136 locations covered Policy” as part of the commitment to
under the Grid Clearing, through its three CTS customers to compensate them in case of the
centres in Mumbai, Chennai and Delhi. Bank being unable to meet the service levels
The Bank has also started participating in NACH committed to the customers. The main
(National Automated Clearing House) objective of the Policy is to establish a system
transactions both for Debit and Credit (ECS) at whereby the Bank shall compensate the
Mumbai, as also Aadhar-Based Payment System customer for any direct and actual loss by way
(ABPS) transactions through NPCI. of internal loss / payment of charges by
customer due to deficiency in service, to the
The Bank has adopted a “Comprehensive Policy”, extent mentioned in the policy. The Policy is
in pursuance of RBI advices, on settlement of based on the principles of transparency and
claims in respect of deceased depositors. The fairness in dealings with customers.
Policy covers all types of deposits, and has
simplified the procedure for settlement. The forms The Bank has framed the “Unclaimed Deposit
are available on the Bank’s website. Policy” based on RBI guidelines with the objective
of classification of unclaimed deposits and setting
The Bank has adopted the “Best Practice Code”, up the grievance redressal mechanism for quick
relating to transaction processing, with the resolution of complaints and record-keeping.
objective of documenting the procedures in line Further, as per RBI directives, w.e.f. June 2014,
with national and international best practices. balances in unclaimed deposits and other
accounts are being transferred to “Deposit
The Bank has put in place a “Deposit Policy” and a Education and Awareness Fund” (DEAF). Details
“Fair Practice Code”. The former outlines the relating to unclaimed accounts are duly uploaded
guiding principles in respect of various products of on the Bank’s website.
the Bank and the terms and conditions governing
the operations of the accounts and the rights of The Bank has also formulated the ‘Customer
depositors. The Fair Practice Code is a voluntary Rights Policy’ and the same is hosted on the
Code establishing standards to be followed by all Bank’s website.
our branches in their dealings with the customers.
Corporate and Global

Markets Operations
Corporate & Global Market Operations (CGMO) Derivatives, Cash Management Services,
manages the operations related to Trade Payments, Depository and Capital Markets
Services, Cross Border Remittances, Supply servicing of all clients across both the Corporate
Chain Finance, Treasury, Foreign Exchange and and Retail segments. CGMO continued its focus
092
00
during the year on Operational Efficiency, Risk A significant achievement was the completion of
Management and Client-centric initiatives. an end-to-end risk review and market
benchmarking of one of the key payment
The Operating Model was further strengthened processes in Cash Management Operations.
during the year with enhanced focus on
centralization of processing activities. The resilience Regular risk reviews were conducted across all
of the Trade Processing Model (independent hubs in processing centers. During the year, critical red
Chennai and Mumbai) was put through the severest flags and risk-related MIS were automated, to have
test during the weather-related challenges faced in a more robust monitoring process. There was
Chennai during December 2015. It was ensured strong emphasis on proactive identification of
that there was minimal client impact during the Trade Based Money Laundering related red flags,
BCP situation. customized training was imparted, and improved
controls were put in place to address this risk.
During the year, processes like Letters of Credit
Client focus is another key focus area, with the
and Collections (Trade Operations), Funding of
objective of improving client experience through
Broker Accounts (Capital and Commodities
various client-centric initiatives.
Market Operations) and submission of various
regulatory reports were centralized. This is in “Voice of Customer” was implemented, through
line with the Bank’s strategy to provide which structured feedback is received from top
increased scale of operations and improved risk clients, across segments. The performance of
management through centralized processing the client servicing team is now measured
and improved client experience through through a dedicated “Service Quality Unit”.
decentralized client servicing. Apart from the Corporate clients, the Client
Services Team started supporting clients from
The Gems and Jewellery Portfolio acquired from the Global Remittances, Gems and Jewellery
Royal Bank of Scotland was successfully and Cash Management services segments. To
migrated during July 2015. This has significantly further improve client servicing, a customized
increased the volumes and through-put handled training program was rolled out.
by the Trade Operations Unit. Being a niche
client segment, a dedicated Operations Support CGMO continued in its journey towards
Desk has been operationalized in Mumbai ‘Continuous Improvement’ with the objective of
(Client-facing) and in Chennai (Support). delivering client satisfaction and year-on-year
efficiency benefits. This program focuses on
There was an increase in number of locations increasing ‘Client Delight, ‘Empowerment’ and
providing support for CGMO products. This is ‘Rewards & Recognition’. As part of this
expected to improve turnaround times and client initiative, over 650 process improvement
experience. The Bank continues to be among initiatives were implemented by the Staff
the market leaders in handling Bankers to the resulting in efficiency improvement, risk
Issue mandates for IPOs and in Tea Trade reduction on improved client experience. This is
Settlements. Significant growth in volumes was almost a 30% increase over the previous years.
seen in all areas. An initiative to scientifically manage the
operations capacity was completed during the
Proactive Operational Risk Management has year. This is expected to help deliver significant
been one of the major focus areas, and is efficiencies in the next couple of years.
embedded in the organization. The Analytics,
Information and Metrics Unit within the CGMO Focus on people development initiatives
Operational Risk team is fully operational and continued. Over 16,000 man-hours of training
delivers critical information and metrics that were delivered during the year aimed at creating
is used to identify potential risk events. a strong knowledge force. Trainings delivered
093
00
covered product features, risk awareness, Treasury Operations, Market Risk Management
regulatory requirements, continuous (for the Global Markets Group), Bullion
improvement and soft skills like communication, Operations, Currency Derivatives, Exception
team effectiveness and leadership skills. Various Management, Client-pricing Repository, Bank
other people-centric initiatives were launched Guarantees, and Supply Chain Finance.
Re-platforming is in progress for the Trade
during the year including job up-skilling, cross-
Finance System (for remaining Trade products)
functional training, and Family Day at Office. A including the client front-end. These
Sustainability Week was also conducted during state-of-the-art systems will be capable of
the year, encouraging staff to participate in handling high volumes of complex Global
planned community events. Market products, will support effective risk
management, and will significantly boost
CGMO made significant progress in the capabilities in these product segments and offer
re-platforming of the processing systems. New clients with world-class products and services.
state-of-the-art systems were operationalized for
Operational Controls consistency of delivery with the expanding

branch network;
The Bank has laid down the policy framework
related to "Know Your Customer" (KYC) norms, t Branch Monitoring Unit is entrusted with regular
“Anti Money Laundering Measures” (AML) and monitoring of branch operations; Voucher
Combating of Financing Terrorism (CFT). The verification process has been operationalised
policy has been framed on the basis of for checking all the entries posted by the
recommendations of the Financial Action Task branches; and
Force and the Paper issued on ‘Customer Due
Diligence for Banks’ by the Basel Committee on t The Process Adherence and Quality function
Banking Supervision. has been operationalised for attaining
uniformity in processes followed by branches to
The Bank has sharpened internal controls and
minimise operational risk.
compliance through the following:
t Separate and independent Compliance Customer Service
function has been set up for Bank-wide In compliance with RBI regulations, the
compliance; ‘Standing Committee on Customer Service’
(SCCS), formerly known as ‘Committee of
t Instituting of the Vigilance function; Procedures and Performance Audit of Public
Services in Banks’, comprising senior Functional
t Expenses management software has been Heads of the Bank and a few customers has
deployed at all branches for facilitating cost been established.
control;
The Bank has also constituted a Customer
t Standard Operating Procedures have been Service Committee of the Board of Directors
defined for processes at branches to ensure (CSCB) to review the performance of the SCCS.
094
00
The Bank has constituted Branch-Level Customer Scheme, 2006 are also displayed at Branches
Service Committees (CSC) at all branches, and provided on the website.
comprising employees and customers. CSC
meetings are convened every month to examine A link has been created in the Bank’s website for
complaints / suggestions, cases of delay, a “Complaint Form”, which gives opportunity to
difficulties faced / reported by customers / all customers to air their grievances in a
members of the Committee. Feedback and simplified way and get their complaints
suggestions are submitted to SCCS. redressed without delay. Further, customers can
contact the respective Branch Manager or Call
SCCS examines and provides relevant feedback our Contact Centre on toll-free number or send
to the Customer Service Committee of the Board email to [email protected] to lodge
for necessary policy / procedural action. their grievances.
The Bank implemented “Talisma”, a ‘Customer Internal Audit

Complaints, Queries and Requests Management The Bank’s Internal Audit function is adequately
System’. The key objective of this solution is to equipped to make an independent and objective
have a single system to track requests, evaluation of the adequacy and effectiveness of
complaints and queries at customer level so that internal controls on an on-going basis to ensure
the service standards as set out by the Bank are that units adhere to compliance requirements
managed and enhanced. The System has been and internal guidelines.
implemented across all branches and the Bank’s
Contact Centres in Mumbai and Chennai. The Internal Audit function undertakes a
comprehensive risk-based audit of all operating
Grievance Redressal Mechanism units. An Audit Plan is drawn up on the basis of a
The Bank follows the Board-approved risk-profiling of auditee units. Internal audit of its
“Grievance Redressal Policy”, which lays down operating units is accordingly undertaken at a
a defined escalation process for all customer frequency synchronized to the risk profile of
complaints received at branches and at each unit in line with the spirit of guidelines
Corporate Office within the overall framework of relating to Risk-Based Internal Audit. The scope
RBI guidelines. of risk-based internal audit, besides examining
the adequacy and effectiveness of internal
A Quarterly Report related to complaints received control systems and external compliance,
and redressed is placed before the Board of includes evaluation of the risk residing at the
Directors. Based on the recurrence of complaints auditee units. To complement the Internal Audit
in specific areas, causative factors are identified Function and have real time supervision and
and necessary remedial measures are initiated. control, critical units of the Bank are covered
under concurrent audits by reputed Audit Firms.
The Bank maintains a dedicated page for
lodging of complaints and complaint To ensure independence, Internal Audit
redressal mechanism on its website functionally reports to the Audit Committee of
www.indusind.com where information on the the Board, and for administrative purpose,
escalation process and the details of the reports to the Managing Director & CEO of the
Nodal Officer / Regional Managers to receive Bank. The Audit Committee of the Board
complaints has been furnished. reviews the performance of Internal Audit
Department, the effectiveness of controls laid
These details are also displayed at the Bank’s down by the Bank, and compliance with
branches. Details of the Banking Ombudsman regulatory guidelines.
095
00
Compliance mandatory stakeholder of the Operations Risk

Management Committee (ORMC) and provides
sign-off for a new Product / Process routed
through this channel. The Chief Compliance
Officer is also the Principal Officer of the Bank
under the Prevention of Money Laundering Act
The Board and Management of the Bank are (PMLA) and reviews the KYC / AML / CFT
committed to high standards in maintaining a Policy annually.
corporate culture of observing what is legally
binding, and of embracing broader standards of The Central Compliance Department also
integrity and ethical conduct. monitors the level of compliance through
modalities like self-certification, on-site and off-site
The Bank has a Central Compliance Department compliance testing, parameter-based testing, etc.,
that facilitates management of Compliance Risk. covering branches, Corporate Office functions,
The Compliance Function undertakes macro and also various associate entities.
level compliance activities namely, review of
Compliance Policy of the Bank, monitoring To promote and strengthen compliance-culture among
compliance aspects, providing guidance on the workforce, the Compliance Function regularly
regulatory and statutory provisions pertaining to conducts seminars for branch staff including
various business activities to the concerned Operations Executives and Branch Managers;
functional units, and assisting functional units in circulates short notes on important topics, and analysis
ensuring that the Bank’s Policies, Processes, of / learning from cases including the learnings. It also
and Products meet the regulatory and statutory publishes monthly newsletter covering news articles on
requirements. The Compliance Function is a banking related topics.
Human Resources
HR has been an enabler in meeting the business that employees want to be a part of the Bank’s
ambition of the Bank. The focus of HR remains growth journey.
on talent acquisition, development, retention
and employee engagement.
HR's strategic agenda is to implement

benchmark HR practices, offer meaningful
career opportunities, work-life balance,
market-linked compensation and an enabling
work culture to its employees.
High Potential Talent industry-wide choose the

Bank as a preferred destination to build a
long-term career. Negligible attrition at strategic
managerial layers and leadership levels indicates
096
00
Key Highlights:
t The employee headcount of the Bank UBMFOUXJUIDSPTTGVODUJPOBMTLJMMT

increased to 23,060 employees in FY16 from
19,121 employees in FY15. The Bank used t Performance Management Processes, namely,
diversified hiring channels such as Employee Goal Setting, Mid-year Review, and Annual
Referral Schemes, Job Portals, Placement Performance Review helped to outline
Agencies, Campus Hiring, Social Media, employee performance objectives through
HireTrain - Deploy model, etc., for achieving “SMARTs”, review performance, mentor and
scalability and efficiency in its hiring processes. develop employees, recognize and reward,
The Bank’s talent acquisition approach is to based on tangible achievement against
build a skilled pipeline for scaling the existing performance objectives.
business initiatives and to source novel skills
and knowledge for anchoring new business The Annual Performance Appraisal for FY15
initiatives. In order to identify, assess and was executed in alignment with the Bank’s
recruit right candidates, the Bank’s selection objective of linking rewards to performance.
process comprised multi-layered interviews Mid-year performance review for FY16 was
and competency assessment tests. used as a platform by the Business line
managers and HR to mentor employees,
t The Bank continues to focus on developing provide developmental feedback and develop
diversified and multi-dimensional skills through performance plans for employees to
carefully designed learning solutions. The key enable achievement of their annual
learning objective is to create a differentiated performance objectives.
workforce with desired Knowledge, Skills and
Attitude for business success of the Bank. t The Bank’s Compensation Policy is based on a
‘Pay-for-Performance’ philosophy. The key
During FY16, the Bank conducted 7,14,000 objectives include basing the Bank’s compensation
learning man-hours for over 1,32,000 on business performance and market trends,
participants through classroom and differentiate amongst individuals based on
e-learning modes. Several learning programs performance, build long-term employee
in areas of Leadership, Team Building, ownership and association, and be compliant with
Managerial Effectiveness, Customer Service, the regulatory guidelines.
Communication Skills, Banking Products,
Banking Operational Processes, Credit t The Bank pursues “Discipline and Compliance”
Processes, Induction, Compliance and as its core values to create a congenial
Technology Platforms were conducted workplace. Every employee has to adhere to
during the year. The Bank also conducted the Bank’s Code of Conduct and follow the
integrated Management Trainee programs Bank’s business processes.
across Business Units to build entry-level
The Bank believes that Human Capital will be the key to its future success. The HR strategic intent would
continue to be on attracting, developing and retaining quality talent and on creating a work culture where
employees can maximize their potential and contribute to the Bank’s business success.
097
00
Employee Stock Option Scheme basis of criteria laid down in the Scheme and is
The Bank had instituted an Employee Stock approved by the Compensation Committee of
Option Scheme (ESOS-2007) to enable its the Board of Directors.
employees, including Whole time Directors, to
participate in the future growth of the Bank. An aggregate of 3,75,70,300 Options,
Under the Scheme, Options can be granted, comprising 6.31% of the Bank's equity capital,
which upon exercise could give rise to the have been granted under the Scheme. Statutory
issuance of a number of shares upto 7% of the disclosures as required by SEBI Guidelines on
issued equity capital of the Bank from time to Employee Stock Options are given at Annexure
time. The eligibility and number of Options to IV to the Directors' Report.
be granted to an employee is determined on the
Shareholder Satisfaction
Towards more transparency and enhancing Stock Exchanges, Press, Bank’s website, RTA’s
A’s
shareholder satisfaction, contact details of website, etc.
shareholders such as e-mail IDs, cell phone Shareholders of the erstwhile IndusInd Enterprisess &
numbers and telephone numbers are obtained, so Finance Limited (IEFL) who did not respond to
as to communicate to them about developments Letters, were contacted individually through Bank’snk’s
in the Bank. This direct communication is in branches, encouraging them to exchange Share are
addition to the regular dissemination of Certificates of IEFL for Certificates of the Bank.
information through usual channels such as the
098
00
Shareholders shall continue to receive best-of-class about the easy process for claiming the dividend
shareholder services and be promptly informed of amounts lying unclaimed with the Bank.
the developments in the institution.
As regards transmission of securities, in case of
The Bank has been at the forefront in “Green securities held in physical mode (in single name
Initiatives”, and through this process aspires to without nomination), SEBI have prescribed a
graduate to paperless compliances. threshold limit of `2,00,000 (Rupees Two lakhs
Shareholders are requested to furnish their e-mail only), i.e., market value of securities per folio, as
IDs at [email protected] or inform on date of the application for transmission, for
telephonically on 022-66412487 to help accelerate following simplified documentation. SEBI have,
the Bank’s migration to paperless compliances. however, empowered Issuer Companies to
enhance the value of such securities, at their
With the implementation of the Companies Act, discretion.
2013, companies can send Annual Reports and
other communications through electronic mode to Due to difficulties faced by the legal heirs in
those shareholders who have registered their email submission of Succession Certificate / Probate /
addresses with the Company or made available by Letters of Administration, the Board of Directors of
the Depository. the Bank have, for operational convenience,
delegated the authority to the Share Transfer
The full text of the Report shall also be made Committee for approving the transmission of
available in an easily navigable format on the securities held in physical mode, in case of market
website www.indusind.com under the link ‘Investors value of securities of upto ` 10,00,000 (Rupees Ten
Reports and Presentation / Annual Reports'. umentation
lakhs only) subject to simplified documentation
Shareholders have continually been informed procedure prescribed by SEBI.
Information Technology
Achievements: April 1, 2015 to ([FHOOHQFH

,'5%7 %DQNLQJ 7HFKQRORJ\ ([FHOOHQFH
March 31, 2016 Award 2014-15
Awards The Bank received the “Best Bank Award for

Electronic Payment Systems amongg Mid-Size
*ROGHQ 3HDFRFN *OREDO $ZDUG IRU El t i
Banks” for the implementation of Electronic
Excellence in Innovation Management Payment Systems.
The Bank won the ‘Golden Peacock Innovation

Management Award’ for the year 2015 at the
awards presentation ceremony in London. The
Bank won this award for delivering innovation
lead product offerings and developing a unique
process of managing innovation within the
GOLDEN PEACOCK
Bank.
IRDBT
RDBT
099
00
National Payments Excellence Awards 2015 1. Best Payment Initiative – Winner.
The Bank received the following awards in the 2. Best Financial Inclusion Initiative – Winner.
National Payments Excellence Awards function
organized by National Payments Corporation of 3. Best Fraud & Risk Management Initiative –
India (NPCI). Runner Up: Amongst Small Banks.
1. NFS ATM Network – Winner: The Bank was

declared winner in “Small Banks Category” in
recognition of excellent performance in NFS
ATM Network, based on the following
parameters; Acquiring and Issuing Volume
growth, Chargeback ratio, Business decline
ratio, Technical decline ratio and deployment of
ATMs in rural areas.
2. NACH – Joint Runner Up: The Bank was

declared joint runner up in “Small Banks
Category” in recognition of excellent
performance in National Automated Clearing
House (NACH), based on parameters such as
Inward volume, Return transaction %, Mapper
seeding, Extension, Dispute processing TAT
and Mandate TAT.
CSOFORUM Business Impact Award

ard
The Bank has been recognized gnized for
implementing security projects whichch resulted
in positive business impact and has enabled the
Bank to quickly launch new online services by
significantly reducing the security assurance
cycle while ensuring continuous protection.
tection. The
award was presented at the Cyber Security for
Business Impact conference and nd awards
ceremony organized by CSOFORUM. M.
IBA Awards 2016

The Bank received three awards in the IBA
Banking Technology Conference Expo &
Awards 2016.
100
000
Digital Initiatives
The new mobile banking App of the Bank was The Bank launched banking on Social
launched on Android, iOS and Windows Platforms like Facebook and Twitter. Customers
platform at the end of December 2015. It is a can bank through Facebook messenger or App
complete ground-up, re-think on User by sending direct Messages to the Bank. Other
Experience with first-of-its-kind User Interface services like balance enquiry, mini-statement,
(UI). Registration is instantaneous using Net locating nearest ATM and branch outlets are
Banking, Debit Card, Credit Card credentials. also available. Customers can send money via
g
Biometric-based Log-in has been enabled on QuickPay y to another Facebook user or to a
compatible phones. It offers a range of banking
banking recipient not on Facebook via e-mail or SMS. To
and payment services like Check Account Acccount enable this service, the user need not download
balances, mini-statements, transfer funds f any additional Mobile App or subscribe to any
(NEFT, IMPS etc.), make bill paym payments,
ments, application on Facebook, but can simply log on
recharges, credit card payments, deposit de
eposit to Facebook available on smart phones.
booking, QuickPay, service requests in a ssimple
imple Customers can also call our Video Branch or
consolidated menu. initiate QuickPay from our Facebook home
page (on desktops). On Twitter, customers can
The focus has been to simplify paymentss and avail all the services mentioned above and can
“unbank” banking with a seamless payment
pay
yment transfer money to another user who is on Twitter
experience on the app with few click checking
checcking as well as to any bank account holder who is
not on Twitter via E-mail or SMS.
This App, launched in November 2015 in

association with Citrus Pay, allows users to set
custom reminders for upcoming bills, track
billing history and pay bills on time. With the
IndusCube App, any user who downloads the
App and sets up a bill will be reminded about
upcoming bill payment automatically. It allows
non-customers to register their card, receive
updates on IndusInd Credit Card and make
out for payments and other services. The App
payments with a few taps on the App. There is
allows customers to withdraw money at ATMs
also an option to share a bill with a family
without a card with its Cash on Mobile Service.
member or friend using the App. The App reads
the SMS automatically and sends reminders to
2 lakh plus App downloads within months of
the user as and when a Bill Payment is up and
launch. 50,000 registered users clocking more
notification comes as SMS.
SMS
than 1 lakh transactions per month.
0101
00
adopting a more targeted and personalized

approach, the Bank is implementing a
Campaign Management Solution. The first
phase has been implemented and the Bank has
QuickPay is one-of-a-kind service launched by started targeted campaigns through e-mails
the Bank in July 2015. and is tracking the efficacy of the campaigns.
Starting from dissemination of e-mails, to
It enables the customers to send money as an tracking of Customers’ Response (Open & Click
e-cheque or as an e-gift card to anyone just with events), and maintaining a repository of
their E-mail ID or Mobile Number. Customers do customers’ responses to various campaigns for
not have to remember Account Numbers or add Lead generation, is being done in an efficient
as beneficiaries. The initiation leg is way. In the next few months, the Bank would
authenticated through customers IndusNet / have the capability of launching campaigns on
Debit Card credentials. On successful all customer touch-points, which would be
validation, a transaction completion link is sent centrally managed using advanced analytics.
to the Mobile number / Email ID of the
beneficiary as per the option selected while Calypso – Integrated Treasury System
initiating the transfer. In addition, an insta-code The Bank has gone live with Calypso ver14 and
is sent to the initiator via SMS. replaced OPICS. All asset classes used by the
Bank are now active on Calypso, the major
API Management ones being Options, Swaps, Forex, Fixed
The Bank implemented the tool to expose APIs Income, Money Market, etc.
(services from banking applications) to multiple
partners in a secured and controlled manner. Calypso is a cross-asset, front-to-back,
This solution has enabled channel partners to real-time solution for Treasury and Liquidity
connect their applications quite easily to the Management. The application provides
Bank’s services without extensive coding. 6 real-time portfolio and risk management
partners are already using this portal to functionality and seamlessly integrates with
connect to the Bank’s services and more than various trading platforms.
15 partners are in different stages of
development. Calypso system has been configured to receive
real-time market data feed from Reuters.
iBlogs Payment interfaces have been configured for
IndusInd Blog site was launched in November NEFT, RTGS and Swift Alliance. Accounting
2015. iBlogs is an interesting platform focusing entries from Calypso are configured to flow into
on latest industry news, trends & topics related the Finacle CBS. Calypso system has been
to the financial sector. These informative articles configured to send emails to customers and
and write-ups are collated from the also for system alerts. The System went live on
Management Team & Employees. Idea of the January 11, 2016.
initiative is to attract digital-savvy audience to
communicate news, views and perspectives of Commodity XL for Precious Metals
reputed leaders from organizations. Currently, 8 (CXLPM) system
blogs are published and another set of articles The Bank has implemented the CXLPM
are planned for future course. (Commodity XL for Precious Metals) system
to cater to bullion requirements. The system
Campaign Management System
To enhance digital marketing capabilities and to
improve interaction with the customer by
102
000
supports import of gold consignment for June 21 – 22, 2015. Some of the key benefits of
domestic as well as export purposes, delivery the upgrade are End-of-Day (EOD) optimization,
of bullion to Distributors on unfixed, loan or performance improvement in job processing,
outright basis, forwards trading with scalability, etc.
distributors / suppliers.
Rural Banking Application
Trade data interface is configured with Treasury
IndusInd Bank has a number of branches in rural
system Calypso for position reporting, covering
areas where stable telecom connectivity is a
and monitoring. Payment interfaces have been
challenge and therefore, Data Cards were
configured with Swift Alliance. Accounting
provided as a cost-effective solution. However,
entries from CXLPM are configured to flow into
considering that the new browser-based solutions
Finacle CBS.
like Finacle require a higher and stable bandwidth,
user and customer experience had been
The System supports a wide range of
impacted. In order to address this, the Bank has
transaction reports, such as Consignment
developed and deployed a custom-built,
Clearance documents, Invoices, Delivery
client-based solution that runs on a laptop, which
Orders, Debit / Credit advices, Interest advices,
requires only minimum data to be fetched from the
Trade confirmation, Balance confirmation, RBI
servers resulting in fast turnaround time. This has
Returns, Customs Returns, Sales Tax Registers,
resulted in rendering of superior customer service.
Bond Cancellation advice.
This client-based solution works on low
bandwidth, provides portability, supports
Customer Oriented - Enhancements multiple devices, viz., desktop, laptop, tab &
mobile. This has, so far, been deployed at over
Environment Upgrade for Finacle - Core 25 such rural unbanked branches.
Banking System
Existing CBS System went live in December 2012. New Currency Derivative System
Since then, branches have doubled, and there is a for Back-Office
considerable increase in transaction volumes. In order to offer enhanced services, a new
Considering this, and the future growth, a decision Currency Derivative System for Back-Office was
was taken to upgrade the hardware by doubling implemented in August 2015. The new system,
the processing capacity and deploying newer from Thomson Reuters, replaced ‘Ensettle’ system
versions of other related system software used earlier.
components like Operating System, Application
Server, database to leverage the newer hardware. Some of the improvements over the previous
Accordingly, migration of Finacle to new hardware system are:
was successfully carried out over the weekend of
Maker / Checker concept
Better built-in checks and validation
Email facility to customers
Reduction in EOD processing time
Integration with CBS application obviating manual

reconciliation of customer accounts and internal accounts
0103
00
iWorkS – Architectural Changes t Carried out additional perimeter network testing

by a third-party to validate work of the regular
iWorkS, an image-based workflow system has 19 testing partner.
Interfaces and more than 70 processes and 13
Utilities. It supports total work-item volume of t Implemented Data Leakage Prevention
more than one crore and document size of around Solution across Web gateway, Email gateway
15 TB. and endpoints devices like laptops and
desktops.
With increase in users and volume, architectural
changes were made by splitting iWorkS into two t Implemented Information Rights Management
cabinets or parts. Some of the benefits of this Solution to control access rights on sensitive
architectural change are: documents and files.
1. Performance enhancement; t Implemented Identity & Access Management

2. Ease in patch management and system Solution for Core Banking application to
maintenance; and achieve greater control over the entire life cycle
3. Increase in System uptime. of user access to applications.
Government-Led Initiatives Internal Efficiency
Goverment Business Applications IT Jobs Automation

For various Government initiatives, the Bank has Automation of various IT processes has been
rolled out following applications: taken up under an initiative named ‘Smart Jobs’. It
aims at end-to-end automation of jobs across
$WDO3HQVLRQ<RMDQD multiple applications, load balancing, timely error
0RUDGDEDG'HYHORSPHQW$XWKRULW\ handling and corrective action, etc. Presently,
1DWLRQDO3HQVLRQ6FKHPH processes configured are from Finacle, ECBF,
3XQMDE0DQGL%RDUG iWorkS, My Revenue and Calypso applications.
30-LYDQ-\RWL%LPD<RMDQD Many other back-end IT processes of other
306XUDNVKD%LPD<RMDQD applications, are being taken up to reduce manual
:DJH3URWHFWLRQ%RDUGRI.HUDOD intervention.
Insider Trading Application – ESS New Service Desk

application
Employee Self Service (ESS) application rolled out Some of the features of the Service Desk are:
during the year is an employee self-service
application for Options grantees to comply with t User-friendly and self-guided Service
the Bank’s Insider Trading Code in compliance Request forms with auto-population of
with SEBI guidelines. mandatory information from Component
Management Database;
Security, Risk & Internal Efficiency
t Service Level Measurements attached to each
t Implemented Web Application Firewall to user request and indicators, notifications and
protect internet facing servers from application auto-escalations helps support teams in better
level attacks. TAT management;
t Recertified successfully for the t Conformance to ITIL framework for Change,

ISO27001:2013 Information Security Incident, Work-order and Asset Management
Management Systems standards. is implemented;
104
000
t MIS Reporting to stakeholders, technicians, Disaster Recovery (DR) Site is located in
senior management; Chennai. During the year, the Bank successfully
migrated Data Centres from the Offices on G.N.
t Auto-assign user request to respective analyst, Chetty Road and Karapakkam to an outsourced
based on support staff availability, skills and modern state-of-the-art Airtel Data Centre facility
location; at Siruseri, Chennai.
t My-IT Mobile application with universal client During the year, the Bank had successfully
helps to access Service Desk having anywhere, conducted DR Drills for 32 applications and
anytime – a digitization initiative. demonstrated its disaster recovery capabilities and
readiness to switch over to DR systems in case of
Business Continuity / DR unforeseen disaster. All these DR Drills have been
audited by an External Auditor. The Bank has also
The Bank has a Business Continuity Plan
participated in the DR Drills of RBI Payments
document, which includes back-up strategies,
Systems Applications.
archiving, and data recovery in case of disasters.
All the servers of the Bank are housed in Data
Centres in Mumbai and Chennai. The Bank’s
Legal
There have been no significant changes / proceedings, which if determined adversely, could
amendments in legislation during FY 2015-16 result in a material adverse effect on the business.
affecting the Bank / the Banking Industry. However, there are certain legal proceedings in the
context of banking activity which are not unusual
The Bank is not involved in any legal proceedings, for a bank of comparable size.
and is not aware of any threatened legal
0105
00
Corporate Communications
The Bank’s focus during the year 2015-16 was to account balance, enquiry of mini-statement,
sustain and maintain the Bank as a High-Street locating nearest ATM / branch, users can also
Brand. To attain this objective, the Bank adopted transfer money to their phone and social contacts
various initiatives which led to increasing the using Facebook and Twitter.
brand’s visibility while communicating with
consumers in their space using the most engaging
marketing approach-digital marketing.
During the year, the Bank embraced various digital Mobile Banking App, a simple, fast and secure way
initiatives to enhance the digital quotient of the of banking on the go. The Bank’s customers can
Brand and also to stay connected with the now check their account balance, transfer money,
new-age digital-savvy customers. recharge mobile or DTH and enjoy a host of other
banking and payment services anytime, anywhere.
The Bank launched many web and App-based
new initiatives for its customers, such as: On the social front, the Bank has been active
on Facebook, Twitter and LinkedIn throughout
the year and stands tall today with more than
6.7 lakh fan-base on Facebook, 21,000 on
Twitter and 38,000 on LinkedIn. Today, most of
the Bank’s followers are customers who use
An Instant money transfer service wherein IndusInd these social platforms to communicate
Bank customers can send money to their personal effectively with the Bank.
contacts and/or business parties through SMS,
e-mail and social media platforms, without having The Bank has continued its journey with Radian6,
the beneficiary Bank Account details. an ORM (Online Reputation Management) tool
which helps in listening to what the customers are
talking or writing on various online platforms. This
tool also helps the Bank to know about various
news articles being written in the media about the
Bank on real time basis. The Bank has also started
IndusCube a Social Media Command Center, which works for
12 hours on all 7 days to respond all customer
IndusCube App, the one-stop solution from queries / feedback, etc. received via various digital
IndusInd Bank that makes bill payments a breeze forums, social channels, news portals, etc.
to its customers as well as non-customers.
While digital marketing gathered momentum,
the conventional marketing formed the
backbone of marketing activity of the Bank.
Series of outdoor advertising campaigns were
planned throughout the year at strategic
Social Banking, which offers customers a host of locations to reinforce the brand.
banking services including transactions through
social platforms like Twitter and Facebook. Apart from
providing banking services like checking
106
000
Another significant achievement during the year sportspersons, the programme will provide
has been the opening of new branches at well-structured support systems to encourage 15
semi-urban and urban locations and taking the emerging and elite para-athletes, who have
score of branch network to 1,000 and 1,800 ATMS overcome challenges and excelled in their chosen
across 623 geographical locations. The Bank had sport against all adversity. The platform would aim
also conducted a series of short burst of intense to carry out year-long engagement activities for all
marketing activities - all in local flavour to reach out our key stake holders, viz., Clients, Employees,
to the regional population. and Community.
The Bank acknowledges that no communication is

complete without the wholehearted support of its
internal stakeholders. Keeping this factor in mind,
the Bank started streaming live, in virtual mode,
the Townhalls of the Managing Director across all
offices and branches. This was appreciated and
valued across internal stakeholders. Apart from
such quarterly Townhalls, the Bank believed in
providing regular mailers on various
developments to the employees thereby aligning
them with the latest updates.
Yet another significant achievement which the Several other communication initiatives undertaken
Bank entered into was an agreement with Royal by the Bank include:
Bank of Scotland N.V. to acquire its Diamond and
Jewellery financing business in India and the
t Sponsorships / donations / events with
reputed Associations / Trusts which in turn
related deposit portfolio.
have given higher visibility and reinforced
the brand image. The Bank participated in
April 7, 2016 would be considered as a
activities having multi-purpose objectives
watershed day in the history of IndusInd Bank.
such as sports, philanthropy, music, etc.,
For it is on that day, the Bank announced the
along with service organisations / NGOs and
launch of a non-banking vertical - the Sport
Corporate Bodies to make the Bank’s
vertical - IndusInd For Sports via a Press
presence felt in the community. Some of the
Conference held in Mumbai. IndusInd Bank also
major associations were with Pandit Chaturlal
carried out a robust social media campaign to
Memorial Society, Sahachari Foundation,
create and encourage engagement levels. As a
Rajmata Vijaya Raje Scindia Centre for
feedback, the Bank was able to generate 7,100
Development (RVRSCD) among others.
conversations with different stakeholders on
Twitter and the said hashtag was trending all t Regular client engagement activities, Debit
India for 8 hours. During the press conference, and Credit Card promotions, regional level
the Bank live-tweeted to constantly keep the promotions, branch launches, an
audience updated. extensiveround of development of various
collaterals for new products / services, and
IndusInd For Sports is an attempt to bring out the tactical promotions during festive /
Sport in Every One, promulgating the benefits of a seasonal offers.
healthy, active lifestyle. The first project to have
officially been launched through the press t Periodic concalls, one-on-one investor
conference is “IndusInd Umang” in association meetings, roadshows and annual analysts’
with the GoSports Foundation. A first-of-its-kind meets have all created a positive impact on
platform, exclusively designed for differently-abled the Bank's image.
0107
00
Branch Network & Infrastructure
As on March 31, 2016

The Bank opened
the Bank had a
199 New
total network of
branches and
1,000
branches and
313 Off-Site 1,800

ATMs, inclusive of
ATMs during
the year 2015-16 1,046
off-site ATMs
The Bank has presence in all 29 States and 5 out requirements, distinct from branch network
of the 7 Union Territories. In addition, the Bank also capacity additions.
has Representative Offices in London, Dubai and
Abu Dhabi. Apart from the Currency Chest set up in Chennai
during the last year, one more Currency Chest
During the year 2015-16, apart from expanding its was made operational in Kolkata during the
Branch network to reach pan-India network of current fiscal, and another Currency Chest is
1,000 branches, the Bank also refurbished / proposed in Bengaluru in the next fiscal, which
re-modeled 3 branches, set up 15 new are expected to significantly enhance in-house
Administrative Offices and relocated 5 branches capabilities and provide support for increased
towards better business prospects. business profitability.
A total of 750 seats were added across India to

cater to growth in Back-Office / Controlling Office
108
000
CORPORATE GOVERNANCE
Bank’s Philosophy on the Code of Corporate Governance

7KH%DQNEHOLHYHVWKDWFRQVLVWHQWLPSOHPHQWDWLRQRIJRRG&RUSRUDWH*RYHUQDQFHSUDFWLFHVFRQWULEXWHVWRZDUGV
GHYHORSLQJDQGVXVWDLQLQJWKHEHVWRSHUDWLQJV\VWHPVDQGSURFHGXUHV
7KHV\VWHPVZKLFKKDYHHYROYHGDOORZVXIILFLHQWIUHHGRPWRWKH%RDUGDQGWKH0DQDJHPHQWWRPDNHGHFLVLRQV
DQGWDNHDFWLRQVWRZDUGVWKHJURZWKRIWKH%DQNDQGVLPXOWDQHRXVO\UHPDLQZLWKLQWKHIUDPHZRUNRIHIIHFWLYH
DFFRXQWDELOLW\ 7R PDLQWDLQ KLJK VWDQGDUGV RI &RUSRUDWH *RYHUQDQFH WKH 'LUHFWRUV KDYH IRUPHG YDULRXV
&RPPLWWHHVRIWKH%RDUG7KH&RPPLWWHHVPHHWUHJXODUO\WRDFKLHYHWKHLUVSHFLILFREMHFWLYHV
7KH%DQNLVFRPPLWWHGWRRSHUDWHRQFRPPHUFLDOSULQFLSOHVHQVXULQJDWWKHVDPHWLPHWKHQHHGWRUHPDLQ
DFFRXQWDEOHWUDQVSDUHQWDQGUHVSRQVLYHWRLWVVWDNHKROGHUV
7KH%DQNDFNQRZOHGJHVWKHQHHGWRXSKROGWKHLQWHJULW\RIHYHU\WUDQVDFWLRQLWHQWHUVLQWRDQGEHOLHYHVWKDW
KRQHVW\ DQG LQWHJULW\ LQ LWV LQWHUQDO FRQGXFW ZRXOG EH MXGJHG E\ LWV H[WHUQDO EHKDYLRXU ,Q WKLV FRQWH[W WKH
'LUHFWRUV KDYH DGRSWHG D ¶&RGH RI (WKLFV DQG &RQGXFW· IRU 'LUHFWRUV DQG 6HQLRU 0DQDJHPHQW 7KLV &RGH
DWWHPSWVWRVHWIRUWKWKHJXLGLQJSULQFLSOHVRQZKLFKWKH%DQNVKDOORSHUDWHDQGFRQGXFWLWVGDLO\EXVLQHVVZLWK
LWVPXOWLWXGLQRXVVWDNHKROGHUV*RYHUQPHQWDQGUHJXODWRU\DJHQFLHVPHGLDDQGDQ\RQHHOVHZLWKZKRPLWLV
FRQQHFWHG
7KH%DQN·VFRUSRUDWHJRYHUQDQFHSKLORVRSK\KDVEHHQVWUHQJWKHQHGWKURXJKWKH&RGHRI&RQGXFWIRU3UHYHQWLRQ
RI,QVLGHU7UDGLQJLQWKH%DQN·VVHFXULWLHVDQGWKH&RGHRI3UDFWLFHVDQG3URFHGXUHVIRU)DLU'LVFORVXUHVRI
8QSXEOLVKHG3ULFH6HQVLWLYH,QIRUPDWLRQ
Certification by the Chief Financial Officer and the Managing Director
,QWHUPVRI5HJXODWLRQRIWKH6(%,/LVWLQJ2EOLJDWLRQVDQG'LVFORVXUH5HTXLUHPHQWV5HJXODWLRQVWKH
&HUWLILFDWLRQE\WKH0DQDJLQJ'LUHFWRU &(2DQGWKH&KLHI)LQDQFLDO2IILFHURIWKH%DQNRQWKHILQDQFLDOVWDWHPHQWV
DQGWKHLQWHUQDOFRQWUROVUHODWLQJWRILQDQFLDOUHSRUWLQJKDVEHHQREWDLQHGDQGVXEPLWWHGWRWKH%RDUG
Code of Ethics and Conduct for Directors and Senior Management
7KH%RDUGRI'LUHFWRUVKDVODLGGRZQD¶&RGHRI(WKLFVDQG&RQGXFW·IRUDOO%RDUG0HPEHUVDQG6HQLRU0DQDJHPHQW
RIWKH%DQN7KHVDLG&RGHKDVEHHQXSORDGHGRQWKH%DQN·VZHEVLWHZZZLQGXVLQGFRPXQGHUWKHKHDG¶,QYHVWRUV·
²¶&RGHRI&RQGXFW·
'HFODUDWLRQE\WKH0DQDJLQJ'LUHFWRU$OOPHPEHUVRIWKH%RDUGDQG6HQLRU0DQDJHPHQWKDYHDIILUPHGWRWKH%RDUG
RIKDYLQJFRPSOLHGZLWKWKH¶&RGHRI(WKLFVDQG&RQGXFW·GXULQJWKH\HDUHQGHG0DUFKDQGQRYLRODWLRQRI
WKH¶&RGHRI&RQGXFW·KDVEHHQUHSRUWHGGXULQJWKH\HDU
)RUWKLVSXUSRVHWKHWHUP¶6HQLRU0DQDJHPHQW·PHDQVSHUVRQQHORIWKH%DQNZKRDUHPHPEHUVRILWV&RUH0DQDJHPHQW
7HDPH[FOXGLQJWKH%RDUGRI'LUHFWRUV7KLVFRPSULVHV0HPEHUVRI0DQDJHPHQWZKRDUHRIWKHOHYHORIIXQFWLRQDOKHDGV
MISSION
´:HZLOOFRQVLVWHQWO\DGGYDOXHWRDOORXUVWDNHKROGHUVDQGHPHUJHDVWKH%HVWLQ&ODVVLQWKHFKRVHQSDUDPHWHUV
DPRQJVWWKHFRPLW\RIEDQNVE\GRXEOLQJRXUSURILWVFOLHQWVDQGEUDQFKHVZLWKLQWKHQH[WWKUHH\HDUVµ
VISION
´,QGXV,QG%DQNZLOOEH
$UHOHYDQWEXVLQHVVDQGEDQNLQJSDUWQHUWRLWVFOLHQWV
&XVWRPHU5HVSRQVLYHVWULYLQJDWDOOWLPHVWRFROODERUDWHZLWKFOLHQWVLQSURYLGLQJVROXWLRQVIRUWKHLUEDQNLQJQHHGV
$IRUHUXQQHULQWKHPDUNHWSODFHLQWHUPVRISURILWDELOLW\SURGXFWLYLW\DQGHIILFLHQF\
(QJDJHGZLWKDOORXUVWDNHKROGHUVDQGZLOOGHOLYHUVXVWDLQDEOHDQGFRPSOLDQWUHWXUQVµ
QUALITY POLICY
´,QGXV,QG%DQNLVFRPPLWWHGWRPHHWDQGVWULYHWRH[FHHGFXVWRPHUUHTXLUHPHQWVWKURXJKWLPHO\HUURUIUHHDQG
FRXUWHRXVVHUYLFH:HVKDOOFRQWLQXDOO\LPSURYHWKHHIIHFWLYHQHVVRIRXUZRUNSURFHVVWKURXJKWUDLQLQJFXVWRPHU
IHHGEDFNDQGUHYLHZRIV\VWHPVµ
109
Board of Directors
7KH%DQN·V%RDUGLVEURDGEDVHGDQGFRQVLVWVRIHPLQHQWLQGLYLGXDOVIURPLQGXVWU\KDYLQJNQRZOHGJHRUSUDFWLFDO
H[SHULHQFHLQUHVSHFWRIRQHRUPRUHILHOGVYL]$FFRXQWDQF\%DQNLQJ)LQDQFH,QIRUPDWLRQ7HFKQRORJ\(FRQRPLFV
$JULFXOWXUHHWF7KH%RDUGLVFRQVWLWXWHGLQFRPSOLDQFHZLWKWKH%DQNLQJ5HJXODWLRQ$FWWKH&RPSDQLHV$FW
DQGWKH6(%,/LVWLQJ2EOLJDWLRQVDQG'LVFORVXUH5HTXLUHPHQWV5HJXODWLRQV´/LVWLQJ5HJXODWLRQVµ
7KH%RDUGLVHQWUXVWHGZLWKIRUPXODWLRQRISROLFLHVLPSOHPHQWDWLRQRI5HJXODWRU\JXLGHOLQHVVHWWLQJXSRIGLUHFWLRQV
SODQQLQJ RI VWUDWHJLHV HYDOXDWLRQ RI SHUIRUPDQFH RI WKH %DQN HWF DQG KDV EHHQ YHVWHG ZLWK UHTXLVLWH SRZHUV
DXWKRULWLHVDQGGXWLHV7KH&RPPLWWHHVKDYHRYHUVLJKWRYHUWKHRSHUDWLRQDOLVVXHVDVVLJQHGWRWKHPE\WKH%RDUG
i. Composition
7KHFRPSRVLWLRQRIWKH%RDUGLVLQFRPSOLDQFHZLWKWKHUHTXLUHPHQWVRI5HJXODWLRQRIWKH/LVWLQJ5HJXODWLRQV
7KH %RDUG FRQVLVWV RI HLJKW 'LUHFWRUV FRPSULVLQJ 1RQ([HFXWLYH &KDLUPDQ ILYH ,QGHSHQGHQW 'LUHFWRUV RQH
1RQ,QGHSHQGHQW1RQ([HFXWLYH'LUHFWRUDQGWKH0DQDJLQJ'LUHFWRUDQG&(27KHFRPSRVLWLRQRIWKH%RDUG
UHSUHVHQWVDQRSWLPDOPL[RISURIHVVLRQDOLVPNQRZOHGJHDQGH[SHULHQFH
$IWHU WKH HQG RI WKH ILQDQFLDO \HDU WKH %RDUG RI 'LUHFWRUV KDG LQ WKHLU PHHWLQJ KHOG RQ 0D\
DSSRLQWHG 'U 7 7 5DP 0RKDQ ',1 DV ¶$GGLWLRQDO 'LUHFWRU· LQ WKH FDWHJRU\ RI ¶,QGHSHQGHQW
1RQ([HFXWLYH·
1RQHRIWKH'LUHFWRUVRIWKH%DQNDUHUHODWHGWRHDFKRWKHU
7KHLQIRUPDWLRQLQUHVSHFWRIHDFKRIWKH'LUHFWRUVLVIXUQLVKHGEHORZ
Name of Director Nature of Special Knowledge / Occupation

Directorship Practical Experience
0U56HVKDVD\HH 3DUWWLPH )LQDQFHDQG*HQHUDO 1RQ([HFXWLYH9LFH
1RQ([HFXWLYH 0DQDJHPHQW &KDLUPDQ
&KDLUPDQ $VKRN/H\ODQG/WG
0UV.DQFKDQ&KLWDOH ,QGHSHQGHQW $FFRXQWDQF\ 3UDFWLVLQJ&KDUWHUHG
1RQ([HFXWLYH $FFRXQWDQW
0U9LMD\9DLG ,QGHSHQGHQW 66, ,QGXVWULDOLVW
1RQ([HFXWLYH
0U7$QDQWKD1DUD\DQDQ ,QGHSHQGHQW $FFRXQWDQF\DQG 5HWLUHG)RUPHU([HFXWLYH
1RQ([HFXWLYH $JULFXOWXUH 'LUHFWRU)LQDQFHRI$VKRN
/H\ODQG/WG
0U5DQELU6LQJK%XWROD ,QGHSHQGHQW )LQDQFH (FRQRPLFV 5HWLUHG)RUPHU&0'RI
1RQ([HFXWLYH ,QGLDQ2LO&RUSRUDWLRQ/WG
0U<DVKRGKDQ0.DOH 1RQ,QGHSHQGHQW &RUSRUDWH*RYHUQDQFH 6HUYLFH
1RQ([HFXWLYH $FFRXQWDQF\DQG7D[DWLRQ
0U6KDQNHU$QQDVZDP\ ,QGHSHQGHQW ,QIRUPDWLRQ7HFKQRORJ\ 5HWLUHG)RUPHU0DQDJLQJ
1RQ([HFXWLYH 'LUHFWRURI,%0,QGLD3ULYDWH
/LPLWHG
0U5RPHVK6REWL :KROHWLPH'LUHFWRU %DQNLQJ 0DQDJLQJ'LUHFWRU &(2
110
ii. Attendance of Directors at Meetings of the Board and Annual General Meeting
'XULQJ WKH \HDU HQGHG 0DUFK QLQH PHHWLQJV RI WKH %RDUG ZHUH KHOG 2Q $SULO 0D\
-XQH-XO\$XJXVW2FWREHU2FWREHU-DQXDU\DQG
0DUFK'HWDLOVRIDWWHQGDQFHDWWKH%RDUG0HHWLQJVDQGDWWKHSUHYLRXV$QQXDO*HQHUDO0HHWLQJRWKHU
'LUHFWRUVKLSVDQG0HPEHUVKLSVDQG&KDLUPDQVKLSVRI&RPPLWWHHVSHUWDLQLQJWRHDFK'LUHFWRUDUHDVIROORZV
Name of the Director Attendance Attendance Number of other No. of No. of

at the Board at the AGM Directorships Committees Committees
Meetings held on of other of other
(No. of August 17, Indian Public Other companies companies
Meetings 2015 Limited Companies / in which in which
attended #) Companies LLPs Member $ % Chairman $ %
0U56HVKDVD\HH $WWHQGHG
0U$VKRN.LQL /HDYHRI 1$ 1$ 1$ 1$

$EVHQFH
0UV.DQFKDQ&KLWDOH $WWHQGHG
0U9LMD\9DLG $WWHQGHG
0U5DQELU6LQJK%XWROD $WWHQGHG 1$ 1$
0U7$QDQWKD1DUD\DQDQ $WWHQGHG
0U<DVKRGKDQ.DOH $WWHQGHG
0U6KDQNHU$QQDVZDP\ 1$
0U5RPHVK6REWL $WWHQGHG
0U$VKRN.LQLUHWLUHGRQ'HFHPEHURQDWWDLQLQJWKHDJHRI\HDUVWKHPD[LPXPDJHOLPLW
SUHVFULEHGIRU'LUHFWRUV
0U6KDQNHU$QQDVZDP\ZDVLQGXFWHGLQWKH%RDUGDV¶$GGLWLRQDO'LUHFWRU·RQ-DQXDU\
,QFOXGHVDWWHQGDQFHWKURXJKYLGHRFRQIHUHQFH
Notes:
3XUVXDQW WR 5HJXODWLRQ RI WKH /LVWLQJ 5HJXODWLRQV IRU WKH SXUSRVH RI FRQVLGHULQJ WKH OLPLW RI WKH
&RPPLWWHHVLQZKLFKWKH'LUHFWRUVDUH0HPEHUV&KDLUPHQDOO3XEOLF/LPLWHGFRPSDQLHVZKHWKHUOLVWHG
RUQRWDUHLQFOXGHG3ULYDWH/LPLWHGFRPSDQLHV)RUHLJQ&RPSDQLHVDQGFRPSDQLHVXQGHU6HFWLRQRI
WKH&RPSDQLHV$FW¶1RWIRU3URILW·DUHH[FOXGHG
)RUWKHSXUSRVHRIGHWHUPLQDWLRQRIWKHQXPEHURI&RPPLWWHHVRIRWKHUFRPSDQLHV&KDLUSHUVRQVKLSV
DQG 0HPEHUVKLSV RI RQO\ WKH $XGLW &RPPLWWHH DQG WKH 6WDNHKROGHUV 5HODWLRQV &RPPLWWHH KDYH EHHQ
FRQVLGHUHG
111
iii. Remuneration
'XULQJ WKH \HDU XQGHU UHYLHZ WKH 1RQ([HFXWLYH 'LUHFWRUV UHFHLYHG UHPXQHUDWLRQ E\ ZD\ RI 6LWWLQJ )HHV IRU
DWWHQGLQJ WKH PHHWLQJV RI WKH %RDUG DQG RI YDULRXV %RDUG &RPPLWWHHV $V SHU WKH %DQN·V SROLF\ QR 6WRFN
2SWLRQVZHUHJUDQWHGWRWKH1RQ([HFXWLYH'LUHFWRUV
,Q YLHZ RI WKH JXLGHOLQHV FRQWDLQHG LQ 5%, &LUFXODU GDWHG -XQH RQ FRPSHQVDWLRQ RI 1RQ([HFXWLYH
'LUHFWRUVRISULYDWHVHFWRUEDQNVWKH%RDUGRI'LUHFWRUVKDYHRQWKHEDVLVRIWKHUHFRPPHQGDWLRQRI+XPDQ
5HVRXUFH 5HPXQHUDWLRQ &RPPLWWHH LQ WKHLU PHHWLQJ KHOG RQ 0D\ DSSURYHG WKH SD\PHQW RI
UHPXQHUDWLRQRIÒDNKVSHUDQQXPWR0U56HVKDVD\HH3DUWWLPH1RQ([HFXWLYH&KDLUPDQRIWKH%DQN
VXEMHFW WR DSSURYDO RI 5HVHUYH %DQN RI ,QGLD DQG WR WKH 1RQ([HFXWLYH 'LUHFWRUV RWKHU WKDQ WKH 3DUWWLPH
&KDLUPDQLQWKHIRUPRI3URILWUHODWHG&RPPLVVLRQQRWH[FHHGLQJÒDNKVSHUDQQXPIRUHDFK'LUHFWRULQ
VXFKPDQQHUDVPD\EHGHFLGHGE\WKH%RDUGRI'LUHFWRUV,QFRPSOLDQFHZLWKWKHSURYLVLRQVRIWKH&RPSDQLHV
$FW WKH DERYH SURSRVDOV KDYH EHHQ SODFHG IRU DSSURYDO E\ WKH 0HPEHUV LQ WKH QG $QQXDO *HQHUDO
0HHWLQJRIWKH%DQN
7KH DERYH FRPSHQVDWLRQ LV LQ DGGLWLRQ WR WKH 6LWWLQJ )HHV EHLQJ SDLG WR WKH 1RQ([HFXWLYH 'LUHFWRUV DQG
UHLPEXUVHPHQWRIWKHLUH[SHQVHVIRUSDUWLFLSDWLRQLQWKH%RDUGDQGLWV&RPPLWWHHPHHWLQJV
$IWHU WKH UHYLVLRQ LQ WKH UHJXODWRU\ SURYLVLRQV FRQWDLQHG LQ WKH &RPSDQLHV $FW WKH %RDUG DSSURYHG
LQFUHDVHLQ6LWWLQJ)HHVIRU%RDUGDQG&RPPLWWHHVPHHWLQJVDVXQGHU
D%RDUGRI'LUHFWRUV ` IRUHYHU\PHHWLQJDWWHQGHG
E$XGLW&RPPLWWHHRIWKH%RDUG ` IRUHYHU\PHHWLQJDWWHQGHGDQG
F)RUDOORWKHU%RDUG&RPPLWWHHV ` IRUHYHU\PHHWLQJDWWHQGHG
7KHGHWDLOVRI6LWWLQJ)HHVSDLGWRWKH1RQ([HFXWLYH'LUHFWRUVIRUDWWHQGLQJWKH%RDUGDQG&RPPLWWHHPHHWLQJV
KHOGGXULQJWKH\HDUDUHDVXQGHU
Name of Director Sitting Fees (`)

0U56HVKDVD\HH
0U$VKRN.LQL
0UV.DQFKDQ&KLWDOH
0U9LMD\9DLG
0U7$QDQWKD1DUD\DQDQ
0U5DQELU6LQJK%XWROD
0U<DVKRGKDQ.DOH
0U6KDQNHU$QQDVZDP\
0U$VKRN.LQLUHWLUHGRQ'HFHPEHURQDWWDLQLQJWKHDJHRI\HDUVWKHPD[LPXPDJHOLPLW
SUHVFULEHGIRU'LUHFWRUV
0U6KDQNHU$QQDVZDP\ZDVLQGXFWHGLQWKH%RDUGRQ-DQXDU\
112
Compensation to Whole-time Directors:
$SSRLQWPHQWUHDSSRLQWPHQWRI:KROHWLPH'LUHFWRUVLVPDGHZLWKWKHSULRUDSSURYDORIWKH5HVHUYH%DQNRI
,QGLD
Mr. Romesh Sobti, Managing Director & CEO:
0U5RPHVK6REWLKDVEHHQ0DQDJLQJ'LUHFWRU &(2RIWKH%DQNIURP)HEUXDU\
5HVHUYH%DQNRI,QGLDKDVDSSURYHGWKHUHDSSRLQWPHQWRI0U5RPHVK6REWLDV0DQDJLQJ'LUHFWRUDQG&(2
XSWR-DQXDU\
)RUWKHILQDQFLDO\HDUWKHGHWDLOVRIUHPXQHUDWLRQRI0U5RPHVK6REWLDUHDVIROORZV6DODU\,15
ODNKV2WKHU$OORZDQFHV,15ODNKVIDFLOLW\RIFRPSDQ\OHDVHGDQGIXUQLVKHGDFFRPPRGDWLRQ3URYLGHQW
)XQG DW RI 6DODU\ *UDWXLW\ DW RQH PRQWK·V 6DODU\ 3HQVLRQ DW WZR PRQWKV· 6DODU\ 0HGLFDO ([SHQVHV
UHLPEXUVHPHQWXSWR,15ODNK/HDYH)DUH&RQFHVVLRQRI,15ODNKV0HGLFODLPIRUVHOIDQGIDPLO\
PHPEHUV3HUVRQDO$FFLGHQW,QVXUDQFH3HUIRUPDQFHEDVHG%RQXV0HPEHUVKLSRIWZRFOXEVDQGWZRRIILFLDO
FDUVZLWKGULYHUV
'XULQJWKH\HDUXQGHUUHYLHZWKH&RPSHQVDWLRQ&RPPLWWHHRIWKH%RDUGLQLWVPHHWLQJKHOGRQ-DQXDU\
JUDQWHG 2SWLRQV WR 0U 5RPHVK 6REWL 0DQDJLQJ 'LUHFWRU &(2 DW D SULFH RI ` DW
DGLVFRXQWRI`SHUVKDUHRQWKH&ORVH3ULFHRI`SHUVKDUHRIWKHSUHFHGLQJGD\LQWKH16(7KH
2SWLRQVVKDOOYHVWRYHUDSHULRGRI\HDUVIURPWKHGDWHRIJUDQWVSUHDG#DWLQWHUYDOVRIRQH
\HDUIURPWKHGDWHRIJUDQW7KH2SWLRQVVRJUDQWHGDQGYHVWHGZRXOGKDYHWREHH[HUFLVHGZLWKLQDSHULRGRI
ILYH\HDUVIURPWKHGDWHRIYHVWLQJRIVXFK2SWLRQV
'XULQJ)<0U6REWLH[HUFLVHG2SWLRQVZKLFKKDGEHHQJUDQWHGDWDSULFHRI`SHUVKDUH
iv. Shareholding
(TXLW\VKDUHVKHOGE\WKH'LUHFWRUVDVRQ0DUFKDUHL0U7$QDQWKD1DUD\DQDQVKDUHV
1RQHRIWKH'LUHFWRUVRIWKH%DQNKROGVKDUHVLQWKH%DQNIRURWKHUSHUVRQVRQDEHQHILFLDOEDVLV)XUWKHUQR
'LUHFWRUKROGVDQ\RWKHUVHFXULW\LVVXHGE\WKH%DQN
Details of Directors seeking appointment / re-appointment / retiring by rotation at the AGM:
0U 6KDQNHU $QQDVZDP\ ZKR ZDV DSSRLQWHG ¶$GGLWLRQDO 'LUHFWRU· RQ -DQXDU\ LQ WKH FDWHJRU\ RI
´,QGHSHQGHQW1RQ([HFXWLYHµVKDOOKROGRIILFHXSWRWKHGDWHRIWKH$*0
'U775DP0RKDQZKRZDVDSSRLQWHG¶$GGLWLRQDO'LUHFWRU·RQ0D\LQWKHFDWHJRU\RI´,QGHSHQGHQW
1RQ([HFXWLYHµVKDOOKROGRIILFHXSWRWKHGDWHRIWKH$*0
,QDFFRUGDQFHZLWK6HFWLRQRIWKH&RPSDQLHV$FWWKH%DQNKDVUHFHLYHG1RWLFHVLQZULWLQJDORQJZLWK
WKHUHTXLVLWH'HSRVLWIURPD0HPEHUSURSRVLQJWKHFDQGLGDWXUHVRI0U6KDQNHU$QQDVZDP\DQG'U775DP
0RKDQIRUWKHRIILFHRI'LUHFWRULQWKHFDWHJRU\RI´,QGHSHQGHQW1RQ([HFXWLYH'LUHFWRUµQRWOLDEOHWRUHWLUHE\
URWDWLRQIRUDSHULRGRIIRXU\HDUVIURPWKHGDWHVRIWKHLURULJLQDODSSRLQWPHQWV
,QRUGHUWRHQVXUHFRPSOLDQFHZLWK6HFWLRQRIWKH$FWWKH%RDUGKDVFRQVLGHUHG0U56HVKDVD\HH3DUW
WLPH1RQ([HFXWLYH&KDLUPDQDQG0U5RPHVK6REWL0DQDJLQJ'LUHFWRU &(2DVOLDEOHWRUHWLUHE\URWDWLRQ
EHVLGHV0U<DVKRGKDQ0.DOH
,QDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKH&RPSDQLHV$FWRXWRIWKUHH'LUHFWRUVOLDEOHWRUHWLUHE\URWDWLRQ
0U56HVKDVD\HH3DUWWLPH1RQ([HFXWLYH&KDLUPDQEHLQJORQJHVWLQRIILFHUHWLUHVE\URWDWLRQDQGEHLQJ
HOLJLEOHRIIHUVKLPVHOIIRUUHDSSRLQWPHQWDWWKH$*0
113
$EULHISURILOHRIWKH'LUHFWRUVVHHNLQJDSSRLQWPHQWUHDSSRLQWPHQWLVJLYHQEHORZ
Director Qualifications Expertise Date of Name of Committees Shareholding

in specific Appointment companies in of other in Bank
functional area which Director / companies in (No. of
Partner in LLPs which Member / shares)
Chairman
0U6KDQNHU %DFKHORURI ,QIRUPDWLRQ -DQXDU\ +HDOWKFDUH Healthcare 1LO
$QQDVZDP\ (QJLQHHULQJ 7HFKQRORJ\ *OREDO Global
%('LSORPD (QWHUSULVHV Enterprises
LQ%XVLQHVV /LPLWHG Limited
0DQDJHPHQW 1RPLQDWLRQ
&UHGLW DQG
,QIRUPDWLRQ 5HPXQHUDWLRQ
%XUHDX,QGLD &RPPLWWHH
/LPLWHG&,%,/ $XGLWDQG5LVN
0DQDJHPHQW
&RPPLWWHH
Credit
Information
Bureau (India)
Limited (CIBIL
&XVWRPHU
3URWHFWLRQ
&RPPLWWHH
$XGLW
&RPPLWWHH
1RPLQDWLRQ
5HPXQHUDWLRQ
&RPPLWWHH
&RUSRUDWH
6RFLDO
5HVSRQVLELOLW\
&RPPLWWHH
'U775DP %7HFK,,7 %DQNLQJ 0D\ 5XUDO Rural
0RKDQ 0XPEDL )LQDQFH (OHFWULILFDWLRQ Electrification
3*'0,,0 &RUSRUDWLRQ Corporation
&DOFXWWD /LPLWHG Limited
3K'6WHUQ $XGLW
6FKRRO1< 6%,&$3 &RPPLWWHH
6HFXULWLHV &65
/LPLWHG &RPPLWWHH
1RPLQDWLRQ
DQG
5HPXQHUDWLRQ
&RPPLWWHH
SBICAP
Securities
Limited
$XGLW
&RPPLWWHH
+5&RPPLWWHH
1RPLQDWLRQ
DQG
5HPXQHUDWLRQ
&RPPLWWHH
114
Director Qualifications Expertise Date of Name of Committees Shareholding
in specific Appointment companies in of other in Bank
functional area which Director / companies in (No. of
Partner in LLPs which Member / shares)
Chairman
0U5 %&RP$&$ )LQDQFH -XO\ $VKRN/H\ODQG Ashok Leyland 1LO
6HVKDVD\HH *HQHUDO /LPLWHG Limited
0DQDJHPHQW 7HFKQRORJ\
,QIRV\V/LPLWHG ,QYHVWPHQW
+LQGXMD &RPPLWWHH
1DWLRQDO3RZHU 6WDNHKROGHUV
&RUSRUDWLRQ 5HODWLRQVKLS
/LPLWHG &RPPLWWHH
5LVN
$VKOH\$LUZD\V 0DQDJHPHQW
/LPLWHGLQ &RPPLWWHH
YROXQWDU\
ZLQGLQJXS Infosys Limited
$XGLW
+RXJKWRQ &RPPLWWHH
,QWHUQDWLRQDO,QF 5LVNDQG
86$ 6WUDWHJ\
&RPPLWWHH
1RPLQDWLRQ
DQG
5HPXQHUDWLRQ
&RPPLWWHH
&65
&RPPLWWHH
Hinduja
National Power
Corporation
Limited
5LVN
&RPPLWWHH
Houghton
International Inc.
USA
$XGLW&RPPLWWHH
Committees of the Board
7KH%RDUGKDVFRQVWLWXWHGVHYHUDO&RPPLWWHHVRI'LUHFWRUVWRWDNHGHFLVLRQVDQGPRQLWRUWKHDFWLYLWLHVIDOOLQJZLWKLQ
WKHLUWHUPVRIUHIHUHQFH7KH%RDUG·V&RPPLWWHHVDUHDVIROORZV
Audit Committee of the Board

7HUPVRIUHIHUHQFH
$ 3RZHUV
7RLQYHVWLJDWHDQ\DFWLYLW\ZLWKLQLWVWHUPVRIUHIHUHQFH
7RVHHNLQIRUPDWLRQIURPDQ\HPSOR\HH
7RREWDLQRXWVLGH/HJDORURWKHUSURIHVVLRQDODGYLFH
7RVHFXUHDWWHQGDQFHRIRXWVLGHUVZLWKUHOHYDQWH[SHUWLVHLILWFRQVLGHUVQHFHVVDU\
115
% 5ROH
2YHUVLJKWRIWKHFRPSDQ\·V)LQDQFLDO5HSRUWLQJSURFHVVDQGWKHGLVFORVXUHRILWVILQDQFLDOLQIRUPDWLRQWR
HQVXUHWKDWWKH)LQDQFLDO6WDWHPHQWVDUHFRUUHFWVXIILFLHQWDQGFUHGLEOH
5HFRPPHQGDWLRQIRUDSSRLQWPHQWUHPXQHUDWLRQDQGWHUPVRIDSSRLQWPHQWRI$XGLWRUV
$SSURYDORISD\PHQWVWR6WDWXWRU\$XGLWRUVIRUDQ\RWKHUVHUYLFHVUHQGHUHGE\WKHP
5HYLHZLQJZLWKWKH0DQDJHPHQWWKHDQQXDO)LQDQFLDO6WDWHPHQWVDQG$XGLWRU·V5HSRUWWKHUHRQEHIRUH
VXEPLVVLRQWRWKH%RDUGIRUDSSURYDOZLWKSDUWLFXODUUHIHUHQFHWR
0DWWHUV UHTXLUHG WR EH LQFOXGHG LQ WKH 'LUHFWRU·V 5HVSRQVLELOLW\ 6WDWHPHQW WR EH LQFOXGHG LQ WKH
%RDUG·V5HSRUWLQWHUPVRI&ODXVHFRIVXEVHFWLRQRI6HFWLRQRIWKH&RPSDQLHV$FW
&KDQJHVLIDQ\LQ$FFRXQWLQJ3ROLFLHVDQGSUDFWLFHVDQGUHDVRQVIRUWKHVDPH
0DMRUDFFRXQWLQJHQWULHVLQYROYLQJHVWLPDWHVEDVHGRQWKHH[HUFLVHRIMXGJPHQWE\0DQDJHPHQW
6LJQLILFDQWDGMXVWPHQWVPDGHLQWKH)LQDQFLDO6WDWHPHQWVDULVLQJRXWRIDXGLWILQGLQJV
&RPSOLDQFHZLWK/LVWLQJDQGRWKHU/HJDOUHTXLUHPHQWVUHODWLQJWR)LQDQFLDO6WDWHPHQWV
'LVFORVXUHRIDQ\5HODWHG3DUW\7UDQVDFWLRQV
4XDOLILFDWLRQVLQWKHGUDIW$XGLW5HSRUW
5HYLHZLQJZLWKWKH0DQDJHPHQWWKHTXDUWHUO\)LQDQFLDO6WDWHPHQWVEHIRUHVXEPLVVLRQWRWKH%RDUGIRU
DSSURYDO
5HYLHZLQJZLWKWKH0DQDJHPHQWWKH6WDWHPHQWRI8VHV$SSOLFDWLRQRI)XQGVUDLVHGWKURXJKDQLVVXH
3XEOLF ,VVXH 5LJKWV ,VVXH 3UHIHUHQWLDO ,VVXH HWF WKH VWDWHPHQW RI IXQGV XWLOL]HG IRU SXUSRVHV RWKHU
WKDQWKRVHVWDWHGLQWKH2IIHU'RFXPHQW3URVSHFWXV1RWLFHDQGWKH5HSRUWVXEPLWWHGE\WKHPRQLWRULQJ
DJHQF\ PRQLWRULQJ WKH XWLOLVDWLRQ RI SURFHHGV RI D 3XEOLF RU 5LJKWV ,VVXH DQG PDNLQJ DSSURSULDWH
UHFRPPHQGDWLRQVWRWKH%RDUGWRWDNHXSVWHSVLQWKLVPDWWHU
5HYLHZDQGPRQLWRUWKH$XGLWRU·VLQGHSHQGHQFHDQGSHUIRUPDQFHDQGHIIHFWLYHQHVVRIDXGLWSURFHVV
$SSURYDORUDQ\VXEVHTXHQWPRGLILFDWLRQRIWUDQVDFWLRQVRIWKHFRPSDQ\ZLWK5HODWHG3DUWLHV
6FUXWLQ\RI,QWHU&RUSRUDWH/RDQVDQG,QYHVWPHQWV
9DOXDWLRQRIXQGHUWDNLQJVRUDVVHWVRIWKHFRPSDQ\ZKHUHYHULWLVQHFHVVDU\
(YDOXDWLRQRI,QWHUQDO)LQDQFLDO&RQWUROVDQG5LVN0DQDJHPHQW6\VWHPV
5HYLHZLQJZLWKWKH0DQDJHPHQWWKHSHUIRUPDQFHRI6WDWXWRU\DQG,QWHUQDO$XGLWRUVDGHTXDF\RIWKH
,QWHUQDO&RQWURO6\VWHPV
5HYLHZLQJ WKH DGHTXDF\ RI ,QWHUQDO $XGLW IXQFWLRQ LI DQ\ LQFOXGLQJ WKH VWUXFWXUH RI WKH ,QWHUQDO $XGLW
'HSDUWPHQWVWDIILQJDQGVHQLRULW\RIWKH2IILFLDOKHDGLQJWKHGHSDUWPHQWUHSRUWLQJVWUXFWXUHFRYHUDJH
DQGIUHTXHQF\RI,QWHUQDO$XGLW
'LVFXVVLRQZLWK,QWHUQDO$XGLWRUVRIDQ\VLJQLILFDQWILQGLQJVDQGIROORZXSWKHUHRQ
5HYLHZLQJWKHILQGLQJVRIDQ\LQWHUQDOLQYHVWLJDWLRQVE\WKH,QWHUQDO$XGLWRUVLQWRPDWWHUVZKHUHWKHUHLV
VXVSHFWHGIUDXGRULUUHJXODULW\RUDIDLOXUHRI,QWHUQDO&RQWURO6\VWHPVRIDPDWHULDOQDWXUHDQGUHSRUWLQJ
WKHPDWWHUWRWKH%RDUG
'LVFXVVLRQZLWK6WDWXWRU\$XGLWRUVEHIRUHWKHDXGLWFRPPHQFHVDERXWWKHQDWXUHDQGVFRSHRIDXGLWDV
ZHOODVSRVWDXGLWGLVFXVVLRQWRDVFHUWDLQDQ\DUHDRIFRQFHUQ
7R ORRN LQWR WKH UHDVRQV IRU VXEVWDQWLDO GHIDXOWV LQ WKH SD\PHQW WR WKH GHSRVLWRUV GHEHQWXUHKROGHUV
VKDUHKROGHUVLQFDVHRIQRQSD\PHQWRIGHFODUHGGLYLGHQGVDQGFUHGLWRUV
116
7RUHYLHZWKHIXQFWLRQLQJRIWKH:KLVWOH%ORZHU0HFKDQLVP
$SSURYDO RI DSSRLQWPHQW RI &)2 LH WKH :KROHWLPH )LQDQFH 'LUHFWRU RU DQ\ RWKHU SHUVRQ KHDGLQJ
WKH )LQDQFH IXQFWLRQ RU GLVFKDUJLQJ WKDW IXQFWLRQ DIWHU DVVHVVLQJ WKH TXDOLILFDWLRQV H[SHULHQFH DQG
EDFNJURXQGHWFRIWKHFDQGLGDWH
&DUU\LQJRXWDQ\RWKHUIXQFWLRQDVLVPHQWLRQHGLQWKHWHUPVRIUHIHUHQFHRIWKH$XGLW&RPPLWWHH
& 5HYLHZRIIROORZLQJLQIRUPDWLRQ6FRSH
0DQDJHPHQW'LVFXVVLRQDQG$QDO\VLVRIILQDQFLDOFRQGLWLRQDQGUHVXOWVRIRSHUDWLRQV
6WDWHPHQWRI6LJQLILFDQW5HODWHG3DUW\7UDQVDFWLRQVDVGHILQHGE\WKH$XGLW&RPPLWWHHVXEPLWWHGE\
0DQDJHPHQW
0DQDJHPHQW/HWWHUV/HWWHUVRI,QWHUQDO&RQWURO:HDNQHVVHVLVVXHGE\WKH6WDWXWRU\$XGLWRUV
,QWHUQDO$XGLW5HSRUWVUHODWLQJWR,QWHUQDO&RQWURO:HDNQHVVHVDQG
7KH DSSRLQWPHQW UHPRYDO DQG WHUPV RI UHPXQHUDWLRQ RI WKH &KLHI ,QWHUQDO $XGLWRU VKDOO EH VXEMHFW WR
UHYLHZE\WKH$XGLW&RPPLWWHH
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHGILYHPHPEHUVYL]0U7$QDQWKD1DUD\DQDQ&KDLUPDQ

0UV.DQFKDQ&KLWDOH0U5DQELU6LQJK%XWROD0U<DVKRGKDQ.DOHDQG0U6KDQNHU
$QQDVZDP\
0HHWLQJV 7KH&RPPLWWHHPHWVHYHQWLPHVGXULQJWKHILQDQFLDO\HDU2Q$SULO
0D\-XO\$XJXVW2FWREHU'HFHPEHU
DQG-DQXDU\
7KH$XGLW&RPPLWWHHRIWKH%RDUGLVHQWUXVWHGZLWKWKHUHVSRQVLELOLW\RIVXSHUYLVLQJWKH%DQN·VLQWHUQDO
FRQWUROV DQG ILQDQFLDO UHSRUWLQJ SURFHVV 7KH &RPSRVLWLRQ 4XRUXP DQG 7HUPV RI 5HIHUHQFH RI WKH
&RPPLWWHH DUH LQ DFFRUGDQFH ZLWK 6HFWLRQ RI WKH &RPSDQLHV $FW DQG WKH SURYLVLRQV RI
5HJXODWLRQRIWKH/LVWLQJ5HJXODWLRQV$OOPHPEHUVRIWKH$XGLW&RPPLWWHHDUHILQDQFLDOO\OLWHUDWHDQG
EULQJLQH[SHUWLVHLQWKHILHOGVRI)LQDQFH7D[DWLRQ(FRQRPLFVHWF
7KHDWWHQGDQFHGHWDLOVRIWKHPHPEHUVDUHDVXQGHU
Members Number of Meetings attended (includes Remarks

attendance through videoconference)
0U7$QDQWKD1DUD\DQDQ
0UV.DQFKDQ&KLWDOH
0U$VKRN.LQL &HDVHG WR EH 'LUHFWRU RQ
'HFHPEHU RQ
DWWDLQLQJWKHDJHRI\HDUV
0U5DQELU6LQJK%XWROD
0U<DVKRGKDQ.DOH ,QGXFWHGLQWKH&RPPLWWHHRQ
0D\
0U6KDQNHU$QQDVZDP\ 1$ ,QGXFWHGLQWKH&RPPLWWHHRQ
-DQXDU\
Committee of Directors
7HUPVRI5HIHUHQFH 7KH&RPPLWWHHRI'LUHFWRUVH[HUFLVHVSRZHUVGHOHJDWHGWRLWE\WKH%RDUGIRUPDQDJLQJWKH
DIIDLUVRIWKH%DQNIRUHIILFLHQWFRQWURORYHURSHUDWLRQDODUHDVDQGIRUHQVXULQJVSHHG\GLVSRVDO
RIPDWWHUVUHTXLULQJLPPHGLDWHDSSURYDO
117
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHGIRXUPHPEHUVYL]0U56HVKDVD\HH&KDLUPDQ0U7$QDQWKD
1DUD\DQDQ0UV.DQFKDQ&KLWDOHDQG0U5RPHVK6REWL
0HHWLQJV 7KH &RPPLWWHH PHW ILIWHHQ WLPHV GXULQJ WKH ILQDQFLDO \HDU RQ 0D\ 0D\
-XQH -XQH -XQH -XO\ 6HSWHPEHU
6HSWHPEHU1RYHPEHU'HFHPEHU'HFHPEHU-DQXDU\
)HEUXDU\0DUFKDQG0DUFK
Members Number of Meetings attended Remarks

(includes attendance through
videoconference)
0U56HVKDVD\HH
0U7$QDQWKD1DUD\DQDQ
0UV.DQFKDQ&KLWDOH
0U5RPHVK6REWL
Nomination Committee
7HUPVRIUHIHUHQFH
3XUVXDQWWR6HFWLRQDQGRWKHUDSSOLFDEOHSURYLVLRQVRIWKH&RPSDQLHV$FW5HJXODWLRQRIWKH/LVWLQJ
5HJXODWLRQV&ODXVHRIWKHHUVWZKLOH/LVWLQJ$JUHHPHQWDQGJXLGHOLQHVLVVXHGE\5%,WKH7HUPVRI5HIHUHQFHDQG
&RPSRVLWLRQRIWKH1RPLQDWLRQ&RPPLWWHHLQFOXGH
)RUPXODWLRQRIFULWHULDIRUHYDOXDWLRQRI,QGHSHQGHQW'LUHFWRUVDQGWKH%RDUG
'HYLVLQJDSROLF\RQ%RDUG'LYHUVLW\
,GHQWLI\LQJSHUVRQVZKRDUHTXDOLILHGWREHFRPH'LUHFWRUVDQGZKRPD\EHDSSRLQWHGLQ6HQLRU0DQDJHPHQW
LQDFFRUGDQFHZLWKWKHFULWHULDODLGGRZQDQGUHFRPPHQGWRWKH%RDUGWKHLUDSSRLQWPHQWDQGUHPRYDO
&RQGXFWLQJ GXH GLOLJHQFH DV WR WKH FUHGHQWLDOV RI DQ\ 'LUHFWRU EHIRUH KLV KHU DSSRLQWPHQW DQG PDNLQJ
DSSURSULDWHUHFRPPHQGDWLRQVWRWKH%RDUGLQFRQVRQDQFHZLWKWKH'U*DQJXO\&RPPLWWHHUHFRPPHQGDWLRQV
DQGWKHUHTXLUHPHQWVRI5%,
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHGWKUHHPHPEHUVYL]0UV.DQFKDQ&KLWDOH&KDLUSHUVRQ

0U56HVKDVD\HHDQG0U5DQELU6LQJK%XWROD
0HHWLQJV 7KH&RPPLWWHHPHWWKUHHWLPHVGXULQJWKHILQDQFLDO\HDU2Q$SULO0D\
DQG-DQXDU\

0UV.DQFKDQ&KLWDOH
0U56HVKDVD\HH
0U5DQELU6LQJK%XWROD ,QGXFWHG LQ WKH &RPPLWWHH RQ
0D\
0U$VKRN.LQL &HDVHG WR EH 'LUHFWRU RQ 'HFHPEHU
RQ DWWDLQLQJ WKH DJH RI
\HDUV
118
Stakeholders Relations Committee
7HUPVRI5HIHUHQFH 7KH REMHFWLYH RI WKH 6WDNHKROGHUV 5HODWLRQV &RPPLWWHH LV WKH UHGUHVVDO RI VWDNHKROGHUV·
FRPSODLQWV
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHVWZRPHPEHUVYL]0U9LMD\9DLG&KDLUPDQDQG0U5RPHVK6REWL

0HHWLQJV 7KH&RPPLWWHHPHWWZLFHGXULQJWKHILQDQFLDO\HDU2Q2FWREHUDQG0DUFK

7KH&RPSRVLWLRQDQG7HUPVRI5HIHUHQFHRIWKH&RPPLWWHHDUHLQDFFRUGDQFHZLWK6HFWLRQRIWKH&RPSDQLHV$FW
DQGWKHSURYLVLRQVRI5HJXODWLRQRIWKH/LVWLQJ5HJXODWLRQV

0U9LMD\9DLG
0U5RPHVK6REWL
'XULQJ WKH \HDU FRPSODLQWV ZHUH UHFHLYHG IURP WKH LQYHVWRUV VKDUHKROGHUV DQG DOO FRPSODLQWV KDYH EHHQ
UHVROYHGDVRQ0DUFK
Special Committee of the Board (for monitoring large value frauds)
7HUPVRI5HIHUHQFH ,QDFFRUGDQFHZLWKWKHGLUHFWLYHVRI5HVHUYH%DQNRI,QGLDD6SHFLDO&RPPLWWHHKDVEHHQVHW
XSIRUPRQLWRULQJDQGIROORZXSRIFDVHVRIIUDXGVLQYROYLQJDPRXQWVRI`FURUHDQGDERYH
&RPSRVLWLRQ 7KH &RPPLWWHH FRPSULVHV IRXU PHPEHUV YL] 0UV .DQFKDQ &KLWDOH &KDLUSHUVRQ
0U<DVKRGKDQ.DOH0U6KDQNHU$QQDVZDP\DQG0U5RPHVK6REWL


0U$VKRN.LQL &HDVHGWREH'LUHFWRURQ'HFHPEHU
RQDWWDLQLQJWKHDJHRI
\HDUV
0UV.DQFKDQ&KLWDOH
0U<DVKRGKDQ.DOH ,QGXFWHG LQ WKH &RPPLWWHH RQ 0D\

0U6KDQNHU$QQDVZDP\ ,QGXFWHG LQ WKH &RPPLWWHH RQ
-DQXDU\
0U5RPHVK6REWL
Customer Service Committee

7HUPVRIUHIHUHQFH 7KH&RPPLWWHH·VIXQFWLRQLVWRPRQLWRUWKHTXDOLW\RIFXVWRPHUVHUYLFHH[WHQGHGE\WKH%DQN
DQGWRDWWHQGWRWKHQHHGVRIFXVWRPHUV
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHVWKUHHPHPEHUVYL]0U9LMD\9DLG&KDLUPDQ0U<DVKRGKDQ.DOH
DQG0U5RPHVK6REWL
119
0HHWLQJV 7KH&RPPLWWHHPHWWZLFHGXULQJWKHILQDQFLDO\HDU2Q2FWREHUDQG)HEUXDU\


RQ DWWDLQLQJ WKH DJH RI
\HDUV
0U9LMD\9DLG

0U5RPHVK6REWL
Risk Management Committee

7HUPVRIUHIHUHQFH 7KH&RPPLWWHH·VUROHLVWRH[DPLQHULVNSROLFLHVDQGSURFHGXUHVGHYHORSHGE\WKH%DQNDQG
WRPRQLWRUDGKHUHQFHWRYDULRXVULVNSDUDPHWHUVDQGSUXGHQWLDOOLPLWVE\WKHYDULRXVRSHUDWLQJ
GHSDUWPHQWV
&RPSRVLWLRQ 7KH &RPPLWWHH FRPSULVHV IRXU PHPEHUV YL] 0U 7 $QDQWKD 1DUD\DQDQ &KDLUPDQ
0U<DVKRGKDQ.DOH0U6KDQNHU$QQDVZDP\DQG0U5RPHVK6REWL
0HHWLQJV 7KH &RPPLWWHH PHW VL[ WLPHV GXULQJ WKH ILQDQFLDO \HDU 2Q $SULO 0D\
-XO\2FWREHU-DQXDU\DQG0DUFK

RQDWWDLQLQJWKHDJHRI\HDUV
0U7$QDQWKD1DUD\DQDQ

0U6KDQNHU$QQDVZDP\ ,QGXFWHG LQ WKH &RPPLWWHH RQ -DQXDU\

0U5RPHVK6REWL
Finance Committee
7HUPVRIUHIHUHQFH 7KH &RPPLWWHH·V UROH LV WR GHFLGH RQ WKH DSSURSULDWH PRGH RI UDLVLQJ RI FDSLWDO WR ILQDOLVH
VHWWOH DSSURYH RU DJUHH WR WHUPV DQG FRQGLWLRQV LQFOXGLQJ WKH SULFLQJ IRU WKH VDLG FDSLWDO
UDLVLQJ SURJUDPPH ILQDOLVH VHWWOH DSSURYH DQG DXWKRULVH WKH H[HFXWLQJ RI DQ\ GRFXPHQW
GHHG ZULWLQJ XQGHUWDNLQJ JXDUDQWHH RU RWKHU SDSHUV LQFOXGLQJ DQ\ PRGLILFDWLRQ WKHUHRI
LQ FRQQHFWLRQ ZLWK WKH FDSLWDOUDLVLQJ SURJUDPPH DQG DXWKRULVH WKH DIIL[LQJ RI WKH &RPPRQ
6HDO RI WKH &RPSDQ\ LI QHFHVVDU\ WKHUHWR LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI $UWLFOHV RI
$VVRFLDWLRQRIWKH&RPSDQ\WRDSSRLQWDQGWRIL[WHUPVDQGFRQGLWLRQVRIPHUFKDQWEDQNHUV
LQYHVWPHQWEDQNHUVOHDGRURWKHUPDQDJHUVDGYLVRUVVROLFLWRUVDJHQWVRUVXFKRWKHUSHUVRQV
RULQWHUPHGLDULHVDVPD\EHGHHPHGQHFHVVDU\IRUWKHFDSLWDOUDLVLQJSURJUDPPHWRGRDOO
VXFKWKLQJVDQGGHDOZLWKDOOVXFKPDWWHUVDQGWDNHDOOVXFKVWHSVDVPD\EHQHFHVVDU\WRJLYH
HIIHFWWRWKHUHVROXWLRQIRUUDLVLQJRIFDSLWDODQGWRVHWWOHUHVROYHDQ\TXHVWLRQRUGLIILFXOWLHVWKDW
PD\DULVHZLWKUHJDUGWRWKHVDLGSURJUDPPH
120
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHVILYHPHPEHUVYL]0U56HVKDVD\HH&KDLUPDQ0U5DQELU6LQJK
%XWROD0U<DVKRGKDQ.DOH0U7$QDQWKD1DUD\DQDQDQG0U5RPHVK6REWL
0HHWLQJV 7KH&RPPLWWHHPHWILYHWLPHVGXULQJWKHILQDQFLDO\HDU2Q-XQH-XQH
-XQH-XO\DQG$XJXVW

0U56HVKDVD\HH
0U5DQELU6LQJK%XWROD
0U7$QDQWKD1DUD\DQDQ &RRSWHG LQ WKH &RPPLWWHH IRU WKH
PHHWLQJKHOGRQ-XO\
,QGXFWHG LQ WKH &RPPLWWHH RQ -XO\


0U5RPHVK6REWL
Compensation Committee
7HUPVRIUHIHUHQFH 7KH&RPPLWWHH·VUROHLVWRPDNHUHFRPPHQGDWLRQVRQWKHLVVXDQFHRIWKH%DQN·VVKDUHVWRLWV
HPSOR\HHVXQGHUWKH(PSOR\HHV6WRFN2SWLRQ6FKHPH
&RPSRVLWLRQ 7KH &RPPLWWHH FRPSULVHV WKUHH PHPEHUV YL] 0UV .DQFKDQ &KLWDOH &KDLUSHUVRQ
0U56HVKDVD\HHDQG0U9LMD\9DLG
0HHWLQJV 7KH&RPPLWWHHPHWWKUHHWLPHVGXULQJWKHILQDQFLDO\HDU2Q0D\-XO\
DQG-DQXDU\

0U56HVKDVD\HH
0UV.DQFKDQ&KLWDOH
0U9LMD\9DLG
Vigilance Committee
7HUPVRIUHIHUHQFH 7KH&RPPLWWHHFRQGXFWVRYHUYLHZRIFDVHVRIODSVHVRIYLJLODQFHQDWXUHRQWKHSDUWRIHPSOR\HHV
RIWKH%DQN
&RPSRVLWLRQ 7KH &RPPLWWHH FRPSULVHV WZR PHPEHUV YL] 0U 5DQELU 6LQJK %XWROD &KDLUPDQ DQG
0U5RPHVK6REWL

121

0U5DQELU6LQJK%XWROD
0U5RPHVK6REWL
I.T. Strategy Committee

7HUPVRIUHIHUHQFH 7KH &RPPLWWHH FRQGXFWV %RDUGOHYHO RYHUYLHZ RI DOLJQLQJ ,QIRUPDWLRQ 7HFKQRORJ\ ZLWK WKH
EXVLQHVV VWUDWHJ\ RI WKH %DQN DLPHG DW RIIHULQJ EHWWHU VHUYLFH WR FXVWRPHUV LPSURYHG ULVN
PDQDJHPHQWDQGVXSHULRUSHUIRUPDQFH
&RPSRVLWLRQ 7KH &RPPLWWHH FRPSULVHV WZR PHPEHUV YL] 0U 6KDQNHU $QQDVZDP\ &KDLUPDQ DQG
0U5RPHVK6REWL
0HHWLQJV 7KH &RPPLWWHH PHW IRXU WLPHV GXULQJ WKH ILQDQFLDO \HDU 2Q 0D\ -XO\
1RYHPEHUDQG0DUFK

RQDWWDLQLQJWKHDJHRI\HDUV
0U5RPHVK6REWL
0U56HVKDVD\HH $WWHQGHG &RPPLWWHH 0HHWLQJ RQ 0D\
DVDQ,QYLWHH
0U6KDQNHU$QQDVZDP\ ,QGXFWHG LQ WKH &RPPLWWHH RQ -DQXDU\

Human Resources & Remuneration Committee

7HUPVRIUHIHUHQFH
2YHUVHHLQJ WKH IUDPLQJ UHYLHZ DQG LPSOHPHQWDWLRQ RI WKH %DQN·V &RPSHQVDWLRQ 5HPXQHUDWLRQ 3ROLF\ IRU
:KROH7LPH 'LUHFWRUV &KLHI ([HFXWLYH 2IILFHUV 5LVN7DNHUV DQG &RQWURO IXQFWLRQ VWDII WRZDUGV HQVXULQJ
HIIHFWLYHDOLJQPHQWEHWZHHQUHPXQHUDWLRQDQGULVNV
'HWHUPLQLQJ RQ EHKDOI RI WKH %RDUG WKH %DQN·V 3ROLF\ RQ UHPXQHUDWLRQ SDFNDJHV IRU ([HFXWLYH 'LUHFWRUV
LQFOXGLQJEHQHILWVVXFKDV3HQVLRQHWF
)RUPXODWLRQ RI FULWHULD IRU GHWHUPLQLQJ TXDOLILFDWLRQV SRVLWLYH DWWULEXWHV DQG LQGHSHQGHQFH RI D 'LUHFWRU DQG
UHFRPPHQGWRWKH%RDUGWKH3ROLF\UHODWLQJWRUHPXQHUDWLRQRI'LUHFWRUV.H\0DQDJHULDO3HUVRQQHODQGRWKHU
7RS0DQDJHPHQWSHUVRQQHO
5HYLHZLQJRIWKH7DOHQW0DQDJHPHQWDQG6XFFHVVLRQ3ROLF\RI7RSOHYHO([HFXWLYHVLHRQHOHYHOEHORZWKH0'
&(20HPEHUVRIWKH&RUH([HFXWLYH7HDPDQGWKHSURFHVVIRUHQVXULQJEXVLQHVVFRQWLQXLW\
5HYLHZLQJRIWKH+5VWUDWHJ\3HUIRUPDQFH$SSUDLVDOSURFHVVIXQGDPHQWDOFKDQJHVLQRUJDQLVDWLRQDOVWUXFWXUH
WUDLQLQJDQGWKHRYHUDOO+5IXQFWLRQ
&RPSRVLWLRQ 7KH &RPPLWWHH FRPSULVHV IRXU PHPEHUV YL] 0U 7 $QDQWKD 1DUD\DQDQ &KDLUPDQ
0U56HVKDVD\HH0U9LMD\9DLGDQG0U5DQELU6LQJK%XWROD
0HHWLQJV 7KH&RPPLWWHHPHWWZLFHGXULQJWKHILQDQFLDO\HDU2Q0D\DQG0DUFK
122

0UV.DQFKDQ&KLWDOH 6WHSSHGGRZQIURPWKH&RPPLWWHHRQ
0D\
0U56HVKDVD\HH
0U9LMD\9DLG
0U7$QDQWKD1DUD\DQDQ 'HVLJQDWHG DV &KDLUPDQ RI WKH
&RPPLWWHHZHI0D\
0U5DQELU6LQJK%XWROD
Corporate Social Responsibility (CSR) Committee

7HUPVRIUHIHUHQFH 7KH&RPPLWWHH·VUROHLVWRHQVXUHWKDWWKH%DQNVSHQGVLQHYHU\ILQDQFLDO\HDUDWOHDVWRIWKH
$YHUDJH1HW3URILWVPDGHGXULQJWKUHHLPPHGLDWHO\SUHFHGLQJILQDQFLDO\HDUVLQSXUVXDQFHRI
LWV&653ROLF\
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHVWKUHHPHPEHUVYL]0UV.DQFKDQ&KLWDOH&KDLUSHUVRQ0U9LMD\
9DLGDQG0U5RPHVK6REWL
0HHWLQJV 7KH&RPPLWWHHPHWRQFHGXULQJWKHILQDQFLDO\HDU2Q2FWREHU
7KHFRPSRVLWLRQRI&65&RPPLWWHHLVLQFRPSOLDQFHZLWKWKHSURYLVLRQVRI6HFWLRQRIWKH&RPSDQLHV$FW
DQGWKH&RPSDQLHV&RUSRUDWH6RFLDO5HVSRQVLELOLW\3ROLF\5XOHV
7KH%DQN·V&653ROLF\LVXSORDGHGRQWKHZHEVLWHDWWKHOLQNJLYHQEHORZ
KWWSZZZLQGXVLQGFRPFRQWHQWFVUKRPHRXUDSSURDFKFVUSROLF\KWPO
Members Number of Meetings attended Remarks

(includes attendance through videoconference)
0UV.DQFKDQ&KLWDOH
RQDWWDLQLQJWKHDJHRI
\HDUV
0U9LMD\9DLG
0U5RPHVK6REWL
Review Committee - Non-cooperative Borrowers and Wilful Defaulters

7HUPVRIUHIHUHQFH 7KH &RPPLWWHH·V UROH LV WR UHYLHZ WKH GHFLVLRQ WDNHQ E\ WKH ,GHQWLILFDWLRQ &RPPLWWHH IRU
LGHQWLILFDWLRQRI1RQFRRSHUDWLYH:LOOIXO'HIDXOWHUV
&RPSRVLWLRQ 7KH&RPPLWWHHFRPSULVHVWKUHHPHPEHUVYL]0U5RPHVK6REWL&KDLUPDQ0U7$QDQWKD
1DUD\DQDQDQG0U5DQELU6LQJK%XWROD
0HHWLQJV 7KH&RPPLWWHHPHWRQFHGXULQJWKHILQDQFLDO\HDU2Q0DUFK

0U5RPHVK6REWL
0U7$QDQWKD1DUD\DQDQ
0U5DQELU6LQJK%XWROD
123
Separate meeting of Independent Directors
'XULQJ WKH \HDU XQGHU UHYLHZ D VHSDUDWH PHHWLQJ RI ,QGHSHQGHQW 'LUHFWRUV ZLWKRXW WKH DWWHQGDQFH RI 1RQ
,QGHSHQGHQW'LUHFWRUVDQGPHPEHUVRIWKH0DQDJHPHQWZDVKHOGRQ0D\DVUHTXLUHGXQGHU6FKHGXOH,9WR
WKH&RPSDQLHV$FW&RGHIRU,QGHSHQGHQW'LUHFWRUVDQG&ODXVHRIWKH/LVWLQJ$JUHHPHQW
,QWKHDIRUHVDLGPHHWLQJWKH,QGHSHQGHQW'LUHFWRUV
D 5HYLHZHGWKHSHUIRUPDQFHRI1RQ,QGHSHQGHQW'LUHFWRUVDQGWKH%RDUGDVDZKROH
E 5HYLHZHGWKHSHUIRUPDQFHRIWKH&KDLUPDQWDNLQJLQWRDFFRXQWWKHYLHZVRI1RQ([HFXWLYH'LUHFWRUVDQGWKH
:KROHWLPH'LUHFWRUDQG
F $VVHVVHG WKH TXDOLW\ TXDQWLW\ DQG WLPHOLQHVV RI IORZ RI LQIRUPDWLRQ EHWZHHQ WKH %DQN 0DQDJHPHQW DQG WKH
%RDUGWKDWLVQHFHVVDU\IRUWKH%RDUGWRHIIHFWLYHO\DQGUHDVRQDEO\SHUIRUPWKHLUGXWLHV
7KHDWWHQGDQFHGHWDLOVRIWKH,QGHSHQGHQW'LUHFWRUVDUHDVXQGHU

0U$VKRN.LQL 8QDQLPRXVO\ DSSRLQWHG &KDLUPDQ RI
WKHPHHWLQJ
0UV.DQFKDQ&KLWDOH
0U9LMD\9DLG
0U7$QDQWKD1DUD\DQDQ
0U5DQELU6LQJK%XWROD
Terms of appointment of Independent Directors

7KH 1RQ([HFXWLYH ,QGHSHQGHQW 'LUHFWRUV IXOILOO WKH FRQGLWLRQV RI LQGHSHQGHQFH VSHFLILHG LQ 6HFWLRQ RI WKH
&RPSDQLHV$FWDQG5HJXODWLRQERIWKH/LVWLQJ5HJXODWLRQV$IRUPDO/HWWHURI$SSRLQWPHQWKDVEHHQLVVXHG
WR,QGHSHQGHQW'LUHFWRUVDWWKHWLPHRIDSSRLQWPHQWDVSURYLGHGLQ&RPSDQLHV$FWDQGWKH/LVWLQJ5HJXODWLRQV
7KH7HUPVDQG&RQGLWLRQVRIDSSRLQWPHQWRI,QGHSHQGHQW'LUHFWRUVKDYHEHHQKRVWHGRQWKH%DQN·VZHEVLWHDWWKH
OLQNJLYHQEHORZ
KWWSZZZLQGXVLQGFRPLPSRUWDQWOLQNVRWKHUXVHIXOLQIRUPDWLRQKWPO
Annual Evaluation of Board Performance and Performance of its Committees and of Directors:
3XUVXDQWWRWKHSURYLVLRQVRIWKH&RPSDQLHV$FWDQGWKH6(%,5HJXODWLRQVWKH%RDUGKDVFDUULHGRXWWKHDQQXDO
HYDOXDWLRQRILWVRZQSHUIRUPDQFHSHUIRUPDQFHRILQGLYLGXDO'LUHFWRUV&KDLUPDQRIWKH%RDUGDQGWKHHYDOXDWLRQRI
WKHZRUNLQJRILWV&RPPLWWHHV
7KH 1RPLQDWLRQ &RPPLWWHH KDV GHILQHG WKH HYDOXDWLRQ FULWHULD SURFHGXUH DQG WLPH VFKHGXOH IRU WKH 3HUIRUPDQFH
(YDOXDWLRQSURFHVVIRUWKH%RDUGLWV&RPPLWWHHVDQG'LUHFWRUV
3HUIRUPDQFHRIWKH%RDUGZDVHYDOXDWHGE\WKH0HPEHUVDIWHUVHHNLQJLQSXWVIURPDOOWKH'LUHFWRUVRQWKHEDVLVRI
FULWHULDVXFKDV%RDUGFRPSRVLWLRQDQGVWUXFWXUHHIIHFWLYHQHVVRIERDUGSURFHVVHVLQIRUPDWLRQDQGIXQFWLRQLQJHWF
3HUIRUPDQFHHYDOXDWLRQRI,QGHSHQGHQW'LUHFWRUVDQGRIWKH&KDLUPDQZDVFDUULHGRXWE\WKHHQWLUH%RDUGH[FOXGLQJ
WKH 'LUHFWRU EHLQJ HYDOXDWHG 3HUIRUPDQFH HYDOXDWLRQ RI WKH 1RQ,QGHSHQGHQW 'LUHFWRUV ZDV FDUULHG RXW E\ WKH
,QGHSHQGHQW'LUHFWRUVZKRDOVRUHYLHZHGWKHSHUIRUPDQFHRIWKH%RDUGDVDZKROH3HUIRUPDQFHRIWKH&RPPLWWHHV
ZDVHYDOXDWHGE\WKH%RDUGDIWHUVHHNLQJLQSXWVIURPPHPEHUVZKRDUHQRWPHPEHUVRIWKH&RPPLWWHHRQWKHEDVLV
RI FULWHULD VXFK DV WKH FRPSRVLWLRQ RI WKH &RPPLWWHHV HIIHFWLYHQHVV RI FRPPLWWHH PHHWLQJV HWF 7KH 1RPLQDWLRQ
&RPPLWWHHDOVRUHYLHZHGWKHSHUIRUPDQFHRIWKH%RDUGLWV&RPPLWWHHVDQGWKH'LUHFWRUV
7KH &KDLUPDQ RI WKH %RDUG SURYLGHG IHHGEDFN WR WKH 'LUHFWRUV RQ DQ LQGLYLGXDO EDVLV DV DSSURSULDWH 6LJQLILFDQW
KLJKOLJKWVOHDUQLQJVDQGDFWLRQSRLQWVZLWKUHVSHFWWRWKHHYDOXDWLRQZHUHGLVFXVVHGDPRQJWKH%RDUGPHPEHUV
124
Familiarization Programme for Independent Directors
$Q DSSURSULDWH ,QGXFWLRQ 3URJUDPPH IRU QHZ 'LUHFWRUV DQG RQJRLQJ IDPLOLDUL]DWLRQ ZLWK UHVSHFW WR WKH EXVLQHVV
ZRUNLQJ RI WKH %DQN IRU DOO 'LUHFWRUV LV D PDMRU FRQWULEXWRU IRU PHDQLQJIXO %RDUG OHYHO GHOLEHUDWLRQV DQG VRXQG
EXVLQHVVGHFLVLRQV
,Q FRPSOLDQFH ZLWK WKH UHTXLUHPHQW RI WKH /LVWLQJ $JUHHPHQW ZLWK WKH 6WRFN ([FKDQJHV WKH %DQN KDV IRUPXODWHG
)DPLOLDUL]DWLRQ 3URJUDPPH IRU ,QGHSHQGHQW 'LUHFWRUV 7KH VDLG 3URJUDPPH DLPV WR SURYLGH WR WKH ,QGHSHQGHQW
'LUHFWRUVDQLQVLJKWLQWRWKH%DQN·VIXQFWLRQLQJDQGWRKHOSWKHPXQGHUVWDQGLWVEXVLQHVVLQGHSWKVRDVWRKHOSWKHP
FRQWULEXWHVLJQLILFDQWO\GXULQJWKHGHOLEHUDWLRQVLQWKH%RDUG&RPPLWWHHPHHWLQJV
)XUWKHURQDQRQJRLQJEDVLVDVDSDUWRI$JHQGDRI%RDUG&RPPLWWHH0HHWLQJVSUHVHQWDWLRQVDUHUHJXODUO\PDGHWR
WKH,QGHSHQGHQW'LUHFWRUVRQYDULRXVPDWWHUVFRYHULQJWKH%DQN·VEXVLQHVVDQG2SHUDWLRQV,QGXVWU\DQG5HJXODWRU\
XSGDWHV6WUDWHJ\)LQDQFH5LVN0DQDJHPHQWIUDPHZRUNHWF
$W WKH WLPH RI DSSRLQWLQJ D 'LUHFWRU D IRUPDO /HWWHU RI $SSRLQWPHQW LV JLYHQ WR KLP KHU ZKLFK H[SODLQV WKH UROH
IXQFWLRQGXWLHVDQGUHVSRQVLELOLWLHVH[SHFWHGRIKLPDVD'LUHFWRURIWKH%DQN
7KHGHWDLOVRIWKH)DPLOLDUL]DWLRQ3URJUDPPHIRU,QGHSHQGHQW'LUHFWRUVDUHDYDLODEOHRQWKH%DQN·VZHEVLWHDWWKHOLQN
PHQWLRQHGEHORZ
KWWSZZZLQGXVLQGFRPFRQWHQWKRPHLPSRUWDQWOLQNVIDPLOLDUL]DWLRQSURJUDPPHIRULQGHSHQGHQWGLUHFWRUVKWPO
Policy on Board Diversity
7KH%DQNKDVRYHUWKH\HDUVKDGHPLQHQWSHUVRQVIURPGLYHUVHILHOGVDV'LUHFWRUVRQLWV%RDUG
3XUVXDQW WR WKH DSSOLFDELOLW\ RI WKH UHYLVHG /LVWLQJ $JUHHPHQW ¶3ROLF\ RQ %RDUG 'LYHUVLW\· ZDV IRUPXODWHG E\ WKH
%DQN7KH%RDUG'LYHUVLW\3ROLF\VHWVRXWWKHQHFHVVLW\DQGWKHDSSURDFKWRZDUGVDFKLHYLQJGLYHUVLW\LQWKH%RDUGRI
'LUHFWRUV
7KH%DQNEHOLHYHVWKDWEHQHILWVRIDSURIHVVLRQDO%RDUGWKDWSRVVHVVHVDEDODQFHRIVNLOOVH[SHULHQFHDQGH[SHUWLVH
ZLOOHQKDQFHWKHGHFLVLRQPDNLQJSRZHURIWKH%RDUGZKLFKLQWXUQZLOOEHQHILWWKHVWDNHKROGHUVRIWKH%DQN
Policy on Related Party Transactions
$OOWUDQVDFWLRQVZLWKUHODWHGSDUWLHVZHUHLQWKHRUGLQDU\FRXUVHRIEXVLQHVVDQGRQDQDUP·VOHQJWKSULFLQJEDVLV
,Q WHUPV RI 6HFWLRQ RI WKH &RPSDQLHV $FW DQG UHTXLUHPHQWV RI WKH /LVWLQJ $JUHHPHQW WKH %DQN KDV
IRUPXODWHGLQWKH\HDUD3ROLF\RQ0DWHULDOLW\RI5HODWHG3DUW\7UDQVDFWLRQVDQGRQGHDOLQJZLWK5HODWHG
3DUW\7UDQVDFWLRQV
7KH3ROLF\RQ5HODWHG3DUW\7UDQVDFWLRQVKDVEHHQKRVWHGRQWKHZHEVLWHRIWKH%DQNDWWKHOLQNPHQWLRQHGEHORZ
KWWSZZZLQGXVLQGFRPLPSRUWDQWOLQNVRWKHUXVHIXOLQIRUPDWLRQKWPO
Strictures and Penalties
7KHUH ZHUH QR 3HQDOWLHV RU 6WULFWXUHV LPSRVHG RQ WKH %DQN E\ WKH 6WRFN ([FKDQJHV 6(%, RU DQ\ RWKHU 6WDWXWRU\
$XWKRULW\RQDQ\PDWWHUVUHODWLQJWRFDSLWDOPDUNHWVGXULQJWKHODVWWKUHH\HDUV
Vigil Mechanism / Whistle Blower Policy
7KH%DQNKDVLQSODFHD:KLVWOH%ORZHU3ROLF\WRSURYLGHDIRUPDOPHFKDQLVPWRWKH'LUHFWRUVDQGHPSOR\HHVWR
UHSRUWWKHLUFRQFHUQVDERXWXQHWKLFDOEHKDYLRXUDFWXDORUVXVSHFWHGIUDXGRUYLRODWLRQRIWKH%DQN·V&RGHRI&RQGXFW
RU (WKLFV 3ROLF\ 7KH 3ROLF\ SURYLGHV IRU DGHTXDWH VDIHJXDUGV DJDLQVW YLFWLPL]DWLRQ RI HPSOR\HHV ZKR DYDLO RI WKH
PHFKDQLVPDQGSURYLGHVIRUGLUHFWDFFHVVWRWKH&KDLUPDQRIWKH$XGLW&RPPLWWHH1RQHRIWKH%DQN·VSHUVRQQHO
KDYHEHHQGHQLHGDFFHVVWRWKH$XGLW&RPPLWWHH
7KH:KLVWOH%ORZHU3ROLF\KDVEHHQKRVWHGRQWKHZHEVLWHRIWKH%DQNDWZZZLQGXVLQGFRP
125
Details of the three previous Annual General Meetings:
AGM Day and Date Time Venue Whether Special

Resolution Passed
VW 0RQGD\$XJXVW SP +RWHO/H0HULGLHQ5DMD%DKDGXU0LOO5RDG <HV
3XQH²
WK )ULGD\-XQH SP +RWHO6XQQ6DQG%XQG*DUGHQ5RDG 1R
3XQH²
WK )ULGD\-XQH SP +RWHO/H0HULGLHQ5DMD%DKDGXU0LOO5RDG 1R
3XQH²
Special Resolutions:
7KHGHWDLOVRI6SHFLDO5HVROXWLRQVSDVVHGDWWKH$QQXDO*HQHUDO0HHWLQJVLQWKHODVWWKUHH\HDUVDUHJLYHQEHORZ
Annual General Meeting Date Resolutions
VW$QQXDO*HQHUDO0HHWLQJ $XJXVW 5HVROXWLRQ 1R 5HDSSRLQWPHQW RI 0UV .DQFKDQ
&KLWDOHDV,QGHSHQGHQW'LUHFWRU
5HVROXWLRQ 1R 5HDSSRLQWPHQW RI 0U 9LMD\ 9DLG DV
,QGHSHQGHQW'LUHFWRU
5HVROXWLRQ 1R $SSRLQWPHQW RI 0U 7 $QDQWKD
1DUD\DQDQDV,QGHSHQGHQW'LUHFWRU
5HVROXWLRQ 1R ,QFUHDVH LQ WKH $XWKRUL]HG 6KDUH
&DSLWDO DQG DOWHUDWLRQ RI WKH &DSLWDO &ODXVH RI WKH
0HPRUDQGXPRI$VVRFLDWLRQRIWKH%DQN
5HVROXWLRQ1R$OWHUDWLRQRI$UWLFOHRIWKH$UWLFOHVRI
$VVRFLDWLRQRIWKH%DQN
5HVROXWLRQ 1R %RUURZLQJ RI PRQLHV SXUVXDQW WR
6HFWLRQFRIWKH&RPSDQLHV$FWDQGRWKHU
DSSOLFDEOHSURYLVLRQV
5HVROXWLRQ 1R ,VVXH RI /RQJ 7HUP %RQGV 1RQ
FRQYHUWLEOH'HEHQWXUHVRQ3ULYDWH3ODFHPHQWEDVLV
1R6SHFLDO5HVROXWLRQKDVEHHQSDVVHGLQWKHWKDQGWK$QQXDO*HQHUDO0HHWLQJRIWKH%DQNKHOGRQ-XQH
DQG-XQHUHVSHFWLYHO\
Extraordinary General Meeting:
1R([WUDRUGLQDU\*HQHUDO0HHWLQJRIWKHPHPEHUVZDVKHOGGXULQJWKH\HDU
Postal Ballot:
Details of Resolutions passed through Postal Ballot
'XULQJWKH\HDULQDFFRUGDQFHZLWK6HFWLRQRIWKH&RPSDQLHV$FWUHDGZLWKWKH&RPSDQLHV0DQDJHPHQW
DQG$GPLQLVWUDWLRQ5XOHVFRQVHQWRIWKHPHPEHUVZDVVRXJKWE\ZD\RI3RVWDO%DOORWRQWZRRFFDVLRQVDV
PHQWLRQHGEHORZ
D 7KH%DQNKDGVHQW3RVWDO%DOORW1RWLFHGDWHG$SULOWRWKHPHPEHUVVHHNLQJWKHLUDSSURYDOWKURXJK
3RVWDO%DOORWIRUSDVVLQJWKHIROORZLQJ6SHFLDO5HVROXWLRQV
126
L ,QFUHDVHLQWKH$XWKRULVHG6KDUH&DSLWDORIWKH%DQNIURPWKHH[LVWLQJOHYHORI` FURUHVGLYLGHGLQWR
FURUHV(TXLW\6KDUHVRI` HDFKWR` FURUHVGLYLGHGLQWRFURUHV(TXLW\6KDUHVRI`HDFKZLWK
FRQVHTXHQWLDODPHQGPHQWWRWKH0HPRUDQGXPRI$VVRFLDWLRQDQG$UWLFOHVRI$VVRFLDWLRQRIWKH%DQN
DQG
LL $XJPHQWDWLRQRI&DSLWDOWKURXJKIXUWKHU,VVXH3ULYDWH3ODFHPHQWRIVHFXULWLHVLQFOXGLQJWKURXJK4XDOLILHG
,QVWLWXWLRQDO3ODFHPHQWHWFIRUXSWR(TXLW\6KDUHVRI` HDFKDWDQDJJUHJDWHLVVXHVL]H
RIQRWH[FHHGLQJ` FURUHVLQIDFHYDOXH
7KH%DQNKDGDSSRLQWHG0U61%KDQGDUL3UDFWLVLQJ&RPSDQ\6HFUHWDU\RUIDLOLQJKLP0V0DQLVKD0DKHVKZDULRI
0V%KDQGDUL $VVRFLDWHVDV6FUXWLQL]HUIRUFRQGXFWLQJWKH3RVWDO%DOORWSURFHVVLQDIDLUDQGWUDQVSDUHQWPDQQHU
7KHUHVXOWVRIWKH3RVWDO%DOORWZHUHGHFODUHGRQ-XQHDWSPDWWKH&RUSRUDWH2IILFHRIWKH%DQN7KH
6SHFLDO5HVROXWLRQVZHUHSDVVHGZLWKRYHUZKHOPLQJPDMRULW\7KHGHWDLOVRIYRWLQJDUHJLYHQEHORZ
Sr. No. Description No. of votes in Favour * No. of votes Against Total
5HVROXWLRQ1R

,QFUHDVH LQ WKH $XWKRUL]HG
6KDUH &DSLWDO DQG DOWHUDWLRQ
RI WKH &DSLWDO &ODXVH RI WKH
0HPRUDQGXPRI$VVRFLDWLRQRI
WKH%DQN
5HVROXWLRQ1R

$OWHUDWLRQ RI $UWLFOH RI WKH
$UWLFOHV RI $VVRFLDWLRQ RI WKH
%DQN
5HVROXWLRQ1R

$XJPHQWDWLRQRI6KDUH&DSLWDO
,QGXV,QG,QWHUQDWLRQDO+ROGLQJV/WGZKRZHUHKROGLQJHTXLW\VKDUHVDVRQKDGH[HUFLVHG
YRWLQJULJKWVHTXLYDOHQWWRWKHLUKROGLQJ+RZHYHULQFRPSOLDQFHZLWK6HFWLRQRIWKH%DQNLQJ5HJXODWLRQ
$FWWKHLUYRWLQJULJKWVZHUHUHVWULFWHGWRYRWHVEHLQJRIWKH%DQN·V(TXLW\&DSLWDO
E 7KH%DQNKDGVHQW3RVWDO%DOORW1RWLFHGDWHG-XQHWRWKHPHPEHUVVHHNLQJWKHLUDSSURYDOWKURXJK
3RVWDO%DOORWIRUSDVVLQJWKH6SHFLDO5HVROXWLRQIRUDOORWPHQWRIHTXLW\VKDUHVRI` HDFKWRWKH
3URPRWHUVRIWKH%DQNRQSUHIHUHQWLDOEDVLV
7KH%DQNKDGDSSRLQWHG0U61%KDQGDUL3UDFWLVLQJ&RPSDQ\6HFUHWDU\RUIDLOLQJKLP0V0DQLVKD0DKHVKZDULRI
0V%KDQGDUL $VVRFLDWHVDV6FUXWLQL]HUIRUFRQGXFWLQJWKH3RVWDO%DOORWSURFHVVLQDIDLUDQGWUDQVSDUHQWPDQQHU
7KHUHVXOWVRIWKH3RVWDO%DOORWZHUHGHFODUHGRQ-XO\DWSPDWWKH&RUSRUDWH2IILFHRIWKH%DQN7KH
6SHFLDO5HVROXWLRQZDVSDVVHGZLWKRYHUZKHOPLQJPDMRULW\7KHGHWDLOVRIYRWLQJDUHJLYHQEHORZ
Sr. No. Description No. of votes in Favour * No. of votes Against Total
$OORWPHQW RI HTXLW\
VKDUHV RQ SUHIHUHQWLDO EDVLV WR
,QGXV,QG ,QWHUQDWLRQDO +ROGLQJV
/WG ¶,,+/· DQG LWV VXEVLGLDU\
YL],QGXV,QG/WG
,QGXV,QG,QWHUQDWLRQDO+ROGLQJV/WGZKRZHUHKROGLQJHTXLW\VKDUHVDVRQKDGH[HUFLVHG
YRWLQJULJKWVHTXLYDOHQWWRWKHLUKROGLQJ+RZHYHULQFRPSOLDQFHZLWK6HFWLRQRIWKH%DQNLQJ5HJXODWLRQ
$FWWKHLUYRWLQJULJKWVKDYHEHHQUHVWULFWHGWRYRWHVEHLQJRIWKH%DQN·V(TXLW\&DSLWDO
127
Material Disclosures:
5HODWHG3DUW\7UDQVDFWLRQV'XULQJWKH\HDUWKHUHZHUHQRPDWHULDOO\VLJQLILFDQWUHODWHGSDUW\WUDQVDFWLRQVWKDWFRXOG
KDYHKDGDQ\SRWHQWLDOIRUFRQIOLFWZLWKWKHLQWHUHVWVRIWKH%DQNDWODUJH
'LVTXDOLILFDWLRQRI'LUHFWRUV$VRQ0DUFKQRQHRIWKH'LUHFWRUVRIWKH%DQNZHUHGLVTXDOLILHGXQGHU6HFWLRQ
RIWKH&RPSDQLHV$FW
'LVFUHWLRQDU\UHTXLUHPHQWVXQGHU/LVWLQJ5HJXODWLRQV7KH%DQNKDVFRPSOLHGZLWKDOOWKHGLVFUHWLRQDU\UHTXLUHPHQWV
RI&RUSRUDWH*RYHUQDQFHVWLSXODWHGXQGHU3DUW(RI6FKHGXOH9RIWKH/LVWLQJ5HJXODWLRQV&HUWLILFDWHWRWKLVHIIHFW
KDVEHHQLVVXHGE\0V%KDQGDUL $VVRFLDWHV&RPSDQ\6HFUHWDULHVDQGWKHVDPHKDVEHHQLQFRUSRUDWHGDVDQ
$QQH[XUHWRWKH'LUHFWRUV·5HSRUW
$FFRXQWLQJ6WDQGDUGV,QWKHSUHSDUDWLRQRI)LQDQFLDO6WDWHPHQWVIRUWKH\HDUWKHWUHDWPHQWSUHVFULEHGLQWKH
$FFRXQWLQJ6WDQGDUGVLVVXHGE\WKH,QVWLWXWHRI&KDUWHUHG$FFRXQWDQWVRI,QGLDIURPWLPHWRWLPHKDVEHHQIROORZHG
E\WKH%DQN
&RPSOLDQFHZLWKGLVFUHWLRQDU\UHTXLUHPHQWVXQGHU6(%,5HJXODWLRQV
7KHVWDWXVRQWKHFRPSOLDQFHZLWKWKHGLVFUHWLRQDU\UHTXLUHPHQWVLQWKH6(%,5HJXODWLRQVLVDVXQGHU
¾ 7KH&KDLUPDQKDVEHHQSURYLGHGZLWKDQRIILFHDWWKH&RUSRUDWH2IILFHRIWKH%DQN([SHQVHVLQFXUUHGE\WKH
&KDLUPDQIRUDWWHQGLQJWKHPHHWLQJVRIWKH%RDUGDQG&RPPLWWHHVKDYHEHHQUHLPEXUVHGIURPWLPHWRWLPH$V
KHLVD1RQ([HFXWLYH'LUHFWRUKHLVHQWLWOHGWRUHFHLYH6LWWLQJ)HHVIRUDWWHQGLQJWKHPHHWLQJVRIWKH%RDUGDQG
RIWKH&RPPLWWHHVRIWKH%RDUG
¾ 7KH%DQNHQGHDYRUVWRUHPDLQLQDUHJLPHRIXQTXDOLILHGILQDQFLDOVWDWHPHQWV
¾ 7KH&KDLUPDQRIWKH%RDUGLVD1RQ([HFXWLYH'LUHFWRUDQGKLVSRVLWLRQLVVHSDUDWHIURPWKDWRIWKH0DQDJLQJ
'LUHFWRU &(2
¾ 7KH,QWHUQDO$XGLWRURIWKH%DQNUHSRUWVGLUHFWO\WRWKH$XGLW&RPPLWWHH
¾ 7KH%DQNKRVWHGLWV4XDUWHUO\$QQXDO)LQDQFLDO5HVXOWVRQLWVZHEVLWHZZZLQGXVLQGFRPZKLFKLVDFFHVVLEOH

WRWKHSXEOLFDWODUJH%HVLGHVWKLVWKHILQDQFLDOUHVXOWVDUHSXEOLVKHGLQQHZVSDSHUVDSDUWIURPEHLQJUHSRUWHG
RQ WKH ZHEVLWHV RI WKH 6WRFN ([FKDQJHV 7KHUHIRUH WKH %DQN GRHV QRW ILQG LW H[SHGLHQW WR VHQG LQGLYLGXDO
FRPPXQLFDWLRQVWRWKHVKDUHKROGHUVUHJDUGLQJVLJQLILFDQWHYHQWVDQGILQDQFLDOSHUIRUPDQFHHYHU\KDOI\HDU
%HVLGHV WKH DERYH HPDLO PHVVDJHV DQG 606 PHVVDJHV ZHUH VHQW GXULQJ WKH \HDU WR VKDUHKROGHUV ZKRVH
HPDLO,'VDQGFHOOSKRQHQXPEHUVZHUHDYDLODEOHZLWKWKH%DQNLQIRUPLQJWKHPDERXWGHFODUDWLRQRIWKH%DQN·V
4XDUWHUO\DQG$QQXDO)LQDQFLDO5HVXOWV
¾ 7KH%DQNKDVFRQWLQXHGWKHH[HUFLVHRIFROOHFWLQJWKHHPDLO,'VRIVKDUHKROGHUVVRDVWRFRPPXQLFDWHPRUH
UHJXODUO\ZLWKWKHPYLDHPDLO
‘Code of Conduct for Prevention of Insider Trading’
,QDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKH6HFXULWLHVDQG([FKDQJH%RDUGRI,QGLD>3URKLELWLRQRI,QVLGHU7UDGLQJ@

5HJXODWLRQVWKH%DQNKDVIRUPXODWHGDFRPSUHKHQVLYH¶&RGHRI&RQGXFWIRU3UHYHQWLRQRI,QVLGHU7UDGLQJ·LQ
VHFXULWLHVRIWKH%DQN
7KH,QVLGHU7UDGLQJ&RGHLVDSSOLFDEOHWR3URPRWHUV'LUHFWRUV'HVLJQDWHG(PSOR\HHV&RQQHFWHG3HUVRQVDQGWR
WKHLULPPHGLDWHUHODWLYHVDVGHILQHGXQGHU&ODXVHIRIWKH6(%,3URKLELWLRQRI,QVLGHU7UDGLQJ5HJXODWLRQ
DQGWRDQ\RWKHUSHUVRQLQSRVVHVVLRQRIRUKDYLQJDFFHVVWRWKH8QSXEOLVKHG3ULFH6HQVLWLYH,QIRUPDWLRQ836,
7KH%DQNKDVVXEVFULEHGWRWKH(PSOR\HH6HOI6HUYLFH0RGXOH(660RGXOHDIXOO\DXWRPDWHGZHEEDVHGSRUWDOIRU

HQDEOLQJFRPSOLDQFHVSUHVFULEHGXQGHUWKH,QVLGHU7UDGLQJ&RGHRIWKH%DQNUHDGZLWK6(%,·V3URKLELWLRQRI,QVLGHU
7UDGLQJ5HJXODWLRQ
128
7KH(660RGXOHIDFLOLWDWHVRQOLQHGLVFORVXUHVE\WKH(PSOR\HHVRIWUDQVDFWLRQVLQWKHVKDUHVRIWKH%DQN
7KHNH\KLJKOLJKWVRIWKH,QVLGHU7UDGLQJ0RGXOHDUHDVIROORZV
D 2QOLQHVXEPLVVLRQRIGLVFORVXUHVSHUWDLQLQJWRGHDOLQJLQVKDUHVRIWKH%DQNIURPDQ\SODFH
E 0RQLWRULQJDQGUHSRUWLQJRIWUDQVDFWLRQV
F $XWRJHQHUDWLRQRI$GYDQFH$OHUWVWRHQVXUHWLPHO\UHSRUWLQJRIWUDQVDFWLRQVDQGWKHLQWLPDWLRQDERXW&ORVXUH
RI7UDGLQJ:LQGRZ
G *HQHUDWLRQRIGHWDLOHG7UDQVDFWLRQ5HSRUWV
Means of Communication
%HVLGHV FRPPXQLFDWLQJ WR WKH 6WRFN ([FKDQJHV ZKHUH WKH %DQN·V VKDUHV DUH OLVWHG WKH )LQDQFLDO 5HVXOWV RI WKH
%DQN DUH DOVR SXEOLVKHG RQ D TXDUWHUO\ EDVLV LQ OHDGLQJ ILQDQFLDO SXEOLFDWLRQV YL] ¶(FRQRPLF 7LPHV· ¶)LQDQFLDO
([SUHVV· ¶%XVLQHVV 6WDQGDUG· LQ (QJOLVK DQG D UHJLRQDO QHZVSDSHU YL] C0DKDUDVKWUD 7LPHV· LQ 0DUDWKL DW WKH
ORFDWLRQRIWKH%DQN·V5HJLVWHUHGRIILFH
4XDUWHUO\FRPSOLDQFHUHSRUWVRQ&RUSRUDWH*RYHUQDQFHDVSUHVFULEHGXQGHU5HJXODWLRQRIWKH/LVWLQJ5HJXODWLRQV
DQGWKH6KDUHKROGLQJ3DWWHUQRIWKH%DQNDVSUHVFULEHGXQGHU5HJXODWLRQRIWKH/LVWLQJ5HJXODWLRQVDUHDOVRILOHG
WKURXJK16((OHFWURQLF$SSOLFDWLRQ3URFHVVLQJ6\VWHP1($36DQG%6(/LVWLQJ&HQWUH
,QIRUPDWLRQUHODWLQJWRWKH)LQDQFLDO5HVXOWVLVDOVRKRVWHGXQGHUWKHLFRQV´0HGLD5RRPµDQG´,QYHVWRUV&RUQHUµRQ
%DQN·VZHEVLWHZZZLQGXVLQGFRP7KHVDLGVHFWLRQVDUHXSGDWHGUHJXODUO\
4XDUWHUO\ 3UHVV PHHWV DUH RUJDQL]HG GXULQJ ZKLFK WKH 5HVXOWV DUH IRUPDOO\ DQQRXQFHG WR WKH PHGLD DQG 3UHVV
5HOHDVHVDUHLVVXHG5HJXODULQWHUYLHZVZLWKWKHHOHFWURQLFFKDQQHOVRQWKHDZDUHQHVVRIUHVXOWVDQGRWKHUDYDLODEOH
RSSRUWXQLWLHVDUHDUUDQJHGIRUWKH0DQDJLQJ'LUHFWRUDQGWKH&KLHI2SHUDWLQJ2IILFHU
$QDO\VW0HHWVDQG&RQIHUHQFH&DOOVZLWKWKH$QDO\VWIUDWHUQLW\DUHDOVRKHOGSHULRGLFDOO\$WUDQVFULSWRIWKHFDOOVDQG
FRSLHVRIWKHSUHVHQWDWLRQVPDGHWR,QVWLWXWLRQDO,QYHVWRUVDQG$QDO\VWVLVKRVWHGRQWKH%DQN·VZHEVLWH
,QFRPSOLDQFHZLWKWKH/LVWLQJ5HJXODWLRQVWKH%RDUGRI'LUHFWRUVKDVDSSURYHGD´3ROLF\IRUGHWHUPLQLQJ0DWHULDOLW\
RI(YHQWV,QIRUPDWLRQµIRUWKHSXUSRVHRIPDNLQJGLVFORVXUHWRWKH6WRFN([FKDQJHV7KH%DQNKDGDOVRIRUPXODWHG
´$UFKLYDO 3ROLF\µ IRU KRVWLQJ RI 5HJXODWRU\ ,QIRUPDWLRQ 'LVFORVXUHV RQ WKH ZHEVLWH RI WKH %DQN DQG ´3ROLF\ IRU
3UHVHUYDWLRQRI'RFXPHQWVDQGRWKHU6WDWXWRU\5HFRUGVµ
$OO GLVFORVXUHV PDGH WR WKH 6WRFN ([FKDQJHV DUH DOVR DYDLODEOH RQ WKH &RPSDQ\·V ZHEVLWH XQGHU WKH KHDGLQJ
¶$QQRXQFHPHQWV·
7KH0DQDJHPHQW'LVFXVVLRQDQG$QDO\VLVUHSRUWIRUIRUPVSDUWRIWKLV$QQXDO5HSRUW
Subsidiary Company
7KH%DQNGRHVQRWKDYHD´PDWHULDOQRQOLVWHG,QGLDQVXEVLGLDU\µ+RZHYHU$/),QVXUDQFH6HUYLFHV3ULYDWH/WGLVD
ZKROO\RZQHGVXEVLGLDU\RIWKH%DQN7KH&RPSDQ\ZDVVHWXSWRGRWKHEXVLQHVVRI,QVXUDQFH&RUSRUDWH%URNLQJ
DQGLVFXUUHQWO\XQGHUYROXQWDU\ZLQGLQJXS7KH/LTXLGDWRUKDVUHSDLGWKHHQWLUH6KDUH&DSLWDORQ)HEUXDU\
DQGWKHIRUPDOLWLHVIRUVWULNLQJRIIWKHQDPHRIWKH&RPSDQ\DUHLQSURJUHVV
Business Responsibility Report
7KH6HFXULWLHV ([FKDQJH%RDUGRI,QGLDYLGHWKHLU&LUFXODURI$XJXVWKDYHPDQGDWHGWKDWWRSHQWLWLHV
OLVWHGLQ%6(DQG16(EDVHGRQPDUNHWFDSLWDOLVDWLRQVKRXOGLQFRUSRUDWHWKH¶%XVLQHVV5HVSRQVLELOLW\5HSRUW·DV
SDUWRIWKHLU$QQXDO5HSRUWV
3XUVXDQWWRQRWLILFDWLRQRI6(%,/LVWLQJ2EOLJDWLRQVDQG'LVFORVXUH5HTXLUHPHQWV5HJXODWLRQVWKHDIRUHVDLG
&LUFXODUGDWHG$XJXVWZDVUHVFLQGHG+RZHYHU5HJXODWLRQIRI/LVWLQJ5HJXODWLRQVUHDGZLWK6(%,
129
&LUFXODUGDWHG1RYHPEHUUHTXLUHVWKDWWKH$QQXDO5HSRUWRIWRS/LVWHG(QWLWLHVVKDOOFRQWDLQD%XVLQHVV
5HVSRQVLELOLW\ 5HSRUW %55 GHVFULELQJ WKH LQLWLDWLYHV WDNHQ E\ WKH OLVWHG HQWLW\ IURP DQ HQYLURQPHQWDO VRFLDO DQG
JRYHUQDQFHSHUVSHFWLYHLQWKHIRUPDWDVVSHFLILHGE\WKH%RDUG
6HFXULWLHV DQG ([FKDQJH %RDUG RI ,QGLD 6(%, YLGH &LUFXODU QR &,5&)'&0' GDWHG 1RYHPEHU
KDYHSUHVFULEHGDUHYLVHGIRUPDWRIWKH%XVLQHVV5HVSRQVLELOLW\5HSRUW%557KHVDLGGLVFORVXUHKDVEHHQSURYLGHG
LQWKH'LUHFWRUV·5HSRUWDVDQ$QQH[XUH
Corporate Social Responsibility
7KH%DQNKDVFRQVWLWXWHGD¶&RUSRUDWH6RFLDO5HVSRQVLELOLW\·&RPPLWWHHRIWKH%RDUGLQOLQHZLWKWKH&RPSDQLHV$FW
,QWKHVHFRQG\HDURI&65UHSRUWLQJXQGHUWKHVWDWXWHRIWKH&RPSDQLHV$FWWKH%DQNKDVDPSOLILHG
LWV LQLWLDWLYHV LQWR DYHQXHV RI SUHYHQWLYH KHDOWKFDUH HGXFDWLRQ VDQLWDWLRQ ZRPHQ HPSRZHUPHQW VSRUWV DQG
HQYLURQPHQWDOFRQVHUYDWLRQ
Sustainability-driven Growth
6XVWDLQDELOLW\ LV DQ LQWHJUDO SDUW RI WKH %DQN·V RSHUDWLRQV 7KH %DQN KDV IRFXVHG RQ GHOLYHULQJ DQG LPSURYLQJ LWV
UHVSRQVLELOLW\WRWKHHQYLURQPHQWDQGVRFLHW\ZKLOHDEVRUELQJWKHUDSLGO\GHYHORSLQJWHQHWVRIVXVWDLQDELOLW\7KH%DQN
UHDFKHGOHDGHUVKLSSRVLWLRQLQ&DUERQ'LVFORVXUH3URMHFWLQ
Statutory Reporting:
7KH %XVLQHVV 5HVSRQVLELOLW\ 5HSRUW %55 DWWDFKHG DV DQ $QQH[XUH WR WKH 'LUHFWRUV· 5HSRUW LV JRYHUQHG E\ WKH
SULQFLSOHVSUHVFULEHGXQGHU$QQH[XUH,,WRWKH6(%,&LUFXODUGDWHG1RYHPEHULH´7RDVVHVVFRPSOLDQFHZLWK
HQYLURQPHQWDOVRFLDODQGJRYHUQDQFHQRUPVµ7KHNH\SULQFLSOHVSUHVFULEHGE\6(%,DUHDVXQGHU
3ULQFLSOH %XVLQHVVHVVKRXOGFRQGXFWDQGJRYHUQWKHPVHOYHVZLWK(WKLFV7UDQVSDUHQF\DQG$FFRXQWDELOLW\
3ULQFLSOH %XVLQHVVHVVKRXOGSURYLGHJRRGVDQGVHUYLFHVWKDWDUHVDIHDQGFRQWULEXWHWRVXVWDLQDELOLW\WKURXJKRXW
WKHLUOLIHF\FOH
3ULQFLSOH %XVLQHVVHVVKRXOGSURPRWHWKHZHOOEHLQJRIDOOHPSOR\HHV
3ULQFLSOH %XVLQHVVHV VKRXOG UHVSHFW WKH LQWHUHVWV RI DQG EH UHVSRQVLYH WRZDUGV DOO VWDNHKROGHUV HVSHFLDOO\
WKRVHZKRDUHGLVDGYDQWDJHGYXOQHUDEOHDQGPDUJLQDOL]HG
3ULQFLSOH %XVLQHVVHVVKRXOGUHVSHFWDQGSURPRWHKXPDQULJKWV
3ULQFLSOH %XVLQHVVVKRXOGUHVSHFWSURWHFWDQGPDNHHIIRUWVWRUHVWRUHWKHHQYLURQPHQW
3ULQFLSOH %XVLQHVVHVZKHQHQJDJHGLQLQIOXHQFLQJSXEOLFDQGUHJXODWRU\SROLF\VKRXOGGRVRLQDUHVSRQVLEOH
PDQQHU
3ULQFLSOH %XVLQHVVHVVKRXOGVXSSRUWLQFOXVLYHJURZWKDQGHTXLWDEOHGHYHORSPHQW
3ULQFLSOH %XVLQHVVHVVKRXOGHQJDJHZLWKDQGSURYLGHYDOXHWRWKHLUFXVWRPHUVDQGFRQVXPHUVLQDUHVSRQVLEOH
PDQQHU
:LWKWKHLPSOHPHQWDWLRQRIWKH&RPSDQLHV$FWFRPSDQLHVFDQVHQG$QQXDO5HSRUWVDQGRWKHUFRPPXQLFDWLRQV
WKURXJKHOHFWURQLFPRGHWRWKRVHVKDUHKROGHUVZKRKDYHUHJLVWHUHGWKHLUHPDLODGGUHVVHVZLWKWKH%DQNRUPDGH
DYDLODEOHE\WKH'HSRVLWRU\
7KHIXOOWH[WRIWKHVHUHSRUWVVKDOODOVREHPDGHDYDLODEOHLQDQHDVLO\QDYLJDEOHIRUPDWRQWKH%DQN·VZHEVLWHZZZ
LQGXVLQGFRP
General Information for Shareholders:
Registration No.
CIN /313/&
Financial Year
Board meeting for adoption of Audited Financial Accounts $SULO
Posting of Annual Report 2015-16 -XQH
Day, Date and Time of 22nd Annual General Meeting )ULGD\-XO\DWSP
130
Venue +RWHO/H0HULGLHQ3XQH
Financial Calendar $SULOWR0DUFK
Book Closure 6DWXUGD\-XQHWR)ULGD\-XO\
Date of Dividend Payment 2QRUDIWHU-XO\
Bank’s Website ZZZLQGXVLQGFRP
Address for Correspondence 0U+DUHVK*DMZDQL
&RPSDQ\6HFUHWDU\
,QGXV,QG%DQN/LPLWHG
6ROLWDLUH&RUSRUDWH3DUN
*XUX+DUJRYLQGML0DUJ
$QGKHUL(DVW
0XPEDL²
7HO
(PDLOFRPSDQ\VHFUHWDU\#LQGXVLQGFRP
Distribution of shareholding as on March 31, 2016
Range – Shares No. of Folios Percentage of Folios No. of shares Percentage of Shares
8SWR

²
DERYH
TOTAL 1,13,163 100.00 59,49,86,335 100.00
Outstanding GDRs / ADRs / Warrants or any Convertible Debentures, conversion date and likely impact on
equity.
7KH%DQNKDV*'5VHTXLYDOHQWWRHTXLW\VKDUHVRXWVWDQGLQJZKLFKFRQVWLWXWHGRI
WKH%DQN·VWRWDOHTXLW\FDSLWDODVDW0DUFK
Disclosure of Commodity Price Risk or Foreign Exchange Risk and Hedging activities
7KH%DQNKDVSXWLQSODFHWKH%RDUGDSSURYHG0DUNHW5LVN0DQDJHPHQW3ROLF\ZKLFKSUHVFULEHVFRPSUHKHQVLYHULVN
PDQDJHPHQWWHFKQLTXHVDQGULVNFRQWUROOLPLWVVXFKDV9DOXHDW5LVN9D5$JJUHJDWH*DS/LPLW$*/6WRS/RVV
/LPLW1HW2YHUQLJKW2SHQ3RVLWLRQOLPLW1223WRFRQWURODQGPDQDJHWKHIRUHLJQH[FKDQJHULVN
%DQNKDVQRWXQGHUWDNHQDQ\FRPPRGLW\SULFHULVNGXULQJWKHSHULRG
7KH%DQNKHGJHVWKH&XUUHQF\5LVNLQLWV%DODQFH6KHHWWKURXJKGHULYDWLYHVLQFOXGLQJIRUH[)RUZDUGVDQG6ZDSV
7KH%DQNPDQDJHVWKH&XUUHQF\5LVNRQH[SRVXUHVGXHWRFOLHQWVHUYLFLQJDQGSURSULHWDU\WUDGLQJLQFRPSOLDQFHZLWK
RYHUDOOULVNFRQWUROIUDPHZRUNDQGOLPLWVSUHVFULEHGXQGHU)XQGVDQG,QYHVWPHQW3ROLF\DQG0DUNHW5LVN0DQDJHPHQW
3ROLF\DSSURYHGE\WKH%RDUG
Shareholding as on March 31, 2016

i. Distribution of shareholding
Category No. of shares held % of shareholding

A. Promoters’ holding 8,86,81,344 14.90
B. Non-Promoters’ holding
131
Category No. of shares held % of shareholding
L ,QVWLWXWLRQDO,QYHVWRUV
D 0XWXDO)XQGVDQG87,
E %DQNV)LQDQFLDO,QVWLWXWLRQV,QVXUDQFH&RPSDQLHV
&HQWUDO6WDWH*RY,QVWLWXWLRQV1RQJRYHUQPHQW
,QVWLWXWLRQV
F ),,V)RUHLJQ3RUWIROLR,QYHVWRU
Sub Total 32,55,58,705 54.72
LL *OREDO'HSRVLWRU\5HFHLSWV
LLL 2WKHUV
D 3ULYDWH&RUSRUDWH%RGLHV
E ,QGLDQ3XEOLF
F 15,V2&%V)RUHLJQ1DWLRQDOV
G &OHDULQJ0HPEHUV
H 7UXVWV
I +LQGX8QGLYLGHG)DPLO\
Sub Total 11,60,64,722 19.51
GRAND TOTAL 59,49,86,335 100.00
¶,QGLDQ3XEOLF·LQFOXGHVVKDUHVKHOGE\5HVLGHQW'LUHFWRUV
ii. Major Shareholders (with more than 1 percent shareholding)
Sr. Name of Shareholder No. of shares held % of shareholding

No.
,QGXV,QG,QWHUQDWLRQDO+ROGLQJV/WG
7KH%DQNRI1HZ<RUN0HOORQ*'5'HSRVLWRU\
,QGXV,QG/LPLWHG
%ULGJH,QGLD)XQG
*$*OREDO,QYHVWPHQWV/LPLWHG
+LQGXMD9HQWXUHV/LPLWHG
$IULQ'LD
)UDQNOLQ7HPSOHWRQ0XWXDO)XQG$F)UDQNOLQ,QGLD3ULPD3OXV
*ROGPDQ6DFKV,QYHVWPHQWV0DXULWLXV,/WG
+LQGXMD*URXS/LPLWHG
)UDQNOLQ7HPSOHWRQ,QYHVWPHQW)XQGV
87,²(TXLW\)XQG
,&,&,3UXGHQWLDO/LIH,QVXUDQFH&RPSDQ\/WG
132
Sr. Name of Shareholder No. of shares held % of shareholding
No.
%LUOD6XQ/LIH7UXVWHH&RPSDQ\3ULYDWH/LPLWHG$&%LUOD6XQ
/LIH)URQWOLQH(TXLW\)XQG
1RUZHVW9HQWXUH3DUWQHUV;),,0DXULWLXV
'9,)XQG0DXULWLXV/WG
'63%ODFNURFN7RS(TXLW\)XQG
0DFTXDULH(PHUJLQJ0DUNHWV$VLDQ7UDGLQJ3WH/WG
7LDD&UHI)XQGV7LDD&UHI,QWHUQDWLRQDO(TXLW\)XQG
+')&6WDQGDUG/LIH,QVXUDQFH&RPSDQ\/LPLWHG
iii. Total Foreign Shareholding

No. of shares held % of shareholding
7RWDO)RUHLJQ6KDUHKROGLQJ
RIZKLFK*'5V
Details of complaints received and resolved from April 1, 2015 to March 31, 2016
Complaints Received Attended to Pending

1RQ5HFHLSWRI6KDUH&HUWLILFDWH
1RQ5HFHLSWRI'LYLGHQG:DUUDQWV
1RQ5HFHLSWRI(QGRUVHPHQW6WLFNHUV
1RQ5HFHLSWRI$QQXDO5HSRUW
1RQ5HFHLSWRI'HPDW&UHGLW5HPDW&HUWLILFDWH
1RQ5HFHLSWRI5HMHFWHG'5)
1RQ5HFHLSWRI([FKDQJHG&HUWLILFDWH
1RQ5HFHLSWRI6SOLW'XSOLFDWH5HSODFHPHQW&HUWLILFDWH
2WKHUV
Total 156 156 0
Listing details of the Bank’s Equity Shares / *Bonds / GDRs on Stock Exchanges
Name of the Stock Exchange Address of the Stock Exchange Stock Code No.
%RPED\6WRFN([FKDQJH/WG 3KLUR]H -HHMHHEKR\ 7RZHUV 'DODO 6WUHHW
0XPEDL
1DWLRQDO 6WRFN ([FKDQJH RI WK )ORRU ([FKDQJH 3OD]D %DQGUD.XUOD ,1'86,1'%. 1RUPDO ² (4
,QGLD/WG &RPSOH[3ORW1R&*%ORFN%DQGUD( 3K\VLFDO
0XPEDL
/X[HPERXUJ6WRFN([FKDQJH 6RFLpWpGHOD%RXUVHGH/X[HPERXUJ
*OREDO'HSRVLWRU\5HFHLSWV 6RFLHWH$QRQ\PH
5&/X[HPERXUJ%
133
7KH%DQNKDVSDLG $QQXDO/LVWLQJ)HHVRQLWVFDSLWDOIRUWKHUHOHYDQWSHULRG WR%RPED\6WRFN([FKDQJH/WGDQG
1DWLRQDO6WRFN([FKDQJHRI,QGLD/WGZKHUHLWVVKDUHVDUHOLVWHGDQGWR/X[HPERXUJ6WRFN([FKDQJHZKHUHLWV*OREDO
'HSRVLWRU\5HFHLSWVDUHOLVWHG
%RQGVDUHOLVWHGRQWKH1DWLRQDO6WRFN([FKDQJHRI,QGLD/WG
Market Price Data of the Bank’s shares

i. National Stock Exchange of India Ltd.
Date Price of Shares Turnover in Nifty Bank Nifty

Open (`) High (`) Low (`) Close (`) ` Lakhs
$SU

0D\
-XQ
-XO
$XJ
6HS
2FW
1RY
'HF
-DQ
)HE
0DU
0DU
30000 35000
30000
25000
25000
20000 Turnover
20000
Niy (`Lakhs)
15000 15000
Bank Niy Price
10000
10000 Price
5000
5000 0
0
Apr-15 May-15 Jun-15 Jul-15 Aug-15 Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16 Mar-16 Mar-16
(Actual values of indices have been retained in the graph whereas the price has been (Actual values of trade has been retained in the graph while the price has been factored
factored for the purpose of comparison. The prices have been mulplied by 25). for the purpose of comparision. The prices have been mullplied by
ii. Bombay Stock Exchange Ltd.

Date Price of Shares Turnover in SENSEX BANKEX
$SU
0D\
-XQ
-XO
$XJ
6HS
134
Date Price of Shares Turnover in SENSEX BANKEX
2FW
1RY
'HF
-DQ
)HE
0DU
0DU
30000 1200
25000 1000
20000
800
SENSEX
15000
BANKEX 600
10000 Turnover (` Lakhs)
Price Price
5000 400
0 200
Apr-15 May-15 Jun-15 Jul-15 Aug-15 Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16 Mar-16 Mar-16
0
(Actual values of indices have been retained in the graph whereas the price has been factored
for the purpose of comparison. The prices have been multiplied by 25)
Dematerialisation of shares and liquidity

7KH%DQN·VVKDUHVDUHWUDGDEOHLQHOHFWURQLFIRUPRQO\DWWKH%RPED\6WRFN([FKDQJH/WGDQGWKH1DWLRQDO6WRFN
([FKDQJH RI ,QGLD /WG RI WKH %DQN·V VKDUHV DUH LQ GHPDWHULDOLVHG IRUP DQG WKH UHVW DUH LQ SK\VLFDO IRUP
'HWDLOVRIWKHVDPHDUHJLYHQEHORZ7KHYROXPHRIWUDGHVDQGVKDUHSULFHLQIRUPDWLRQLVSURYLGHGLQWKHWDEOHVDERYH
Particulars No. of Shares Percentage (%)

,Q'HPDWHULDOLVHGIRUP
,Q3K\VLFDOIRUP
Total 59,49,86,335 100
,QYLHZRIWKHQXPHURXVDGYDQWDJHVRIIHUHGE\WKH'HSRVLWRU\V\VWHPPHPEHUVKROGLQJWKHVKDUHVRIWKH%DQNLQ
SK\VLFDOIRUPDUHUHTXHVWHGWRJHWWKHVDPHGHPDWHULDOLVHGDQGFRQYHUWHGWRWKHHOHFWURQLFIRUP
Share Transfer System
7KH6KDUH7UDQVIHU&RPPLWWHHFRPSULVLQJ%DQN·V([HFXWLYHVKDVEHHQFRQVWLWXWHGWRGHDOZLWKWUDQVIHURIVKDUHV
LVVXHRI'XSOLFDWH6KDUH&HUWLILFDWHVLQOLHXRIPXWLODWHG6KDUH&HUWLILFDWHVRUWKRVHZKLFKDUHPLVSODFHGORVWDQGRWKHU
UHODWHGPDWWHUV$SSURYDOVJUDQWHGE\WKH6KDUH7UDQVIHU&RPPLWWHHDUHFRQILUPHGDWVXEVHTXHQW%RDUGPHHWLQJV
:LWKDYLHZWRH[SHGLWLQJWKHSURFHVVRISK\VLFDOVKDUHWUDQVIHUVWKH6KDUH7UDQVIHU&RPPLWWHHPHHWVHYHU\)ULGD\
7UDGLQJLQWKH%DQN·VVKDUHVQRZWDNHVSODFHFRPSXOVRULO\LQGHPDWHULDOLVHGIRUP+RZHYHUPHPEHUVKROGLQJVKDUH
FHUWLILFDWHV LQ SK\VLFDO IRUP DUH HQWLWOHG WR WUDQVIHU WKHLU VKDUHKROGLQJ E\ IRUZDUGLQJ WKH 6KDUH &HUWLILFDWHV DORQJ
ZLWKGXO\H[HFXWHGDQGVWDPSHG6HFXULWLHV7UDQVIHU)RUP)RUP1R6+DVSHUWKHIRUPDWSUHVFULEHGXQGHUWKH
&RPSDQLHV 6KDUH &DSLWDO DQG 'HEHQWXUHV 5XOHV VLJQHG E\ WKH PHPEHU RU RQ KLV KHU EHKDOI DQG WKH
WUDQVIHUHHWRWKH%DQNRUWRWKH5HJLVWUDU 6KDUH7UDQVIHU$JHQW/LQN,QWLPH,QGLD3YW/WG
Standardization and simplification of procedure for transmission of securities
,Q FRPSOLDQFH ZLWK WKH JXLGHOLQHV LVVXHG E\ 6(%, UHJDUGLQJ VWDQGDUGL]DWLRQ DQG VLPSOLILFDWLRQ RI SURFHGXUHV IRU
WUDQVPLVVLRQRIVHFXULWLHVWKH%DQN·V%RDUGKDVHPSRZHUHGWKH6KDUH7UDQVIHU&RPPLWWHHIRUDSSURYLQJWUDQVPLVVLRQ
RIVHFXULWLHVKHOGLQSK\VLFDOPRGHIRUPDUNHWYDOXHRIVHFXULWLHVRIXSWR` 5XSHHV7HQODNKVRQO\VXEMHFW
WRFRPSOHWLRQRIVLPSOLILHGGRFXPHQWDWLRQSURFHGXUHSUHVFULEHGE\6(%,
135
Share Capital Audit
3XUVXDQWWR5HJXODWLRQRIWKH6(%,/LVWLQJ2EOLJDWLRQVDQG'LVFORVXUH5HTXLUHPHQWV5HJXODWLRQV&ODXVH
FRIWKHHUVWZKLOH/LVWLQJ$JUHHPHQWWKH3UDFWLVLQJ&RPSDQ\6HFUHWDU\KDVH[DPLQHGWKHUHFRUGVUHODWLQJWR
6KDUH7UDQVIHU'HHGV5HJLVWHUVDQGRWKHUUHODWHGGRFXPHQWVRQDKDOI\HDUO\EDVLVDQGKDVFHUWLILHGFRPSOLDQFHZLWK
WKHSURYLVLRQVRIWKHDERYH&ODXVH7KH&HUWLILFDWHVDUHIRUZDUGHGWR%6(DQG16(ZKHUHWKH%DQN·VHTXLW\VKDUHV
DUHOLVWHG
$VUHTXLUHGE\6(%,6KDUH&DSLWDO$XGLWLVFRQGXFWHGE\D3UDFWLVLQJ&RPSDQ\6HFUHWDU\,QGHSHQGHQW([WHUQDO
$XGLWRU RQ D TXDUWHUO\ EDVLV IRU WKH SXUSRVH RI UHFRQFLOLDWLRQ RI WKH WRWDO DGPLWWHG (TXLW\ 6KDUH &DSLWDO ZLWK WKH
'HSRVLWRULHV YL] 1DWLRQDO 6HFXULWLHV 'HSRVLWRU\ /LPLWHG 16'/ DQG &HQWUDO 'HSRVLWRU\ 6HUYLFHV ,QGLD /LPLWHG
&'6/DQGLQWKHSK\VLFDOIRUPZLWKWKHWRWDO,VVXHG3DLGXS(TXLW\&DSLWDORIWKH%DQN7KH$XGLWRU·V&HUWLILFDWHLQ
WKLVUHJDUGKDVEHHQVXEPLWWHGWR%6(/LPLWHGDQGWKH1DWLRQDO6WRFN([FKDQJHRI,QGLD/LPLWHG
Consolidation of Folios
6KDUHKROGHUV KROGLQJ VKDUHV LQ GLIIHUHQW )ROLRV EXW LQ LGHQWLFDO QDPHV DUH UHTXHVWHG WR JHW WKHLU VKDUHKROGLQJV
FRQVROLGDWHGLQWRRQHIROLRE\UHTXHVWLQJWKH%DQN5HJLVWUDUIRUWKHVDPH7KHUHTXHVWPD\SOHDVHEHDFFRPSDQLHG
ZLWK3URRIRI,GHQWLW\DQGWKH6KDUH&HUWLILFDWHV
5HJLVWUDU 6KDUH7UDQVIHU$JHQW
/LQN,QWLPH,QGLD3YW/WG
&3DQQDODO6LON0LOOV&RPSRXQG
/%60DUJ%KDQGXS:HVW
0XPEDL²
&RQWDFW3HUVRQ0U0DKHVK0DVXUNDU
7HO)D[
(PDLOUQWKHOSGHVN#OLQNLQWLPHFRLQ
Redressal of Investors’ Grievances
,QRUGHUWRVHUYLFHWKHLQYHVWRUVLQDQHIILFLHQWPDQQHUDQGWRDWWHQGWRWKHLUJULHYDQFHVWKH%DQNKDVFRQVWLWXWHGDQ
¶,QYHVWRU6HUYLFHV&HOO·DWLWVXQGHUPHQWLRQHG2IILFHDW0XPEDL0HPEHUVDUHUHTXHVWHGWRFRQWDFW
Mr. Raghunath Poojary
,QYHVWRU6HUYLFHV&HOO
,QGXV,QG%DQN/WG
6ROLWDLUH&RUSRUDWH3DUN
*XUX+DUJRYLQGML0DUJ
$QGKHUL(DVW0XPEDL
7HO)D[
(PDLOLQYHVWRU#LQGXVLQGFRP
Dividends
Receipt of dividend through Electronic mode
6KDUHKROGHUVFDQRSWIRUUHFHLYLQJGLYLGHQGFUHGLWGLUHFWO\LQWRWKHLU%DQNDFFRXQWVE\ZD\RIXSGDWLQJWKHLU%DQN
$FFRXQWGHWDLOVZLWKWKH'HSRVLWRU\3DUWLFLSDQW'3LQFDVHWKHVKDUHVDUHKHOGLQGHPDWPRGHRUZLWKWKH5HJLVWUDU
6KDUH7UDQVIHU$JHQWYL]/LQN,QWLPH,QGLD3YW/WGLQFDVHWKHVKDUHVDUHKHOGLQSK\VLFDOIRUP
136
7RDYDLORIWKLVIDFLOLW\VKDUHKROGHUVFDQDSSURDFKWKHLU'3VRUVHQGDUHTXHVWOHWWHUWRWKH5HJLVWUDU 6KDUH7UDQVIHU
$JHQWYL]/LQN,QWLPH,QGLD3YW/WGGXO\VLJQHGE\WKHVKDUHKROGHUVPHQWLRQLQJSDUWLFXODUVRI%DQN$FFRXQW)ROLR
1RDQGDWWDFKLQJVHOIDWWHVWHGFRSLHVRI3$1&DUG5HVLGHQFHSURRIQRWROGHUWKDQWZRPRQWKVFDQFHOOHGFKHTXH
OHDIDORQJZLWKVLJQDWXUHDWWHVWDWLRQOHWWHUIURPWKHLU%DQN
Unclaimed Dividend
$V SHU WKH DSSOLFDEOH SURYLVLRQV RI WKH &RPSDQLHV $FW WKH %DQN LV VWDWXWRULO\ UHTXLUHG WR WUDQVIHU WR WKH ,QYHVWRU
(GXFDWLRQ 3URWHFWLRQ)XQG,(3)DOOGLYLGHQGVUHPDLQLQJXQFODLPHGIRUDSHULRGRIVHYHQ\HDUVIURPWKHGDWHRI
WUDQVIHUWRWKH8QSDLG'LYLGHQG$FFRXQW2QFHVXFKDPRXQWVDUHWUDQVIHUUHGWR,(3)QRFODLPRIWKHVKDUHKROGHUVKDOO
OLHDJDLQVWWKH%DQNRUWKH,(3)
'LYLGHQGVIRUDQGXSWRWKHILQDQFLDO\HDUHQGHG0DUFKKDYHDOUHDG\EHHQWUDQVIHUUHGWR¶,(3)·
'HWDLOVRIXQFODLPHGGLYLGHQGVIRUWKHILQDQFLDO\HDURQZDUGVDQGWKHODVWGDWHIRUFODLPLQJWKHGLYLGHQGIRU
UHVSHFWLYH\HDUVDUHJLYHQLQWKHWDEOHEHORZ0HPEHUVDUHUHTXHVWHGWRWDNHQRWHRIVXFKGXHGDWHVDQGFODLPWKH
XQSDLGGLYLGHQGVZHOOLQDGYDQFHRIWKHGXHGDWHLHEHIRUHWKHH[SLU\RIWKHVHYHQ\HDUSHULRG
Year Type of Dividend Date of declaration of Dividend Due date for availing unclaimed
Dividend
)LQDO -XO\ $XJXVW
)LQDO -XQH $XJXVW
)LQDO -XO\ $XJXVW
)LQDO -XO\ $XJXVW
)LQDO -XQH $XJXVW
)LQDO -XQH $XJXVW
)LQDO $XJXVW 6HSWHPEHU
Unclaimed Shares
3XUVXDQWWR5HJXODWLRQRIWKH/LVWLQJ5HJXODWLRQVHUVWZKLOH&ODXVH$RIWKH/LVWLQJ$JUHHPHQWHQWHUHGLQWR
ZLWKWKH6WRFN([FKDQJHVWKH%DQNKDGVHQWWKUHH5HPLQGHU/HWWHUVLQUHVSHFWRIXQFODLPHGVKDUHVWRVKDUHKROGHUV
DWWKHDGGUHVVHVDYDLODEOHLQWKH%DQN·VUHFRUGLQFRRUGLQDWLRQZLWK/LQN,QWLPH,QGLD3YW/WGWKH%DQN·V5HJLVWUDU
6KDUH7UDQVIHU$JHQWV$IWHUFRQVLGHULQJWKHUHTXHVWVUHFHLYHGLQWKLVUHJDUGWKHXQFODLPHGVKDUHVZHUHWUDQVIHUUHG
WRWKH´8QFODLPHG6XVSHQVH$FFRXQWµ
7KHYRWLQJULJKWVRQWKHVKDUHVRXWVWDQGLQJLQWKH´8QFODLPHG6XVSHQVH$FFRXQWµDVRQ0DUFKVKDOOUHPDLQ
IUR]HQWLOOWKHULJKWIXORZQHURIVXFKVKDUHVFODLPVWKHVKDUHV
$VRQ0DUFKVKDUHVZHUHO\LQJXQFODLPHGLQWKH´8QFODLPHG6XVSHQVH$FFRXQWµDVSHUWKHGHWDLOV
JLYHQEHORZ
Particulars Folios Shares

2SHQLQJ%DODQFH
$GG7UDQVIHUGXULQJWKH\HDU
/HVV&ODLPUHFHLYHGDQGVKDUHVWUDQVIHUUHG
&ORVLQJ%DODQFHDVRQ0DUFK
137
Independent Auditor’s Report
To the Members of IndusInd Bank Limited

Report on the Standalone Financial Statements
1. We have audited the accompanying standalone financial statements of IndusInd Bank Limited (‘‘the Bank’’),
which comprise the Balance Sheet as at March 31, 2016 and the Profit and Loss Account and Cash Flow
Statement for the year then ended, and a summary of significant accounting policies and other explanatory
information, which we have signed under reference to this report.
Management’s Responsibility for the Financial Statements
2. The Board of Directors of the Bank are responsible for the matters stated in Section 134(5) of the Companies
Act, 2013 with respect to preparation of these standalone financial statements to give a true and fair view of
the financial position, financial performance and cash flows of the Bank in accordance with the accounting
principles generally accepted in India, including the Accounting Standards specified under Section 133 of the
Companies Act, 2013 (“the Act”), read with Rule 7 of the Companies (Accounts) Rules, 2014 and provisions
of Section 29 of the Banking Regulation Act, 1949 and circulars and guidelines issued by the Reserve Bank of
India (RBI) from time to time as applicable to banks. This responsibility also includes maintenance of adequate
accounting records in accordance with the provisions of the Act for safeguarding of the assets of the Bank and
for preventing and detecting frauds and other irregularities; selection and application of appropriate accounting
policies; making judgments and estimates that are reasonable and prudent; and design, implementation and
maintenance of adequate internal financial controls, that were operating effectively for ensuring the accuracy
and completeness of the accounting records, relevant to the preparation and presentation of the financial
statements that give a true and fair view and are free from material misstatement, whether due to fraud or error.
Auditors’ Responsibility
3. Our responsibility is to express an opinion on these standalone financial statements based on our audit.
4. We have taken into account the provisions of the Act and the Rules made thereunder, including the accounting
standards, provisions of section 29 of the Banking Regulation Act, 1949, circulars and guidelines issued by RBI
as applicable to banks and matters which are required to be included in the audit report.
5. We conducted our audit in accordance with the Standards on Auditing specified under section 143(10) of the
Act and other applicable authoritative pronouncements issued by the Institute of Chartered Accountants of
India. Those Standards require that we comply with ethical requirements and plan and perform the audit to
obtain reasonable assurance about whether the financial statements are free from material misstatement.
6. An audit involves performing procedures to obtain audit evidence, about the amounts and disclosures in the
financial statements. The procedures selected depend on the auditors’ judgment, including the assessment of
the risks of material misstatement of the financial statements, whether due to fraud or error. In making those
risk assessments, the auditors consider internal control relevant to the Bank’s preparation and fair presentation
of the financial statements in order to design audit procedures that are appropriate in the circumstances. An
audit also includes evaluating the appropriateness of accounting policies used and the reasonableness of the
accounting estimates made by the Board of Directors of the Bank, as well as evaluating the overall presentation
of the standalone financial statements.
7. We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit
opinion on the standalone financial statements.
Opinion
8. In our opinion, and to the best of our information and according to the explanations given to us, the accompanying
standalone financial statements together with the notes thereon give the information required by provisions of
section 29 of the Banking Regulation Act, 1949 as well as the Companies Act, 2013 and circulars and guidelines
issued by the Reserve Bank of India, in the manner so required for banking companies and give a true and fair
view in conformity with the accounting principles generally accepted in India of the state of affairs of the Bank as
at March 31, 2016 and its profit and its cash flow for the year then ended.
Other Matter
9. The standalone financial statements of the Bank as at March 31, 2015 and for the year then ended were audited
by another firm of chartered accountants who, vide their report dated April 16, 2015, expressed an unmodified
opinion on those financial statements.
138
Report on Other Legal and Regulatory Requirements
10. In our opinion, the Balance Sheet, Profit and Loss Account and Cash Flow Statement dealt with by this report
have been drawn up in accordance with the provisions of section 29 of the Banking Regulation Act,1949 read
with applicable provisions of section 133 of the Act read with Rule 7 of the Companies (Accounts) Rules, 2014.
11. As required by section 143(3) of the Act and section 30 of the Banking Regulation Act,1949 we report that:
a) We have sought and obtained all the information and explanations which, to the best of our knowledge
and belief, were necessary for the purposes of our audit;
b) The transactions of the Bank, which have come to our notice during the course of our audit, have been
within the powers of the Bank;
c) During the course of our audit we have visited 32 branches to examine the books of accounts and
other records maintained at the branch and performed other relevant audit procedures. Since the key
operations of the Bank are automated with the key applications integrated to the core banking system,
the audit is primarily carried out at Mumbai and Chennai as all the necessary records and data required
for the purposes of our audit are available therein;
d) In our opinion, proper books of account as required by law have been kept by the Bank so far as it
appears from our examination of those books;
e) The Balance Sheet, the Profit and Loss Account and the Cash Flow Statement dealt with by this report are
in agreement with the books of account;
f) In our opinion, the aforesaid standalone financial statements comply with the Accounting Standards
specified under Section 133 of the Act, read with Rule 7 of the Companies (Accounts) Rules, 2014 to the
extent they are not inconsistent with the accounting policies prescribed by RBI;
g) on the basis of written representations received from the directors as on 31 March 2016 taken on record
by the Board of Directors, none of the directors is disqualified as on 31 March 2016 from being appointed
as a director in terms of Section 164(2) of the Act;
h) With respect to the adequacy of the internal financial controls over financial reporting of the Bank and the
operating effectiveness of such controls, refer to our separate Report in “Annexure A”.
i) With respect to the other matters to be included in the Auditors’ Report in accordance with Rule 11 of the
Companies (Audit and Auditors) Rules, 2014, in our opinion and to the best of our knowledge and belief
and according to the information and explanations given to us:
i. The Bank has disclosed the impact, if any, of pending litigations as at March 31, 2016 on its financial
position in its standalone financial statements – Refer Schedule 12 and Note 9.4 in Schedule 18;
ii. The Bank has made provision as at March 31, 2016, as required under the applicable law or
accounting standards, for material foreseeable losses on long-term contracts including derivative
contracts – Refer Note 9.5 in Schedule 18;
iii. There has been no delay in transferring amounts, required to be transferred, to the Investor
Education and Protection Fund by the Bank during the year ended March 31, 2016.
For Price Waterhouse Chartered Accountants LLP

Firm Registration Number:012754N/ N500016
Russell I Parera
Place : Mumbai Partner
Date : April 21, 2016 Membership Number 042190
139
Annexure A to Independent Auditors’ Report
Referred to in paragraph 11 h of the Independent Auditors’ Report of even date to the members of IndusInd Bank
Limited on the standalone financial statements for the year ended March 31, 2016
Report on the Internal Financial Controls under Clause (i) of Sub-section 3 of Section 143 of
the Act
1. We have audited the internal financial controls over financial reporting of IndusInd Bank Limited (“the Bank”) as
of March 31, 2016 in conjunction with our audit of the standalone financial statements of the Bank for the year
ended on that date.
Management’s Responsibility for Internal Financial Controls
2. The Bank’s management is responsible for establishing and maintaining internal financial controls based on the
internal control over financial reporting criteria established by the Bank considering the essential components
of internal control stated in the Guidance Note on Audit of Internal Financial Controls Over Financial Reporting
issued by the Institute of Chartered Accountants of India (ICAI). These responsibilities include the design,
implementation and maintenance of adequate internal financial controls that were operating effectively
for ensuring the orderly and efficient conduct of its business, including adherence to Bank’s policies, the
safeguarding of its assets, the prevention and detection of frauds and errors, the accuracy and completeness of
the accounting records, and the timely preparation of reliable financial information, as required under the Act.
3. Our responsibility is to express an opinion on the Bank’s internal financial controls over financial reporting based
on our audit. We conducted our audit in accordance with the Guidance Note on Audit of Internal Financial Controls
Over Financial Reporting (the “Guidance Note”) and the Standards on Auditing deemed to be prescribed under
section 143(10) of the Act to the extent applicable to an audit of internal financial controls, both applicable to an
audit of internal financial controls and both issued by the ICAI. Those Standards and the Guidance Note require
that we comply with ethical requirements and plan and perform the audit to obtain reasonable assurance about
whether adequate internal financial controls over financial reporting was established and maintained and if such
controls operated effectively in all material respects.
4. Our audit involves performing procedures to obtain audit evidence about the adequacy of the internal financial
controls system over financial reporting and their operating effectiveness. Our audit of internal financial controls
over financial reporting included obtaining an understanding of internal financial controls over financial reporting,
assessing the risk that a material weakness exists, and testing and evaluating the design and operating
effectiveness of internal control based on the assessed risk. The procedures selected depend on the auditor’s
judgement, including the assessment of the risks of material misstatement of the financial statements, whether
due to fraud or error.
5. We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit
opinion on the Bank’s internal financial controls system over financial reporting.
Meaning of Internal Financial Controls Over Financial Reporting
6. A Bank’s internal financial control over financial reporting is a process designed to provide reasonable
assurance regarding the reliability of financial reporting and the preparation of financial statements for external
purposes in accordance with generally accepted accounting principles. A Bank’s internal financial control over
financial reporting includes those policies and procedures that (1) pertain to the maintenance of records that,
in reasonable detail, accurately and fairly reflect the transactions and dispositions of the assets of the Bank;
(2) provide reasonable assurance that transactions are recorded as necessary to permit preparation of financial
statements in accordance with generally accepted accounting principles, and that receipts and expenditures of
the Bank are being made only in accordance with authorisations of management and directors of the Bank; and
(3) provide reasonable assurance regarding prevention or timely detection of unauthorised acquisition, use, or
disposition of the company’s assets that could have a material effect on the financial statements.
140
Inherent Limitations of Internal Financial Controls Over Financial Reporting
7. Because of the inherent limitations of internal financial controls over financial reporting, including the possibility
of collusion or improper management override of controls, material misstatements due to error or fraud may
occur and not be detected. Also, projections of any evaluation of the internal financial controls over financial
reporting to future periods are subject to the risk that the internal financial control over financial reporting may
become inadequate because of changes in conditions, or that the degree of compliance with the policies or
procedures may deteriorate.
Opinion
8. In our opinion, the Bank has, in all material respects, an adequate internal financial controls system over financial
reporting and such internal financial controls over financial reporting were operating effectively as at March 31,
2016, based on the internal control over financial reporting criteria established by the Bank considering the
essential components of internal control stated in the Guidance Note on Audit of Internal Financial Controls Over
Financial Reporting issued by the Institute of Chartered Accountants of India .

Russell I Parera
141
Balance Sheet as at March 31, 2016
` in '000s
SCHEDULE As at As at
31.03.2016 31.03.2015
CAPITAL AND LIABILITIES
Capital 1 594,98,63 529,45,02
Employee Stock Options Outstanding 18 (Note 10.2) 13,76,64 14,05,31
Reserves and Surplus 2 17087,22,27 10101,03,11
Deposits 3 93000,34,61 74134,36,42
Borrowings 4 22155,86,48 20618,05,62
Other Liabilities and Provisions 5 7204,80,65 6390,41,73
TOTAL 140056,99,28 111787,37,21
ASSETS
Cash and Balances with Reserve Bank of India 6 4521,04,05 4035,14,27
Balances with Banks and Money at Call and Short Notice 7 5590,83,10 6743,99,92
Investments 8 31214,31,47 22878,33,79
Advances 9 88419,34,19 68788,19,90
Fixed Assets 10 1255,32,39 1157,57,74
Other Assets 11 9056,14,08 8184,11,59
TOTAL 140056,99,28 111787,37,21
Contingent Liabilities 12 285101,32,08 208973,10,21
Bills for Collection 13760,84,54 6728,91,77
Significant Accounting Policies 17
Notes to the financial statements 18
The schedules referred to above form an integral part of the Balance Sheet.
The Balance Sheet has been prepared in conformity with Form A of the Third Schedule to the Banking Regulation Act, 1949.
As per our report of even date. For INDUSIND BANK LTD.
For Price Waterhouse Chartered R. Seshasayee T. Anantha Narayanan

Accountants LLP Chairman Director


142
Profit and Loss Account for the year ended March 31, 2016
` in '000s
SCHEDULE Year ended Year ended
31.03.2016 31.03.2015
I. INCOME
Interest Earned 13 11580,65,89 9691,96,39
Other Income 14 3296,94,62 2548,00,33
TOTAL 14877,60,51 12239,96,72
II. EXPENDITURE
Interest Expended 15 7064,08,65 6271,68,85
Operating Expenses 16 3672,10,09 2870,06,25
Provisions and Contingencies 18 (Note 12.1) 1854,96,76 1304,50,09
TOTAL 12591,15,50 10446,25,19
III. PROFIT
Net Profit for the year 2286,45,01 1793,71,53
Profit brought forward 3664,01,65 2623,33,40
TOTAL 5950,46,66 4417,04,93
IV. APPROPRIATIONS
Transfer to
a) Statutory Reserve 571,61,25 448,42,88
b) Capital Reserve 13,21,00 12,27,49
c) Investment Reserve Account - 37,16,33
d) Proposed final dividend 292,62,03 212,01,29
e) Corporate Dividend Tax 59,57,06 43,15,29
937,01,34 753,03,28
Balance carried over to the Balance Sheet 5013,45,32 3664,01,65
TOTAL 5950,46,66 4417,04,93
V. EARNINGS PER EQUITY SHARE
(Face value of `10/- per share)
Basic (`) 18 (Note 11.5) 39.68 33.99
Diluted (`) 18 (Note 11.5) 39.26 33.41
Notes to the financial statements 18
The schedules referred to above form an integral part of the Profit and Loss Account.
The Profit and Loss Account has been prepared in conformity with Form B of the Third Schedule to the Banking Regulation Act, 1949.



143
Cash Flow Statement for the year ended March 31, 2016
` in '000s
Year ended Year ended
31.03.2016 31.03.2015
A. Cash Flow from Operating Activities
Net Profit before taxation 3469,26,11 2709,17,02
Adjustments for :
Depreciation on Fixed assets 156,51,93 126,84,89
(Appreciation) / Depreciation on Investments 29,51,23 (66,42,58)
Employees Stock Option expenses 2,22,46 3,03,35
Loan Loss and Other Provisions 642,64,44 455,47,19
Amortisation of premium on HTM investments 36,33,24 31,57,55
Loss / (Profit) on sale of fixed assets (6,98,95) 1,91,46
Operating Profit before Working Capital changes 4329,50,46 3261,58,88
Adjustments for :
Increase in Advances (20273,78,73) (14141,83,50)
Increase in Investments (8401,82,15) (2923,79,90)
Increase in Other Assets (705,99,49) (3759,04,47)
Increase in Deposits 18865,98,19 13632,07,88
Increase in Other Liabilities 747,03,26 3631,95,91
Cash generated from / (used in) Operations (5439,08,46) (299,05,20)
Direct Taxes paid (net of refunds) (1348,84,10) (1122,00,88)
Net Cash used in Operating Activities (6787,92,56) (1421,06,08)
B. Cash Flow from Investing Activities
Purchase of Fixed Assets (including WIP) (269,02,26) (278,62,65)
Proceeds from sale of Fixed Assets 11,50,78 2,47,03
Net Cash used in Investing Activities (257,51,48) (276,15,62)
C. Cash Flow from Financing Activities
Proceeds from issue of equity shares (net of issue expenses) 5125,19,57 66,25,15
Proceeds from issue of Long Term Infrastructure Bonds - 500,00,00
Dividends paid (284,83,42) (215,43,35)
Redemption of Sub-ordinated Tier-2 capital (535,00,00) (225,10,00)
Increase in Borrowings 2072,80,85 5581,19,92
Net Cash generated from Financing Activities 6378,17,00 5706,91,72
Net Increase / (Decrease) in Cash and Cash Equivalents (667,27,04) 4009,70,02
Cash and Cash Equivalents at the beginning of the year 10779,14,19 6769,44,17
Cash and Cash Equivalents at the end of the year 10111,87,15 10779,14,19
Notes:
1. The above Cash Flow Statement has been prepared under the indirect method as set out in Accounting Standard
3 on Cash Flow Statements.
2. Figures in bracket indicate cash outflow.
3. Cash and cash equivalents comprises of Cash in Hand and Balances with RBI (Schedule 6) and Balances with
Banks and Money at Call and Short Notice (Schedule 7).

144
Schedules
` in ’000s
As at 31.03.2016 As at 31.03.2015
SCHEDULE - 1 CAPITAL
Authorised Capital
70,00,00,000 (Previous Year 55,00,00,000) equity shares of ` 10/- each 700,00,00 550,00,00
[Refer Schedule 18 (Note 1.1)]
Issued, Subscribed and Called up Capital

Paid up Capital
Refer Schedule 18 (Note1.2)

TOTAL 594,98,63 529,45,02
SCHEDULE - 2 RESERVES AND SURPLUS

I Statutory Reserve
Opening balance 1634,18,43 1185,75,55
Additions during the year 571,61,25 448,42,88
2205,79,68 1634,18,43
II Share Premium Account
Opening balance 4211,93,46 4150,35,92
Less: Share issue expenses 50,67,39 -
9274,10,55 4211,93,46
III General Reserve
Balance as at the end of the year 1,35,57 1,35,57
1,35,57 1,35,57
IV Capital Reserve
Opening balance 157,00,21 143,86,27
170,21,21 157,00,21
V Investment Allowance Reserve
Balance as at the end of the year 1,00,00 1,00,00
1,00,00 1,00,00
VI Investment Reserve Account
Additions during the year - 37,16,33
40,52,98 40,52,98
145
Schedules (Contd.)
` in ’000s
As at 31.03.2016 As at 31.03.2015
VII Revaluation Reserve
Less : Deductions during the year 10,23,85 6,26,25
380,76,96 391,00,81
VIII Balance in the Profit and Loss Account 5013,45,32 3664,01,65
TOTAL 17087,22,27 10101,03,11
SCHEDULE - 3 DEPOSITS
A I Demand Deposits
i) From Banks 567,66,73 550,97,12
ii) From Others 14910,35,03 11805,05,34
II Savings Bank Deposits 17246,24,53 12943,56,94
III Term Deposits
i) From Banks 5001,20,36 5200,09,92
ii) From Others 55274,87,96 43634,67,10
TOTAL 93000,34,61 74134,36,42
B Deposits of Branches
I In India 93000,34,61 74134,36,42
II Outside India - -
TOTAL 93000,34,61 74134,36,42
SCHEDULE - 4 BORROWINGS
I Borrowings in India
i) Reserve Bank of India - -
ii) Other Banks 4769,68,99 8763,38,36
iii) Other Institutions and Agencies 14622,75,24 8979,52,26
iv) Unsecured Non-Convertible Redeemable Debentures / Bonds - 535,00,00
(Subordinated Tier-2 Bonds)
v) Unsecured Non-Convertible Redeemable Non-Cumulative 308,90,00 308,90,00
Bonds (Subordinated Upper Tier-2 Bonds)
vi) Long Term Infrastructure Bonds 500,00,00 500,00,00
II Borrowings outside India 1954,52,25 1531,25,00
TOTAL 22155,86,48 20618,05,62
Secured borrowings included in I & II above - -
146
Schedules (Contd.)
` in ’000s
As at 31.03.2016 As at 31.03.2015
SCHEDULE - 5 OTHER LIABILITIES AND PROVISIONS
I Inter-office Adjustments (Net) 126,86,21 -
II Bills Payable 520,03,19 355,17,62
III Interest Accrued 789,19,18 658,40,08
IV Proposed Dividend 322,25,01 254,89,34
V Others [Mark to market gain or loss on forex and derivative 5446,47,06 5121,94,69
transactions (Refer Schedule 18 (Note 9.12))] [Standard Asset
Provisions (Refer Schedule 18 (Note 4.9))]
TOTAL 7204,80,65 6390,41,73

SCHEDULE - 6 CASH AND BALANCES WITH RESERVE
BANK OF INDIA
I Cash in hand (including foreign currency notes) 739,52,90 671,19,82
II Balances with Reserve Bank of India
i) In Current Account 3781,51,15 3363,94,45
ii) In Other Accounts - -
TOTAL 4521,04,05 4035,14,27
SCHEDULE - 7 BALANCES WITH BANKS AND MONEY AT CALL AND
SHORT NOTICE
I In India
i) Balances with Banks
a) In Current Accounts 454,27,01 459,51,36
b) In Other Deposit Accounts 3059,52,75 5296,80,22
ii) Money at Call and Short Notice - With Other Institutions - -
TOTAL 3513,79,76 5756,31,58
II Outside India
i) In Current Accounts 751,93,34 362,68,34
ii) In Other Deposit Accounts - -
iii) Money at Call and Short Notice 1325,10,00 625,00,00
TOTAL 2077,03,34 987,68,34
GRAND TOTAL 5590,83,10 6743,99,92
SCHEDULE - 8 INVESTMENTS
I In India
Gross Value 31270,67,74 22905,18,83
Less : Aggregate of provision / depreciation 56,36,27 26,85,04
Net value of Investments in India 31214,31,47 22878,33,79
147
Schedules (Contd.)
` in ’000s
As at 31.03.2016 As at 31.03.2015
Comprising :
i) Government securities*++ 25268,03,95 17906,12,96
ii) Other approved securities - -
iii) Shares 41,32,83 27,96,85
iv) Debentures and bonds 1812,88,69 1625,66,35
v) Subsidiaries and / or Joint Ventures - 50,00
vi) Others - Security Receipts, Pass Through Certificates, Units 4092,06,00 3318,07,63
of schemes of Mutual Funds, Venture Capital Funds
and Others
II Outside India - -
TOTAL 31214,31,47 22878,33,79
“*Includes securities of `403.18 crores (Previous Year ` 387.57 crores)
pledged for clearing facility and margin requirements.
++ Net of Repo Borrowings of ` 2,839.99 crores (Previous Year
` 6,701.00 crores) under the Liquidity Adjustment Facility in line with RBI
requirements.”
SCHEDULE - 9 ADVANCES
A i) Bills Purchased and Discounted 869,52,78 1824,50,93
ii) Cash Credits, Overdrafts and Loans Repayable on Demand 23144,94,88 17734,99,18
iii) Term Loans 64404,86,53 49228,69,79
TOTAL 88419,34,19 68788,19,90
B i) Secured by Tangible Assets 76778,24,12 58524,26,82
(includes advances against book debts)
ii) Covered by Bank / Government Guarantees 1125,55,91 1445,83,41
(includes advances against L/Cs issued by Banks)
iii) Unsecured 10515,54,16 8818,09,67
TOTAL 88419,34,19 68788,19,90
C I) Advances in India
i) Priority Sector 28066,51,54 22907,20,38
ii) Public Sector 808,25,51 1130,71,37
iii) Banks 29,69 25,78
iv) Others 59544,27,45 44750,02,37
TOTAL 88419,34,19 68788,19,90
II) Advances Outside India - -
TOTAL 88419,34,19 68788,19,90
148
Schedules (Contd.)
` in ’000s
As at 31.03.2016 As at 31.03.2015
SCHEDULE - 10 FIXED ASSETS
I PREMISES
i) At cost, as at the beginning of the year 595,92,11 595,43,32
ii) Additions during the year - 48,79
595,92,11 595,92,11
iii) Less : Deductions during the year 5,90,29 -
iv) Less : Depreciation to date [Refer Schedule 18 (Note 9.15)] 66,72,06 58,99,02
TOTAL 523,29,76 536,93,09
II Other Fixed Assets (including furniture and fixtures)

i) At cost, as at the beginning of the year 1232,41,88 1009,74,96
ii) Additions during the year 269,56,04 265,00,18
1501,97,92 1274,75,14
iii) Less : Deductions during the year 36,34,79 42,33,26
iv) Less : Depreciation to date [Refer Schedule 18 (Note 9.15)] 771,08,26 649,78,76
TOTAL 694,54,87 582,63,12
III Capital Work in Progress 37,47,76 38,01,53
GRAND TOTAL 1255,32,39 1157,57,74
SCHEDULE - 11 OTHER ASSETS
I Inter-office Adjustments (Net) - 13,64,99
II Interest Accrued 962,60,98 937,21,60
III Tax Paid in Advance / tax deducted at source (net of provision) 456,98,06 392,06,18
IV Stationery and Stamps 40,35 1,64,47
V Non-banking assets acquired in satisfaction of claims 45,52,82 41,19,82
VI Others [Mark to market gain or loss on forex and derivative 7590,61,87 6798,34,53
transactions (Refer Schedule 18 (Note 9.12))]
[Deferred Tax Assets (Refer Schedule 18 (Note 11.6))]
TOTAL 9056,14,08 8184,11,59
SCHEDULE - 12 CONTINGENT LIABILITIES

I Claims against the Bank not acknowledged as debts 648,59,09 547,73,97
II Liability on account of outstanding Forward Exchange Contracts 143761,31,22 96187,31,18
III Liability on account of outstanding Derivative Contracts 99741,53,69 79217,67,10
IV Guarantees given on behalf of constituents
- In India 32722,19,60 27987,92,20
- Outside India - -
V Acceptances, Endorsements and Other Obligations 6512,09,48 5019,93,18
VI Other Items for which the Bank is contingently liable 1715,59,00 12,52,58
TOTAL 285101,32,08 208973,10,21
149
Schedules (Contd.)
` in ’000s
31.03.2016 31.03.2015
SCHEDULE - 13 INTEREST EARNED
I Interest / Discount on Advances / Bills 9244,55,57 7716,90,85
II Income on Investments 1780,63,24 1587,68,95
III Interest on Balances with RBI and Other Inter-Bank Funds 408,50,31 277,29,99
IV Others 146,96,77 110,06,60
TOTAL 11580,65,89 9691,96,39
SCHEDULE - 14 OTHER INCOME
I Commission, Exchange and Brokerage 2231,47,71 1692,56,84
II Profit / (Loss) on Sale of Investments (Net) 145,25,65 117,73,63
III Profit / (Loss) on Sale of Land, Buildings and Other Assets (Net) 6,98,95 (1,91,46)
IV Profit on exchange transactions / Derivatives (Net) 836,99,93 720,38,87
V Income earned by way of dividend from companies in India 3,39,65 3,40,99
VI Miscellaneous Income 72,82,73 15,81,46
TOTAL 3296,94,62 2548,00,33
SCHEDULE - 15 INTEREST EXPENDED
I Interest on Deposits 5708,78,69 5172,06,02
II Interest on Reserve Bank of India / Inter-Bank Borrowings 272,40,52 299,91,61
III Others (including interest on Subordinated Debts and Upper Tier-2 bonds) 1082,89,44 799,71,22
TOTAL 7064,08,65 6271,68,85
SCHEDULE - 16 OPERATING EXPENSES
I Payments to and Provisions for Employees 1236,08,80 980,47,90
II Rent, Taxes and Lighting (includes operating lease rentals) 271,32,58 234,64,10
III Printing and Stationery 49,45,74 43,06,37
IV Advertisement and Publicity 21,01,43 42,88,71
V Depreciation on Bank’s Property 156,51,93 126,84,89
VI Directors’ Fees, Allowances and Expenses 1,30,95 1,11,80
VII Auditors’ Fees and Expenses 1,42,24 1,36,22
VIII Law Charges 44,76,42 37,56,33
IX Postage, Telegrams, Telephones, etc. 111,00,91 96,92,91
X Repairs and Maintenance 201,67,45 164,77,37
XI Insurance 103,35,29 75,97,44
XII Service Provider Fees 334,39,88 224,19,97
XIII Other Expenditure 1139,76,47 840,22,24
TOTAL 3672,10,09 2870,06,25
150
Schedule 17
Significant accounting policies
1. General
1.1 IndusInd Bank Limited (‘‘the Bank’’) was incorporated in 1994 under the Companies Act, 1956 and is
licensed by the Reserve Bank of India (RBI) to operate as a commercial bank under the Banking Regulation
Act, 1949. The Bank is publicly held and provides a wide range of banking products and financial services
to corporate and retail clients besides undertaking treasury operations. The Bank operates in India and
does not have a branch in any foreign country.
1.2 The accompanying financial statements have been prepared under the historical cost convention except
where otherwise stated, and in accordance with statutory requirements prescribed under the Banking
Regulation Act, 1949, circulars and guidelines issued by RBI from time to time (RBI guidelines), accounting
standards referred to in Section 133 of the Companies Act, 2013 (the Act) and practices prevailing within
the banking industry in India.
1.3 The preparation of the financial statements in conformity with generally accepted accounting principles
in India requires management to make estimates and assumptions that affect the reported amounts of
assets, liabilities, revenues, expenses and disclosure of contingent liabilities on the date of the financial
statements. Management believes that the estimates and assumptions used in the preparation of the
financial statements are prudent and reasonable. Any revision to accounting estimates is recognised
prospectively in current and future periods.
2. Transactions involving Foreign Exchange
2.1 Monetary assets and liabilities denominated in foreign currency are translated at the Balance Sheet date
at the closing rates of exchange notified by the Foreign Exchange Dealers’ Association of India (FEDAI)
and the resulting gains or losses are recognised in the Profit and Loss account.
2.2 Non-monetary items which are carried in terms of historical cost denominated in a foreign currency are
reported using the exchange rate at the date of the transaction; and non-monetary items which are carried
at fair value or other similar valuation denominated in a foreign currency are reported using the exchange
rates that existed when the values were determined.
2.3 All foreign exchange contracts outstanding at the Balance Sheet date are re-valued on present value basis
2.4 Swap Cost arising on account of foreign currency swap contracts to convert foreign currency funded
liabilities and assets into rupee liabilities and assets is amortised to the Profit and Loss account under the
head ‘Interest – Others’ over the underlying swap period.
2.5 Income and expenditure denominated in a foreign currency is translated at the rates of exchange prevailing
on the date of the transaction.
2.6 Contingent liabilities at the Balance Sheet date on account of outstanding forward foreign exchange
contracts, guarantees, acceptances, endorsements and other obligations denominated in a foreign
currency are stated at the closing rates of exchange notified by the FEDAI.
3. Investments
Significant accounting policies in accordance with RBI guidelines are as follows:
3.1 Categorisation of Investments:
The Bank classifies its investment at the time of purchase into one of the following three categories:
(i) Held to Maturity (HTM) – Securities acquired with the intention to hold till maturity.
(ii) Held for Trading (HFT) – Securities acquired with the intention to trade.
(iii) Available for Sale (AFS) – Securities which do not fall within the above two categories.
Subsequent shifting amongst the categories is done in accordance with RBI guidelines.
151
3.2 Classification of Investments:
For the purpose of disclosure in the Balance Sheet, investments are classified under six groups viz.,
(i) Government Securities, (ii) Other Approved Securities, (iii) Shares, (iv) Debentures and Bonds, (v)
Investments in Subsidiaries and Joint Ventures, and (vi) Other Investments.
3.3 Acquisition cost:
(i) Broken period interest on debt instruments is treated as a revenue item.
(ii) Brokerage, commission, etc. pertaining to investments, paid at the time of acquisition is charged to
the Profit and Loss account.
(iii) Cost of investments is computed based on the weighted average cost method.
3.4 Valuation of Investments:
(i) Held to Maturity – Each security in this category is carried at its acquisition cost. Any premium on
acquisition of the security is amortised over the balance period to maturity. The amortized amount is
classified under Interest earned – Income on investments (Item II of Schedule 13). The book value
of the security is reduced to the extent of amount amortized during the relevant accounting period.
Diminution, other than temporary, is determined and provided for each investment individually.
(ii) Held for Trading – Securities are valued scrip-wise and depreciation / appreciation is aggregated
for each classification. Net appreciation in each classification is ignored, while net depreciation is
provided for.
(iii) Available for Sale – Securities are valued scrip-wise and depreciation / appreciation is aggregated
for each classification. Net appreciation in each classification, is ignored, while net depreciation is
provided for.
(iv) Market value of government securities (excluding treasury bills) is determined on the basis of the
prices / YTM declared by Primary Dealers Association of India (PDAI) jointly with Fixed Income
Money Market and Derivatives Association (FIMMDA).
(v) Treasury bills are valued at carrying cost, which includes discount amortised over the period to
maturity.
(vi) Fair value of other debt securities is determined based on the yield curve and spreads provided by
FIMMDA.
(vii) Quoted equity shares are valued at lower of cost and the closing price on a recognised stock
exchange. Unquoted equity shares are valued at their break-up value or at ` 1/- per company where
the latest Balance Sheet is not available.
(viii) Units of the schemes of mutual funds are valued at the lower of cost and Net Asset Value (NAV)
provided by the respective schemes of mutual funds.
(ix) Investments in equity shares held as long-term investments by erstwhile IndusInd Enterprises &
Finance Limited and Ashok Leyland Finance Limited (since merged with the Bank) are valued at
cost and classified as part of HTM category. Provision towards diminution in the value of such
long-term investments is made only if the diminution in value is not temporary in the opinion of
management.
(x) Security Receipts (SR) are valued at the lower of redemption value and NAV obtained from the
Securitisation Company (SC) / Reconstruction Company (RC).
(xi) Trade date method of accounting is followed for purchase and sale of investments, except for
Government of India and State Government securities where settlement date method of accounting
is followed in accordance with RBI guidelines.
(xii) Provision for non-performing investments is made in conformity with RBI guidelines.
(xiii) Repurchase (Repo) / Reverse Repurchase (Reverse Repo) transactions (except transactions under
Liquidity Adjustment Facility (LAF) with RBI) are accounted for as Borrowing / Lending respectively.
152
On completion of the second leg of the Repo / Reverse Repo transaction, the difference between
the consideration amounts is reckoned as Interest Expenditure / Income. Amounts outstanding in
Repo / Reverse Repo account as at the Balance Sheet date is shown as part of Borrowings / Money
at Call and at Short Notice respectively, and the accrued expenditure / income till the Balance Sheet
date is recognised in the Profit and Loss account.
In respect of repo transactions under LAF with RBI, monies borrowed from RBI are credited to
investment account and reversed on maturity of the transaction. Costs thereon are accounted for
as interest expense. In respect of reverse repo transactions under LAF, monies lent to RBI are
debited to investment account and reversed on maturity of the transaction. Revenues thereon are
accounted for as interest income.
(xiv) In respect of the short sale transactions in Central Government dated securities, the short position
is covered by outright purchase of an equivalent amount of the same security within a maximum
period of three months including the day of trade. The short position is reflected as the amount
received on sale in a separate account and is classified under ‘Other Liabilities’. The short position
is marked to market and loss, if any, is charged to the Profit and Loss account, while gain, if any, is
not recognized. Profit / loss on settlement of the short position is recognized in the Profit and Loss
account.
(xv) Profit in respect of investments sold from HTM category is included in the Profit on Sale of
Investments and an equivalent amount (net of taxes, if any, and net of transfer to Statutory Reserves
as applicable to such profits) is appropriated from the Profit and Loss Appropriation account to
Capital Reserve account.
(xvi) In the event, provisions created on account of depreciation in the AFS or HFT categories are found
to be in excess of the required amount in any year, the excess is credited to the Profit and Loss
account and an equivalent amount (net of taxes, if any, and net of transfer to Statutory Reserves as
applicable to such excess provisions) is appropriated to an Investment Reserve Account (IRA).
The balance in IRA account is used to meet provision on account of depreciation in AFS and HFT
categories by transferring an equivalent amount to the Profit and Loss Appropriation account as and
when required.
3.5 Investments in unquoted units of Venture Capital Funds (VCF) are categorised under HTM category for
initial period of three years and valued at cost as per RBI guidelines. Units of VCF held under AFS category
where current quotations are not available are marked to market based on the Net Asset Value (NAV)
shown by VCF as per the latest audited financials of the fund. In case the audited financials are not
available for a period beyond 18 months, the investments are valued at ` 1/- per VCF.
4. Derivatives
Derivative contracts are designated as hedging or trading and accounted for as follows:
4.1 The hedging contracts comprise of Forward Rate Agreements, Interest Rate Swaps, and Currency Swaps
undertaken to hedge interest rate and currency risk on certain assets and liabilities. The net interest
receivable / payable is accounted on an accrual basis over the life of the swaps. However, where the
hedge is designated with an asset or liability that is carried at market value or lower of cost and market
value, then the hedging instrument is also marked to market with the resulting gain or loss recorded as an
adjustment to the market value of designated assets or liabilities.
4.2 The trading contracts comprise of trading in Interest Rate Swaps, Interest Rate Futures and Currency
Futures. The gain / loss arising on unwinding or termination of the contracts, is accounted for in the Profit
and Loss account. Trading contracts outstanding as at the Balance Sheet date are re-valued at their fair
value and resulting gains / losses are recognised in the Profit and Loss account.
4.3 Gains or losses on the termination of hedge swaps is deferred and recognised over the shorter of the
remaining life of the hedge swap or the remaining life of the underlying asset / liability.
4.4 Premium paid and received on currency options is accounted when due in the Profit and Loss Account.
153
4.5 Fair value of derivative is determined with reference to bid / asks quoted market price or by using valuation
models. Where the fair value is calculated using valuation models, the methodology is to calculate the
expected cash flows under the terms of each specific contract and then discount these values back to
the present value. The valuation takes into consideration all relevant market factors (e.g. prices, interest
rate, currency exchange rates, volatility, liquidity, etc.). Most market parameters are either are directly
observable or are implied from instrument prices. The model may perform numerical procedures in the
pricing such as interpolation when input values do not directly correspond to the most actively traded
market trade parameters.
4.6 Provisioning of overdue customer receivable on derivative contracts is made as per RBI guidelines.
5. Advances
5.1 Advances are classified as per RBI guidelines into standard, sub-standard, doubtful and loss assets after
considering subsequent recoveries to date.
5.2 Specific provisions for non-performing advances and floating provisions are made in conformity with RBI
guidelines. In addition the Bank considers accelerated provisioning based on past experience, evaluation
of securities and other related factors.
5.3 A general provision on standard assets is made in accordance with RBI guidelines. Provision made
against standard assets is included in ‘Other Liabilities and Provisions’.
5.4 Advances are disclosed in the Balance Sheet, net of provisions and interest suspended for non-performing
advances, and floating provisions.
5.5 Advances exclude derecognised securitised advances, inter-bank participation certificates issued and
bills rediscounted.
5.6 Amounts recovered during the year against bad debts written off in earlier years are recognised in the
Profit and Loss account.
5.7 Provision no longer considered necessary in the context of the current status of the borrower as a
performing asset, are written back to the Profit and Loss account to the extent such provisions were
charged to the Profit and Loss account.
5.8 For restructured / rescheduled assets, provision is made in accordance with the guidelines issued by RBI,
which requires the diminution in the fair value of the assets to be provided at the time of restructuring. The
restructured accounts are classified in accordance with RBI guidelines, including special dispensation
wherever allowed.
6. Securitisation transactions and direct assignments
6.1 The Bank transfers its loan receivables both through Direct Assignment route as well as transfer to Special
Purpose Vehicles (SPV).
6.2 The securitization transactions are without recourse to the Bank. The transferred loans and such securitized
receivables are de-recognized as and when these are sold (true sale criteria being fully met) and the
consideration has been received by the Bank. Gains / losses are recognized only if the Bank surrenders
the rights to the benefits specified in the loan contracts.
6.3 In terms of RBI guidelines, profit / premium arising on account of sale of standard assets, being the
difference between the sale consideration and book value, is amortized over the life of the securities
issued by the Special Purpose Vehicles (SPV). Any loss arising on account of the sale is recognized in the
Profit and Loss account in the period in which the sale occurs.
6.4 In case of sale of non-performing assets through securitization route to SC / RC by way of assignment of
debt against issuance of SRs, the recognition of sale and accounting of profit and loss thereon is done in
accordance with applicable RBI guidelines. Generally, the sale is recognized at the lower of redemption
value of SR and the Net Book Value (NBV) of the financial asset sold, and the surplus is recognized in the
Profit and Loss Account; shortfall if any, is charged to the Profit and Loss account subject to regulatory
forbearance, if any, allowed from time to time.
Profit or loss realized on ultimate redemption of the SR is recognized in the Profit and Loss Account.
154
7. Property, Plant and Equipment
7.1 Fixed assets are stated at cost (except in the case of premises which were re-valued based on values
determined by approved valuers) less accumulated depreciation and impairment, if any. Cost includes
incidental expenditure incurred on the assets before they are ready for intended use.
7.2 The appreciation on account of revaluation is credited to Revaluation Reserve. Depreciation relating to
revaluation is adjusted against the Revaluation Reserve.
7.3 Depreciation is provided over the useful life of the assets, pro rata for the period of use, on a straight-line
method. The useful life estimates prescribed in Part C of Schedule II to the Companies Act, 2013 are
generally adhered to, except in respect of asset classes where, based on technical evaluation, a different
estimate of useful life is considered suitable. Pursuant to this policy, the useful life estimates in respect of
the following assets are as follows:
(a) Computers at 3 years
(b) Application software and perpetual software licences at 5 years
(c) Printers, Scanners, Routers, Switch at 5 years
(d) ATMs at 7 years
(e) Network cabling, Electrical Installations, Furniture and Fixtures, Other Office Machinery at 10 years
(f) Vehicles at 5 years
(g) Buildings at 60 years
The useful life of an asset class is periodically assessed taking into account various criteria such as
changes in technology, changes in business environment, utility and efficacy of an asset class to meet
with intended user needs, etc. Whenever there is a revision in the estimated useful life of an asset, the
unamortised depreciable amount is charged over the revised remaining useful life of the said asset.
7.4 The carrying amount of fixed assets is reviewed at the Balance Sheet date to determine if there are any
indications of impairment based on internal / external factors. In case of impaired assets, the impairment
loss i.e. the amount by which the carrying amount of the asset exceeds its recoverable value is charged to
the Profit and Loss account to the extent the carrying amount of assets exceeds its estimated recoverable
amount.
8. Revenue Recognition
8.1 Interest and discount income on performing assets is recognised on accrual basis. Interest and discount
income on non-performing assets is recognised on realisation.
8.2 Interest on Government securities, debentures and other fixed income securities is recognised on a period
proportion basis. Income on discounted instruments is recognised over the tenor of the instrument on a
constant Yield to Maturity method.
8.3 Dividend income is accounted on accrual basis when the right to receive dividend is established.
8.4 Commission (except for commission on Deferred Payment Guarantees which is recognised over the term
on a straight line basis), Exchange and Brokerage are recognised on a transaction date and net of directly
attributable expenses.
8.5 Fees are recognised on an accrual basis when binding obligation to recognise the fees has arisen as per
agreement, except in cases where the Bank is uncertain of realisation.
8.6 Income from distribution of third party products is recognised on the basis of business booked.
155
9. Operating Leases
9.1 Lease rental obligations in respect of assets taken on operating lease are charged to the Profit and Loss
account on a straight-line basis over the lease term.
9.2 Assets given under leases in respect of which all the risks and benefits of ownership are effectively
retained by the Bank are classified as operating leases. Lease rentals received under operating leases are
recognized in the Profit and Loss account as per the terms of the contracts.
10. Employee Benefits
10.1 The Gratuity scheme of the Bank is a defined benefit scheme and the expense for the year is recognized
on the basis of actuarial valuation at the Balance Sheet date. The present value of the obligation under
such benefit plan is determined based on independent actuarial valuation using the Projected Unit Credit
Method which recognizes each period of service that gives rise to additional unit of employee benefit
entitlement and measures each unit separately to build up the final obligation. Payment obligations under
the Group Gratuity scheme are managed through purchase of appropriate policies from insurers.
10.2 Provident Fund contributions are made under trusts separately established for the purpose and the
scheme administered by Regional Provident Fund Commissioner (RPFC), as applicable. The rate at which
the annual interest is payable to the beneficiaries by the trusts is being administered by the government.
The Bank has an obligation to make good the shortfall, if any, between the return from the investments of
the trusts and the notified interest rates. Actuarial valuation of this Provident Fund Interest shortfall is done
as per the guidance note on Valuation of Interest Rate Guarantees on Exempt Provident Funds under AS
15 (Revised) issued by the Institute of Actuaries of India, and such shortfall, if any, is provided for.
10.3 Provision for compensated absences is made on the basis of actuarial valuation as at the Balance Sheet
date. The actuarial valuation is carried out using the Projected Unit Credit Method.
10.4 Intrinsic value method is applied to account for the compensation cost of ESOP granted to the employees
of the Bank. Intrinsic value is the amount by which the quoted market price of the underlying shares on the
grant date exceeds the exercise price of the options. Accordingly, such compensation cost is amortized
over the vesting period.
11. Segment Reporting
In accordance with the guidelines issued by RBI, the Bank has adopted Segment Reporting as under:
(a) Treasury includes all investment portfolios, Profit / Loss on sale of Investments, Profit / Loss on foreign
exchange transactions, equities, income from derivatives and money market operations. The expenses
of this segment consist of interest expenses on funds borrowed from external sources as well as internal
sources and depreciation / amortisation of premium on Held to Maturity category investments.
(b) Corporate / Wholesale Banking includes lending to and deposits from corporate customers and
identified earnings and expenses of the segment.
(c) Retail Banking includes lending to and deposits from retail customers and identified earnings and
expenses of the segment.
(d) Other Banking Operations includes all other operations not covered under Treasury, Corporate /
Wholesale Banking and Retail Banking.
Unallocated includes Capital and Reserves, Employee Stock Options (Grants) Outstanding and other
unallocable assets, liabilities, income and expenses.
12. Debit and Credit Card reward points liability
The liability towards Credit Card reward points is computed based on an actuarial valuation and the liability
towards Debit Card reward points is computed on the basis of management estimates considering past trends.
156
13. Bullion
13.1 The Bank imports bullion including precious metal bars on a consignment basis for selling to its customers.
The imports are on a back-to-back basis and are priced to the customer based on the prevailing price
quoted by the supplier and the local levies related to the consignment like customs duty, etc. The profit
earned is included in commission income.
13.2 The Bank sells gold coins to its customers. The difference between the sale price to customers and
purchase price is reflected under commission income.
14. Income-tax
Tax expenses comprise of current and deferred taxes. Current tax is measured at the amount expected to be
paid to the tax authorities in accordance with the Income Tax Act, 1961. Deferred taxes reflect the impact of
current year timing differences between taxable income and accounting income for the year and reversal of
timing differences of earlier years. Deferred tax is measured based on the tax rates and the tax laws enacted
or substantively enacted at the Balance Sheet date. Deferred tax assets are recognized, in general, only to the
extent that there is reasonable certainty that sufficient future taxable income will be available against which such
deferred tax assets can be realized; where there are unabsorbed depreciation and / or carry forward of losses
under tax laws, deferred tax assets are recognized only if there is virtual certainty supported by convincing
evidence that such deferred tax asset can be realized against future taxable income. Unrecognized deferred tax
assets of earlier years are re-assessed and recognised to the extent that it has become reasonably certain that
future taxable income will be available against which such deferred tax assets can be realized.
15. Earnings per share
Earnings per share is calculated by dividing the Net Profit or Loss for the period attributable to equity shareholders
by the weighted average number of equity shares outstanding during the period. Diluted earnings per equity
share are computed using the weighted average number of equity shares and dilutive potential equity shares
outstanding as at end of the year.
16. Provisions, contingent liabilities and contingent assets
16.1 A provision is recognized when there is an obligation as a result of past event, and it is probable that an
outflow of resources will be required to settle the obligation, and in respect of which a reliable estimate can
be made. Provisions are not discounted to their present value and are determined based on best estimate
required to settle the obligation at the Balance Sheet date. These are reviewed at each Balance Sheet date
and adjusted to reflect the current best estimates.
16.2 A disclosure of contingent liability is made when there is:
(a) A possible obligation arising from a past event, the existence of which will be confirmed by
occurrence or non-occurrence of one or more uncertain future events not within the control of the
bank; or
(b) A present obligation arising from a past event which is not recognized as it is not probable that an
outflow of resources will be required to settle the obligation or a reliable estimate of the amount of
the obligation cannot be made.
16.3 When there is a possible obligation or a present obligation in respect of which the likelihood of outflow of
resources is remote, no provision or disclosure is made.
16.4 Contingent assets are not recognized or disclosed in the financial statements. However, contingent assets
are assessed continually and if it is virtually certain that an inflow of economic benefits will arise, the assets
and related income are recognized in the period in which the change occurs.
17. Cash and Cash equivalents
Cash and cash equivalents comprises of Cash in Hand and Balances with RBI and Balances with Banks and
Money at Call and Short Notice.
157
Schedule 18
Notes forming part of the Financial Statements
1. Capital:
1.1 Authorised Capital:
The Authorised Capital of the Bank was increased on June 8, 2015 to ` 600 crores consisting of
60,00,00,000 equity shares of ` 10/- each from ` 550 crores consisting of 55,00,00,000 equity shares of
` 10/- each based on a special resolution passed by the members through postal ballot, and further on
August 17, 2015 to ` 700 crores consisting of 70,00,00,000 equity shares of ` 10/- each based on a special
resolution passed by the members in the twenty first Annual General Meeting.
1.2 Capital Issue:
During the year ended March 31, 2016, through a Qualified Institutions Placement (QIP), 5,12,18,640
equity shares of ` 10/- each were allotted at a price of ` 845.00 per share aggregating to ` 4,327.98
crores. Further, the promoters of the Bank were allotted 87,81,360 equity shares of ` 10/- each at a
price of ` 857.20 per share, aggregating to ` 752.74 crores through a Preferential Allotment. Besides,
55,36,126 equity shares aggregating to ` 95.14 crores were allotted on various dates to the employees
who exercised their stock options.
During the year ended March 31, 2015, 40,03,725 equity shares aggregating to ` 66.25 crores were
allotted on various dates to the employees who exercised their stock options.
1.3 Capital Adequacy Ratio:
The Bank computes Capital Adequacy Ratio as per Basel III Capital Regulations issued by RBI, which
became applicable to the Bank with effect from April 1, 2013.
Under Basel III Capital Regulations, on an on-going basis, the Bank has to maintain a Minimum Total
Capital (MTC) of 9.625% (Previous Year 9.00%) including Capital Conversion Buffer (CCB) at 0.625%
(Previous Year Nil), of the total risk weighted assets (RWA). Out of the MTC, at least 6.125% (Previous Year
5.50%), including 0.625% (Previous Year Nil) towards CCB, shall be from Common Equity Tier 1 (CET1)
capital and at least 7.00% (Previous Year 7.00%) from Tier 1 capital. The capital adequacy ratio of the Bank
is set out below:
(` in crores)
March 31, 2016 March 31, 2015

1. Common Equity Tier 1 capital ratio 14.92% 11.22%
2. Tier 1 capital ratio 14.92% 11.22%
3. Tier 2 capital ratio 0.58% 0.87%
4. Total capital ratio (CRAR) 15.50% 12.09%
5. Amount of equity capital raised 5,175.86 66.25
6. Amount of Additional Tier 1 capital raised; of which
Perpetual Non-Cumulative Preference Shares (PNCPS) - -
Perpetual Debt Instruments (PDI) - -
7. Amount of Tier 2 capital raised; of which
Debt capital instrument: - -
Preference Share Capital Instruments [Perpetual
Cumulative Preference Shares (PCPS) / Redeemable
Non-Cumulative Preference Shares (RNCPS) / - -
Redeemable Cumulative Preference Shares (RCPS)]
158
2. Investments:
2.1 Details of Investments:
(` in crores)
March 31, 2016 March 31, 2015

1. Value of Investments
(i) Gross value of Investments 31,270.68 22,905.19
(a) In India 31,270.68 22,905.19
(b) Outside India - -
(ii) Provisions for Depreciation 56.36 26.85
(a) In India 56.36 26.85
(iii) Net value of Investments 31,214.32 22,878.34
(a) In India 31,214.32 22,878.34
2. Movement in provisions held towards depreciation on
Investments
(i) Opening balance 26.85 98.65
(ii) Add: Provision made during the year 29.51 3.27
(iii) Less: Write-off / (write-back) of excess provisions - (75.07)
during the year
(iv) Closing balance 56.36 26.85
2.2 Category wise details of Investments (Net of provision for depreciation):
(` in crores)
As at March 31, 2016 As at March 31, 2015

HTM AFS HFT HTM AFS HFT
(i) Government securities 17,298.33 7,969.71 - 11,259.21 6,646.92 -
(ii) Other approved securities - - - - - -
(iii) Shares 4.75 36.58 - 4.75 23.22 -
(iv) Debentures and bonds - 1,812.89 - - 1,625.66 -
(v) Subsidiaries and / or Joint - - - 0.50 - -
Ventures
(vi) Others - Security Receipts, 20.00 4,072.06 - - 3,318.08 -
Pass Through Certificates,
investment in units of Mutual
Funds, Commercial Paper,
Venture Capital, etc.
Total 17,323.08 13,891.24 - 11,264.46 11,613.88 -
159
2.3 Details of Repo / Reverse Repo including under Liquidity Adjustment Facility (LAF) transactions (in
face value terms):
(` in crores)
Minimum Maximum Daily average Balance as at

outstanding outstanding outstanding the year end
during the during the during the
year year year
Year ended March 31, 2016
Securities sold under repo
(i) Government Securities 35.06 6,745.81 3,959.85 4,544.98
(ii) Corporate Debt Securities - - - -
Securities purchased under
reverse repo
(i) Government Securities 75.00 1,863.40 129.83 -
Year ended March 31, 2015
Securities sold under repo
(i) Government Securities 1.03 6,701.00 3,586.33 6,701.00
Securities purchased under
reverse repo
(i) Government Securities 5.07 600.00 44.11 -
2.4 a) Issuer composition of Non-SLR investments as at March 31, 2016:
(` in crores)
No. Issuer Amount(1) Extent of Extent of ‘below Extent of Extent of

private investment grade’ ‘unrated’ ‘unlisted’
placement securities securities(2) securities(3)
(1) (2) (3) (4) (5) (6) (7)
1. Public Sector 25.00 25.00 - - -
Undertakings
2. Financial 451.11 451.11 - - -
Institutions
3. Banks 2,600.70 2,600.70 - - -
4. Private 2,140.25 2,125.62 - - 12.00
corporates
5. Subsidiaries / - - - - -
Joint Ventures
160
(` in crores)

(1) (2) (3) (4) (5) (6) (7)
6. Others 785.58 785.58 - - -
7. Provision (56.36) (49.63) - - (2.25)
held towards
depreciation
Total 5,946.28 5,938.38 - - 9.75
Issuer composition of Non-SLR investments as at March 31, 2015:

(` in crores)

(1) (2) (3) (4) (5) (6) (7)
1. Public Sector 145.07 145.07 - - -
Undertakings
2. Financial 485.84 485.84 - - -
Institutions
3. Banks 2,474.92 2,474.92 - - -
4. Private 1,242.70 1,225.16 - - 7.00
corporates
5. Subsidiaries / 0.50 - - - 0.50
Joint Ventures
6. Others 650.03 650.03 - - -
7. Provision (26.85) (24.55) - - (2.25)
held towards
depreciation
Total 4,972.21 4,956.47 - - 5.25
Notes:
(1) Does not include amount of securities pledged with Central Counter Parties, viz., Clearing
Corporation of India Limited, National Securities Clearing Corporation of India Limited and Multi
Commodity Exchange of India Limited.
(2) Excludes investment in equity shares.
(3) Excludes investment in commercial papers, certificates of deposit and preference shares acquired
by way of conversion of debts.
(4) Amounts reported under columns 4, 5, 6 and 7 are not mutually exclusive.
161
2.4 b) Non-performing Non-SLR investments:
(` in crores)
Particulars Year ended Year ended

March 31, 2016 March 31, 2015
Opening balance 2.26 7.14
Additions during the year - 0.50
Reductions during the year - (5.38)
Closing balance 2.26 2.26
Total provisions held 2.26 2.26
2.5 During the year and the previous year, the value of sales and transfer of securities to / from HTM category,
excluding one-time transfer of securities from HTM and sale on account of Open Market Operation (OMO),
has not exceeded 5% of the book value of investments held in HTM category at the beginning of the year.
As such, in line with RBI guidelines, specific disclosures on book value, market value, and provisions if
any, relating to such sale and transfers are not required to be made.
3. Derivatives:
3.1 Interest Rate Swaps, Forward Rate Agreements and Cross Currency Swaps:
(` in crores)
Particulars As at As at
March 31, 2016 March 31, 2015
(i) Notional principal of swap agreements 93,289.75 75,786.84
(ii) Losses which would be incurred if counter parties failed 1,998.83 1,666.90
to fulfill their obligations under the agreements
(iii) Collateral required by the Bank upon entering into - -
swaps
(iv) Concentration of credit risk arising from the swaps – 56.45% 59.75%
With banks
(v) Net Fair value of the swap book 197.70 122.18
The nature and terms of Interest Rate Swaps (IRS) outstanding as on March 31, 2016 are set out below:
(` in crores)
Nature No. Notional Benchmark Terms

Principal
Merchant and Cover 1 4.26 EURIBOR Fixed Payable Vs Floating Receivable
Merchant and Cover 1 4.26 EURIBOR Fixed Receivable Vs Floating Payable
Merchant and Cover 1 3.06 LIBOR Fixed Payable Vs Floating Receivable
Merchant and Cover 1 3.06 LIBOR Fixed Receivable Vs Floating Payable
Trading 97 4,202.89 MIBOR Fixed Payable Vs Floating Receivable
Trading 66 3,149.92 MIBOR Fixed Receivable Vs Floating Payable
Trading 241 19,512.00 MIFOR Fixed Payable Vs Floating Receivable
Trading 246 18,445.00 MIFOR Fixed Receivable Vs Floating Payable
162
Principal
Trading 4 54.91 EURIBOR Fixed Payable Vs Floating Receivable
Trading 22 87.48 EURIBOR Fixed Receivable Vs Floating Payable
Trading 86 9,091.89 LIBOR Fixed Payable Vs Floating Receivable
Trading 335 9,026.66 LIBOR Fixed Receivable Vs Floating Payable
Trading 1 231.89 LIBOR Floating Receivable Vs Floating Payable
The nature and terms of IRSs outstanding as on March 31, 2015 are set out below:
(` in crores)

Principal
Merchant and Cover 1 100.00 MIBOR Fixed Payable Vs Floating Receivable
Merchant and Cover 1 100.00 MIBOR Fixed Receivable Vs Floating Payable
Trading 88 4,227.89 MIBOR Fixed Payable Vs Floating Receivable
Trading 100 5,043.49 MIBOR Fixed Receivable Vs Floating Payable
Trading 195 15,642.00 MIFOR Fixed Payable Vs Floating Receivable
Trading 196 14,915.00 MIFOR Fixed Receivable Vs Floating Payable
Merchant and Cover 1 11.25 EURIBOR Fixed Payable Vs Floating Receivable
Merchant and Cover 1 11.25 EURIBOR Fixed Receivable Vs Floating Payable
Trading 4 49.65 EURIBOR Fixed Payable Vs Floating Receivable
The nature and terms of Cross Currency Swaps (CCSs) outstanding as on March 31, 2016 are set out
below:
(` in crores)
Principal
(Cross Currency Swap)
Merchant and Cover 8 1,042.39 LIBOR Floating Payable Vs Fixed Receivable
Merchant and Cover 16 1,053.59 NA Fixed Receivable Vs Fixed Payable
(Principal Only Swap)
Merchant and Cover 15 2,026.72 NA Fixed Receivable Vs Fixed Payable
163
(` in crores)
Principal
Merchant and Cover 2 468.57 NA Fixed Receivable Vs Fixed Payable
(Coupon only swap)
Trading 1 3.75 EURIBOR Floating Payable Vs Fixed Receivable
(Coupon only swap)
Trading 226 10,243.35 LIBOR Floating Payable Vs Fixed Receivable
Trading 1 45.07 LIBOR Floating Payable Vs Fixed Receivable
Trading 35 2,272.64 NA Fixed Receivable Vs Fixed Payable
Trading 109 2,198.28 NA Fixed Receivable Vs Fixed Payable (Cross
Currency Swap)
Trading 3 499.47 NA Fixed Receivable Vs Fixed Payable
(Coupon only swap)
Trading 2 96.50 LIBOR/ Floating Receivable Vs Floating Payable
LIBOR (Cross Currency Swap)
Trading 3 666.15 LIBOR/ Floating Receivable Vs Floating Payable
MIBOR (Cross Currency Swap)
Trading 9 1,857.31 LIBOR/ Floating Receivable Vs Floating Payable
MIFOR (Cross Currency Swap)
The nature and terms of CCSs outstanding as on March 31, 2015 are set out below:
(` in crores)
Principal
Merchant and Cover 14 769.91 NA Fixed Payable (Principal Only Swap)
Merchant and Cover 14 922.40 NA Fixed Receivable (Principal Only Swap)
Merchant and Cover 15 1,974.51 NA Fixed Vs Fixed (Cross Currency Swap)
Merchant and Cover 2 112.26 NA Fixed Vs Fixed (Principal Only Swap)
Merchant and Cover 2 453.34 NA Fixed Vs Fixed (Coupon Only Swap)
164
(` in crores)
Principal
Trading 4 211.93 LIBOR Floating Vs Floating (Cross Currency
Swap)
Trading 9 398.05 NA Fixed Payable (Principal Only Swap)
Trading 18 1,192.50 NA Fixed Receivable (Principal Only Swap)
Trading 2 532.31 NA Fixed Vs Fixed (Principal Only Swap)
Trading 16 1,027.59 NA Fixed Vs Fixed (Cross Currency Swap)
Trading 3 476.78 NA Fixed Vs Fixed (Coupon Only Swap)
Trading 8 1,757.49 LIBOR / Floating Vs Floating (Cross Currency
MIFOR Swap)
(Coupon Only Swap)
3.2 Exchange Traded Interest Rate Derivatives:
The details of Exchange Traded Interest Rate Derivatives undertaken during the year ended March 31,
2016 are as below:
(` in crores)
Sr. Particulars Amount

No.
(i) Notional principal amount of exchange traded interest rate derivatives undertaken
during the year (instrument-wise)
(a) NSE840GS24 Apr 2015 291.96
(b) NSE840GS24 May 2015 124.48
(c) NSE840GS24 Jun 2015 82.39
(d) NSE840GS24 July 2015 8.20
(e) NSE772GS25 July 2015 257.63
(ii) Notional principal amount of exchange traded interest rate derivatives outstanding Nil
as on March 31, 2016 (instrument-wise)
(iii) Notional principal amount of exchange traded interest rate derivatives outstanding Nil
and not “highly effective” (instrument-wise)
(iv) Marked-to-market value of exchange traded interest rate derivatives outstanding Nil
165
The details of Exchange Traded Interest Rate Derivatives undertaken during the year ended March 31,
2015 are as below:
(` in crores)
Sr. Particulars Amount

No.
(i) Notional principal amount of exchange traded interest rate derivatives undertaken
during the year (instrument-wise)
(a) NSE883GS Apr 14 1,105.30
(b) NSE883GS May 14 2,117.03
(c) NSE883GS Jun 14 139.06
(d) NSE883GS Jul 14 852.83
(e) NSE840GS Aug 14 1,496.30
(f) NSE840GS Sep 14 476.97
(g) NSE840GS Oct 14 20.63
(h) NSE840GS Dec 14 514.50
(i) NSE840GS Jan 15 644.58
(j) NSE840GS Feb 15 732.98
(ii) Notional principal amount of exchange traded interest rate derivatives outstanding Nil
as on March 31, 2015 (instrument-wise)
(iii) Notional principal amount of exchange traded interest rate derivatives outstanding Nil
(iv) Marked-to-market value of exchange traded interest rate derivatives outstanding Nil
3.3 Disclosures on Risk Exposure in Derivatives:

Derivatives Policy approved by the Board of Directors defines the framework for carrying out derivatives
business and lays down policies and processes to measure, monitor and report risk arising from derivative
transactions. The policy provides for (a) appropriate risk limits for different derivative products and
(b) authority levels for review of limit breaches and to take appropriate actions in such events. As part of
the Derivatives Policy, the Bank has a Product Suitability and Customer Appropriateness Policy, which is
used to classify customers on the basis of their need for various derivative products and their competence
in understanding such products and the attendant risks involved.
Risk Management Department of the Bank is responsible for measuring, reporting and monitoring risk
arising from derivatives transactions. It functions independent of Treasury business and undertakes the
following activities:
0RQLWRUVGHULYDWLYHVRSHUDWLRQVDJDLQVWSUHVFULEHGSROLFLHVDQGOLPLWVRQDGDLO\EDVLV
'DLO\UHYLHZRISURGXFWZLVHSURILWDELOLW\DQGDFWLYLW\UHSRUWVIRUGHULYDWLYHVRSHUDWLRQV
'DLO\VXEPLVVLRQRI0,6DQGGHWDLOVRIH[FHSWLRQVWRWKH7RS0DQDJHPHQWDQG
0RQLWRULQJHIIHFWLYHQHVVRIGHULYDWLYHGHDOVLGHQWLILHGDVKHGJHVDJDLQVWWKHWHUPVRIWKHKHGJLQJ
instruments and underlying hedged risk.
&ROODWHUDOVDUHJHQHUDOO\NHSWDVFDVKRUFDVKHTXLYDOHQWIRUVHFXULQJGHULYDWLYHWUDQVDFWLRQV
The Risk Management function applies a host of quantitative tools and methods such as Value at Risk,
PV01, stop-loss limits, counterparty limits, deal size limits and overnight position limits.
166
The Bank undertakes derivative transactions for hedging customers’ exposure, hedging the Bank’s own
exposure, as well as for trading purposes, wherever permitted by RBI. The customers use these derivative
products to hedge their forex and interest rate exposures.
The following table presents quantitative disclosures relating to Derivatives:
(` in crores)
Sr. Particulars March 31, 2016 March 31, 2015

No. Currency Interest rate Currency Interest rate
derivatives derivatives derivatives derivatives
1. Derivatives (Notional Principal 1,79,685.56 63,817.29 1,24,224.55 51,180.43
Amount) (Note 1)
(a) For hedging - - - -
(b) For trading 1,79,685.56 63,817.29 1,24,224.55 51,180.43
2. Marked to Market Positions (Note 2)
(a) Asset (+) 3,281.39 414.34 2,506.16 383.10
(b) Liability (-) (2,753.11) (375.00) (2,503.57) (313.68)
3. Credit Exposure (note 3) 10,523.67 1,135.07 8,215.89 916.95
4. Likely impact of one percentage
change in interest rate (100*PV01)
(Note 4)
(a) on hedging derivatives - - - -
(b) on trading derivatives 58.77 51.33 8.61 8.07
5. Maximum and Minimum of 100*PV01
observed during the year (Note 5)
(a) on hedging Nil Nil Nil Nil
(b) on trading
Maximum 58.77 98.53 28.94 35.24
Minimum 1.18 4.12 0.01 0.42
Note 1: There were no outstanding currency and interest rate futures as on March 31, 2016.
Note 2: Marked to Market positions includes interest accrued on the swaps.
Note 3: Credit exposure is computed based on the current exposure method.
Note 4: Based on the absolute value of PV01 of the derivatives outstanding as at the year end.
Note 5: Based on the PV01 of the outstanding derivatives.
167
4. Asset Quality:
4.1 Non-Performing Assets:
(` in crores)
Items March 31, 2016 March 31, 2015

(i) Net NPAs to Net Advances (%) 0.36% 0.31%
(ii) Movement of Gross NPAs
(a) Opening balance 562.92 620.79
(b) Additions during the year 848.65 887.29
Sub-total (A) 1,411.57 1,508.08
(c) Reductions during the year
(i) Upgradations 51.68 66.85
(ii) Recoveries (excluding recoveries made from 302.42 275.86
upgraded accounts)
(iii) Technical / Prudential write-offs - -
(iv) Write-offs other than those under (iii) above 280.65 602.45
Sub-total (B) 634.75 945.16
(d) Closing balance (A-B) 776.82 562.92
(iii) Movement of Net NPAs
(b) Additions during the year 331.36 202.74
(c) Reductions during the year 220.09 176.31
(d) Closing balance 321.75 210.48
(iv) Movement of provisions for NPAs
(excluding provisions on standard assets)
(b) Provisions made during the year 517.29 684.55
(c) Write-off / write-back of excess provisions 414.66 768.85
(d) Closing balance 455.07 352.44
Notes:
1) Recoveries include sale to SC / RC.
2) In terms of RBI circular DBOD.BP.BC.No.98/21.04.132/2013-14 dated February 26, 2014, in respect
of assets sold to SC / RCs, during the last quarter of the year ended March 31, 2015, the loss on
sale arrived at by deducting sale consideration and provisions held as on the date of sale from the
outstanding amount, is being amortized over a period of two years. Accordingly, the Bank has charged
to the Profit and Loss account an amount of ` 128.36 crores (Previous Year ` 32.09 crores) during the
year ended March 31, 2016.
4.2 Provision coverage ratio:
Provision coverage ratio as at March 31, 2016 is 58.58% (Previous Year 62.61%).
168
4.3 Details of technical write-offs and recoveries made thereon:
(` in crores)

Opening balance of Technical / Prudential written off accounts Nil Nil
Add : Technical / Prudential write-offs during the year Nil Nil
Sub-total Nil Nil
Less : Recoveries made from previously Technical / Prudential Nil Nil
written-off accounts during the year
Closing balance of Technical / Prudential written-off accounts Nil Nil
4.4 Sector-wise advances:
(` in crores)
Sr. Sector 2015-16 2014-15

No.
Outstanding Gross % of Gross Outstanding Gross % of Gross
Total NPAs NPAs Total NPAs NPAs
Advances to Total Advances to Total
Advances Advances
A Priority Sector
1. Agriculture and 9,296.77 67.93 0.73% 7,984.73 55.12 0.69%
allied activities
2. Advances to 1,559.51 1.03 0.07% 1,082.40 0.55 0.05%
industries sector
eligible as priority
sector lending
of which:
(a) Gems and 945.13 - - 327.43 - -
Jewellery
(b) Construction 0.37 - - 1.95 - -
(Other than
Infrastructure)
(c) Power 0.27 - - 0.56 - -
3. Services 17,284.64 177.03 1.02% 13,899.55 167.77 1.21%
4. Personal loans 42.85 5.32 12.42% 50.62 4.76 9.40%
Sub-total (A) 28,183.77 251.31 0.89% 23,017.30 228.20 0.99%
B Non Priority
Sector
1. Agriculture and - - - - - -
allied activities
2. Industry 19,346.19 190.18 0.98% 13,301.07 103.70 0.78%
of which:
(a) Gems and 4,320.34 41.77 0.97% 1,332.62 34.80 2.61%
Jewellery
(b) Construction 1,129.20 44.64 3.95% 1,532.60 11.55 0.75%
(Other than
Infrastructure)
(c) Power 4,921.34 - - 2,438.97 - -
3. Services 37,846.29 178.01 0.47% 30,017.76 121.07 0.40%
4. Personal loans 3,498.16 157.32 4.50% 2,804.51 109.95 3.92%
Sub-total (B) 60,690.64 525.51 0.87% 46,123.34 334.72 0.73%
Total (A+B) 88,874.41 776.82 0.87% 69,140.64 562.92 0.81%
169
4.5 Details of Loan Assets subjected to Restructuring as on March 31, 2016:
170
(` in crores)
SN Type of Restructuringĺ Under CDR Mechanism $ Under SME Debt Restructuring Mechanism Others Total
Asset Classificationĺ Stan Sub- Doubtful Loss Total Stan Sub- Doubtful Loss Total Stan Sub- Doubtful Loss Total Stan Sub- Doubtful Loss Total
DetailsĻ dard Stan dard Stan dard Stan dard Stan
dard dard dard dard
1 Restructured No. of borrowers 13 - - - 13 2 - - - 2 - - 1 - 1 15 - 1 - 16
Accounts as on Amount outstanding 405.42 - - - 405.42 32.33 - - - 32.33 - - 0.24 - 0.24 437.75 - 0.24 - 437.99
01/04/2015
Provision thereon 68.34 - - - 68.34 2.49 - - - 2.49 - - 0.10 - 0.10 70.83 - 0.10 - 70.93
2 Fresh No. of borrowers - - - - - - - - - - 2 - - - 2 2 - - - 2
restructuring Amount outstanding 29.03 - - - 29.03 1.51 - - - 1.51 173.55 - - - 173.55 204.09 - - - 204.09
during the year
Provision thereon 8.30 - - - 8.30 1.79 - - - 1.79 10.00 - - - 10.00 20.09 - - - 20.09
3 Upgradation No. of borrowers - - - - - - - - - - - - - - - - - - - -
to restructured Amount outstanding - - - - - - - - - - - - - - - - - - - -
standard
category during Provision thereon - - - - - - - - - - - - - - - - - - - -
the FY
4 Restructured No. of borrowers -1 -1 - - - - -1 -1
standard
advances Amount outstanding -2.72 -2.72 - - - - -2.72 -2.72
which cease to Provision thereon - - - - - - - -
attract higher
provisioning and
/ or additional
risk weight at the
end of the FY
and hence need
not be shown
as restructured
standard
advances at the
beginning of the
next FY
5 Downgradations No. of borrowers -4 - 4 - - - - - - - - - - - - -4 - 4 - -
of restructured Amount outstanding -89.07 - 89.07 - - - - - - - - - - - - -89.07 - 89.07 - -
accounts during
the FY Provision thereon -21.90 - 21.90 - - - - - - - - - - - - -21.90 - 21.90 - -
6 Write-offs of No. of borrowers - - -4 - -4 - - - - - - - -1 - -1 - - -5 - -5
restructured Amount outstanding -7.67 - -89.07 - -96.74 -7.06 - - - -7.06 - - -0.24 - -0.24 -14.73 - -89.31 - -104.04
accounts during
the FY 2015-16 Provision thereon -3.85 - -21.90 - -25.75 - - - - - - - -0.10 - -0.10 -3.85 - -22.00 - -25.85
7 Restructured No. of borrowers 8 - - - 8 2 - - - 2 2 - - - 2 12 - - - 12
Accounts as on Amount outstanding 334.99 - - - 334.99 26.78 - - - 26.78 173.55 - - - 173.55 535.32 - - - 535.32
31/03/2016
(closing figure) Provision thereon 50.89 - - - 50.89 4.28 - - - 4.28 10.00 - - - 10.00 65.17 - - - 65.17
1. Provision also includes FITL / NPA provision, wherever applicable, in addition to provision for diminution in fair value.
2. Sr. No. 2 includes additions to existing restructured accounts of ` 30.54 crores (provision ` 10.09 crores).
3. Sr. No. 6 includes reductions in existing restructured accounts of ` 104.04 crores (provision ` 25.85 crores). This also includes accounts which have exited CDR / Bank has done
OTS with / sold to ARC / Restructuring Failures.
$ Excluding Optionally Convertible Cumulative Redeemable Preference Shares (OCCRPS) of ` 12.46 crores.
4.5 Details of Loan Assets subjected to Restructuring as on March 31, 2015:
(` in crores)
SN Type of Restructuringĺ Under CDR Mechanism $ Under SME Debt Restructuring Mechanism Others Total
Asset Classificationĺ Stan Sub- Doubtful Loss Total Stan Sub- Doubtful Loss Total Stan Sub- Doubtful Loss Total Stan Sub- Doubtful Loss Total
DetailsĻ dard Stan dard Stan dard Stan dard Stan
dard dard dard dard
1 Restructured No. of borrowers 12 1 - - 13 - - - - - - - - - - 12 1 - - 13
Accounts as on Amount outstanding 229.66 1.28 - - 230.94 - - - - - - - - - - 229.66 1.28 - - 230.94
01/04/2014
Provision thereon 45.26 1.28 - - 46.54 - - - - - - - - - - 45.26 1.28 - - 46.54
2 Fresh No. of borrowers 7 - - - 7 3 - - - 3 - 1 1 - 2 10 1 1 - 12
restructuring Amount outstanding 421.39 - - - 421.39 33.33 - - - 33.33 - 0.71 0.24 - 0.95 454.72 0.71 0.24 - 455.67
during the year
Provision thereon 68.85 - - - 68.85 2.59 - - - 2.59 - 0.14 0.10 - 0.24 71.44 0.14 0.10 - 71.68
3 Upgradation No. of borrowers - - - - - - - - - - - - - - - - - - - -
to restructured Amount outstanding - - - - - - - - - - - - - - - - - - - -
standard
category during Provision thereon - - - - - - - - - - - - - - - - - - - -
the FY
4 Restructured No. of borrowers -3 -3 - - - - -3 -3
standard
advances Amount outstanding -52.56 -52.56 - - - - -52.56 -52.56
which cease to Provision thereon -7.57 -7.57 - - - - -7.57 -7.57
attract higher
provisioning and
/ or additional
risk weight at the
end of the FY
and hence need
not be shown
as restructured
standard
advances at the
beginning of the
next FY
5 Downgradations No. of borrowers -3 2 1 - - -1 1 - - - - - - - - -4 3 1 - -
of restructured Amount outstanding -144.94 143.66 1.28 - - -1.0 1.0 - - - - - - - - -145.94 144.66 1.28 - -
accounts during
the FY Provision thereon -29.77 28.49 1.28 - - -0.10 0.10 - - - - - - - - -29.87 28.59 1.28 - -
6 Write-offs of No. of borrowers - 3 1 - 4 - 1 - - 1 - 1 - - 1 - 5 1 - 6
restructured Amount outstanding 48.13 144.94 1.28 - 194.35 - 1.0 - - 1.0 - 0.71 - - 0.71 48.13 146.65 1.28 - 196.06
accounts during
the FY 2014-15 Provision thereon 8.43 29.77 1.28 - 39.48 - 0.10 - - 0.10 - 0.14 - - 0.14 8.43 30.01 1.28 - 39.72
7 Restructured No. of borrowers 13 - - - 13 2 - - - 2 - - 1 - 1 15 - 1 - 16
Accounts as on Amount outstanding 405.42 - - - 405.42 32.33 - - - 32.33 - - 0.24 - 0.24 437.75 - 0.24 - 437.99
31/03/2015
(closing figure) Provision thereon 68.34 - - - 68.34 2.49 - - - 2.49 - - 0.10 - 0.10 70.83 - 0.10 - 70.93
1. Provision also includes FITL / NPA provision, wherever applicable, in addition to provision for diminution in fair value.
2. Sr. No. 2 includes ` 10.41 crores of additions to existing restructured accounts (number of accounts 5, provision thereon ` 5.54 crores).
3. Sr. No. 6 includes ` 48.13 crores (number of accounts 4, provision thereon ` 8.43 crores) of reduction from existing restructured accounts by way of sale / recovery / exit from CDR
/ OTS by the Bank.
$ Excluding Optionally Convertible Cumulative Redeemable Preference Shares (OCCRPS) of `14.79 crores.
171
4.6 a) Details of financial assets sold to Securitisation Company (SC) / Reconstruction Company
(RC) for asset reconstruction:
(` in crores)
Items 2015-16 2014-15
1. No. of accounts 1,895 1,068
2. Aggregate value (net of provisions) of accounts sold to SC / RC 179.87 455.53
3. Aggregate consideration 163.13 194.00
4. Additional consideration realized in respect of accounts - 0.72
transferred in earlier years
5. Aggregate gain / (loss) over net book value (16.74) (260.81)
b) Details of book value of investment in security receipts:

(` in crores)
Particulars 2015-16 2014-15

Backed by NPAs sold by the Bank as underlying 213.51 160.29
Backed by NPAs sold by the other Banks / Financial Institutions /
- -
Non-Banking Financial Companies as underlying
Total 213.51 160.29
4.7 During the year, there has been no individual purchase / sale of non-performing financial assets from / to
other banks (Previous Year Nil).
4.8 During the year, there was no sale of assets through securitization except sale of assets to SC / RC
(Previous Year Nil).
4.9 Provision on Standard Assets:
In accordance with RBI guidelines, general provision on standard assets is made at the following rates:
(a) At 1% on standard advances to Commercial Real Estate Sector;
(b) At 0.25% on standard direct advances to SME and Agriculture; and
(c) At 0.40% of the balance outstanding in other standard assets.
Standard assets provision as at March 31, 2016, also includes additional provision made on restructured
standard assets in compliance with RBI guidelines.
The provision on standard assets is included in ‘Other Liabilities and Provisions – Others’ in Schedule 5,
and is not netted off from Advances. The amount of provision held on standard assets is as below:
(` in crores)
Cumulative Provision held for Standard Assets 455.69 343.09
[Including ` 27.24 crores towards UFCE of clients
(Previous Year ` 32.00 crores)]
4.10 Unhedged Foreign Currency Exposure (UFCE) of Clients:
Foreign exchange risk is the risk of loss arising out of adverse movements in foreign exchange rates
affecting both on-balance sheet and off-balance sheet exposures. The forex positions that are not
effectively hedged either by way of natural hedge or through derivatives / forward contracts expose a
client to the risk of loss due to volatility in the forex rates. The Bank assesses the risk arising out of such
UFCE of the clients at the time of credit appraisal and monitors the same at regular intervals. The provision
for standard assets as of March 31, 2016, included an amount of ` 27.24 crores (Previous Year ` 32.00
crores) towards UFCE. Further, capital held under Basel III Capital Regulations, as of March 31, 2016,
includes an amount of ` 52.47 crores (Previous Year ` 101.50 crores) on account of UFCE, computed at
the applicable risk weights.
172
4.11 Floating provision:
(` in crores)

Opening Balance as at beginning of the year - 50.00
Provisions made during the year - -
Draw-down made during the year - 50.00
Closing Balance as at end of the year - -
5. Business ratios:
Ratio March 31, 2016 March 31, 2015

(i) Interest income as a percentage to working funds 9.67% 10.27%
(ii) Non-interest income as a percentage to working funds 2.75% 2.70%
(iii) Operating profit as a percentage to working funds 3.46% 3.28%
(iv) Return on assets 1.91% 1.90%
(v) Business (deposits plus gross advances) per employee 764.55 719.23
(` in lakhs)
(vi) Profit per employee (` in lakhs) 9.92 9.38
Notes:
(1) Working funds are reckoned as the average of total assets as per the monthly returns in Form X filed with
RBI during the year.
(2) Returns on Assets are computed with reference to average working funds.
(3) Business per employee (deposits plus gross advances) is computed after excluding Inter-bank deposits.
6. Asset Liability Management:
6.1 Maturity Pattern of certain items of Assets and Liabilities:
a) As at March 31, 2016:
(` in crores)
Day 1 2 to 8 to 15 to 29 days to Over Over Over Over Over Total
7 Days 14 Days 28 Days 3 months 3 months to 6 months 1 year to 3 years to 5 years
6 months to 1 year 3 years 5 years
Deposits 377.19 2,903.38 2,669.00 4,186.32 16,194.84 6,573.26 16,645.95 14,472.24 10,323.07 18,655.10 93,000.35
Loans & 728.45 7,975.86 1,909.57 2,448.64 12,867.24 5,783.52 10,888.79 32,790.97 9,126.65 5,599.65 90,119.34
Advances $
Investments* - 31.20 50.03 - 1,930.87 2,876.00 4,345.55 3,038.97 4,055.44 17,726.24 34,054.30
Borrowings 0.30 6,365.89 165.64 662.55 - 3,496.62 3,475.72 7,014.60 265.64 708.90 22,155.86
Foreign 988.02 1,487.92 715.36 659.63 4,252.44 868.20 714.54 4,817.66 219.86 37.58 14,761.21
currency
assets
Foreign 519.31 835.55 200.10 680.51 158.07 456.95 1,316.62 5,839.60 2,344.06 264.83 12,615.60
currency
liabilities
$
Loans & Advances includes BRDS of ` 1,700.00 crores.
* Investment is inclusive of Repo under LAF of ` 2,839.99 crores.
173
b) As at March 31, 2015:
(` in crores)
Day 1 2 to 8 to 15 to 29 days to Over Over Over Over Over Total

7 Days 14 Days 28 Days 3 months 3 months to 6 months 1 year to 3 3 years to 5 years
6 months to 1 year years 5 years
Deposits 408.81 3,240.39 2,253.60 2,215.14 15,027.87 6,635.78 9,213.56 9,004.60 3,573.69 22,560.92 74,134.36
Loans & 817.59 2,922.61 2,751.50 843.61 3,748.76 4,023.05 6,134.01 35,284.31 6,890.32 5,372.44 68,788.20
Advances
Investments* - - 205.00 - 3,600.70 1,061.94 2,631.07 2,705.07 4,204.93 15,170.63 29,579.34
Borrowings 0.02 3,643.85 937.50 - 893.75 1,591.69 5,382.44 7,203.66 156.25 808.90 20,618.06
Foreign 250.41 1,116.79 394.51 174.26 468.82 481.77 292.85 6,464.82 250.73 156.07 10,051.03
currency
assets
Foreign 67.89 632.62 963.31 14.88 918.21 626.11 2,844.92 2,532.60 1,570.69 262.97 10,434.20
currency
liabilities
* Investment is inclusive of Repo under LAF of ` 6,701.00 crores.
6.2 Liquidity Coverage Ratio (LCR):
The Bank adheres to RBI guidelines relating to the Liquidity Coverage Ratio, Liquidity Risk Monitoring Tools and
the LCR Disclosure Standards pursuant to the Basel III Framework on Liquidity Standards that are applicable to
banks in India with effect from January 1, 2015. LCR, as laid down in the guidelines, measures the Bank’s ability
to manage and survive under combined idiosyncratic and market-wide liquidity stress condition that would
result in accelerated withdrawal of deposits from retail as well wholesale depositors, partial loss of secured
funding, increase in collateral requirements, unscheduled draw down of unused credit lines, etc.
The Bank depends on balanced funding from retail as well as wholesale depositors. The Bank computes LCR in
all significant currencies using the factors mentioned in RBI guidelines. High Quality Liquid Assets (HQLA) of the
Bank consist of cash, unencumbered excess SLR, a portion of statutory SLR as allowed under the guidelines,
cash balance with RBI in excess of statutory cash reserve requirements, and high rated corporate bonds issued
by entities other than financial institutions. Major components of the Bank’s Balance Sheet are in domestic
currency, and it uses foreign currency sources to predominantly fund foreign currency advances.
Collaterals are generally kept as cash or cash equivalent for securing derivative transactions. The largest
absolute net 30-day collateral flows realized during the preceding 24 months has been considered as potential
outflow on account of change in valuation of derivative trades.
The Asset Liability Management Committee (ALCO) of the Bank is the governing body to decide on composition
of funding sources and accordingly guide different business units. The Balance Sheet Management Group
(BSMG), under the guidance of the ALCO, is responsible for operationalizing liquidity management within the
Bank.
174
Quantitative disclosure:
Following is the quantitative disclosures relating to LCR:
(` in crores)
June 2015 September 2015 December 2015 March 2016 2014-15

Total Total Total Total Total Total Total Total Total Total
Unweighted Weighted Unweighted Weighted Unweighted Weighted Unweighted Weighted Unweighted Weighted
Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average)
High Quality Liquid Assets
1. Total High Quality Liquid Assets 9,557.52 11,841.21 11,733.66 12,903.00 7,559.71
(HQLA)
Cash Outflows
2. Retail deposits and deposits

from small business customers,
of which:
(i) Stable deposits 2,766.37 138.32 2,864.87 143.24 2,960.13 148.01 3,032.24 151.61 8,038.57 401.93
(ii) Less stable deposits 16,460.26 1,646.03 18,372.99 1,837.30 19,697.69 1,969.77 22,194.65 2,219.47 13,876.10 1,387.61
3. Unsecured wholesale funding,

of which:
(i) Operational deposits (all - - - - - - - - 6,925.64 1,714.42

counterparties)
(ii) Non-operational deposits (all 26,370.99 16,622.54 24,874.93 15,808.17 27,084.72 15,780.49 34,318.38 21,888.93 11,883.13 9,263.78
counterparties)
(iii) Unsecured debt - - - - - - - - - -
4. Secured wholesale funding - - - - -
5. Additional requirements, of which
(i) Outflows related to derivative 7,903.68 7,903.68 9,429.77 9,429.77 7,609.27 7,609.27 12,168.11 12,168.11 7,780.53 7,780.53
exposures and other collateral
requirements
(ii) Outflows related to loss of funding - - - - - - - - - -

on debt products
(iii) Credit and liquidity facilities - - - - - - - - - -
6. Other contractual funding 468.81 468.81 2,361.44 2,361.44 4,551.53 4,551.53 2,306.97 2,306.97 3,060.62 3,060.62
obligations
175
Quantitative disclosure: (Contd.)
176
June 2015 September 2015 December 2015 March 2016 2014-15
Total Total Total Total Total Total Total Total Total Total
Unweighted Weighted Unweighted Weighted Unweighted Weighted Unweighted Weighted Unweighted Weighted
Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average) Value (average)
7. Other contingent funding 5,971.86 298.59 13,685.39 684.27 9,279.39 463.97 13,234.49 520.37 3,844.25 192.21
obligations
8. Total Cash Outflows 27,077.97 30,264.19 30,523.04 39,255.46 23,801.10
Cash Inflows
9. Secured lending (e.g. reverse - - - - - - - - - -

repos)
10. Inflows from fully performing 12,610.68 11,673.64 15,424.80 14,307.59 14,025.44 12,841.11 23,436.16 20,994.41 14,776.54 11,557.55
exposures
11. Other cash inflows 1,442.66 721.33 - - - - - - - -
12. Total Cash Inflows 12,394.97 14,307.59 12,841.11 20,994.41 11,557.55
Total Adjusted Total Adjusted Total Adjusted Total Adjusted Total Adjusted
Value Value Value Value Value
13. Total HQLA 9,557.52 11,841.21 11,733.66 12,903.00 7,559.71
14. Total Net Cash Outflows 14,683.00 15,956.60 17,681.93 18,261.05 12,243.55
15. Liquidity Coverage Ratio (%) 65.09% 74.21% 66.36% 70.66% 61.74%
7. Exposures:
7.1 Exposure to Real Estate Sector:
(` in crores)
Particulars March 31, 2016 March 31, 2015

(a) Direct exposure
(i) Residential Mortgages - of which housing loans eligible for 5,708.29 3,844.71
inclusion in priority sector advance ` 43.89 crores (Previous
Year ` 51.11 crores)(1)
(ii) Commercial Real Estate(2) 10,122.55 7,758.87
(iii) Investments in Mortgage Backed Securities (MBS) and other
securitized exposures:
Residential - -
Commercial Real Estate - -
(b) Indirect exposure 2,725.26 1,704.95
Fund based and non-fund based exposures on National Housing
Bank (NHB) and Housing Finance Companies (HFCs)
Total Real Estate Exposure 18,556.10 13,308.53
(1)
As per RBI circular FIDD.CO.Plan.BC.54/04.09.01/2014-15 dated April 23, 2015, limit for housing
loan under priority sector has been changed from ` 25 lakhs to ` 28 lakhs.
(2)
Does not include corporate lending backed by mortgage of land and building.
7.2 Exposure to Capital Market:
(` in crores)

(i) Direct investment in equity shares, convertible bonds, 47.96 16.77
convertible debentures and units of equity oriented mutual
funds the corpus of which is not exclusively invested in
corporate debt
(ii) Advances against shares / bonds / debentures or other Nil Nil
securities or on clean basis to individuals for investment
in shares (including IPOs / ESOPs), convertible bonds,
convertible debentures, and units of equity-oriented mutual
funds
(iii) Advances for any other purposes where shares or 54.96 5.45
convertible bonds or convertible debentures or units of
equity oriented mutual funds are taken as primary security
(iv) Advances for any other purposes to the extent secured by 2,260.29 528.87
the collateral security of shares or convertible bonds or
convertible debentures or units of equity oriented mutual
funds i.e. where the primary security other than shares /
convertible bonds / convertible debentures / units of equity
oriented mutual funds does not fully cover the advances
177
(v) Secured and unsecured advances to stockbrokers and 2,049.98 2,124.28
guarantees issued on behalf of stockbrokers and market
makers
(vi) Loans sanctioned to corporates against the security of Nil Nil
shares / bonds / debentures or other securities or on clean
basis for meeting promoter’s contribution to the equity of
new companies in anticipation of raising resources
(vii) Bridge loans to companies against expected equity flows / Nil Nil
issues
(viii) Underwriting commitments taken up by the banks in Nil Nil
respect of primary issue of shares or convertible bonds or
convertible debentures or units of equity oriented mutual
funds
(ix) Financing to stockbrokers for margin trading Nil Nil
(x) All exposures to Venture Capital Funds (both registered and 20.00 Nil
unregistered)
Total Exposure to Capital Market 4,433.19 2,675.37
During the year, Bank has converted debt of ` 9.09 crores to equity as a part of strategic debt restructuring
which is exempt from CME limit.
7.3 Risk Category-wise exposure to country risk:
(` in crores)
Risk category Exposure (net) Provision held Exposure (net) Provision held
as at as at as at as at
March 31, 2016 March 31, 2016 March 31, 2015 March 31, 2015
Insignificant 587.53 - 326.98 -
Low 2,286.44 - 1,344.63 -
Moderate 88.61 - 55.06 -
High 762.38 - 511.09 -
Very High 69.31 - 5.67 -
Restricted 4.49 - 3.24 -
Off Credit 5.79 - - -
Total 3,804.55 - 2,246.67 -
7.4 Single borrower limit and Group Borrower Limit:

During the year ended March 31, 2016, the Bank’s credit exposures to single borrowers and group
borrowers were within the prudential limits prescribed by RBI except in case of Vodafone Mobile Services
Limited, where the single borrower limit was exceeded. This exposure has been approved by the Board
of Directors of the Bank as it was within the prudential limit. During the year ended March 31, 2015,
the Bank’s credit exposures to single borrowers and group borrowers were within the prudential limits
prescribed by RBI.
7.5 Unsecured advances:
The Bank has not extended any project advances where the collateral is an intangible asset such as
a charge over rights, licenses, authorizations etc. (Previous Year Nil). The Unsecured Advances of
` 10,515.54 crores (Previous Year ` 8,818.10 crores) as disclosed in Schedule 9B (iii) are without any
collateral or security.
178
8. Concentration of Deposits, Advances, Exposures and NPAs:
8.1 Concentration of Deposits:
(` in crores)
As on As on
March 31, 2016 March 31, 2015
Total Deposits of twenty largest depositors 25,558.51 19,329.88
Percentage of Deposits of twenty largest depositors to Total 27.48% 26.07%
Deposits of the Bank
8.2 Concentration of Advances:
(` in crores)
As on As on
March 31, 2016 March 31, 2015
Total Advances to twenty largest borrowers 26,797.58 22,566.46
Percentage of Advances of twenty largest borrowers to Total 16.17% 17.50%
Advances of the Bank
Advances are computed as per the definition of Credit Exposure including derivatives as prescribed in
Master Circular on Exposure Norms DBR.No.Dir.BC. 12/13.03.00/2015-16 dated July 1, 2015.
8.3 Concentration of Exposures:
(` in crores)
As on As on
March 31, 2016 March 31, 2015
Total Exposure to twenty largest borrowers / customers 26,850.88 22,847.85
Percentage of Exposure of twenty largest borrowers / 15.69% 17.14%
customers to Total Exposure of the Bank on borrowers /
customers
Exposures are computed as per the definition in Master Circular on Exposure Norms DBR.No.Dir.
BC.12/13.03.00/2015-16 dated July 1, 2015 and includes credit, derivatives and investment exposure.
8.4 Concentration of NPAs:
(` in crores)
As on As on
March 31, 2016 March 31, 2015
Total Exposure to top four NPA accounts 141.40 100.49
8.5 Intra-Group Exposure:
(` in crores)
As on As on
March 31, 2016 March 31, 2015
Total amount of intra-group exposure Nil Nil
Total amount of top-20 intra-group exposure Nil Nil
Percentage of Intra Group Exposure to Total Exposure of the Nil Nil
Bank on borrower/ Customer
Details of Breach of Limit on Intra Group exposure and Nil Nil
Regulatory action thereon, if any
179
9. Miscellaneous:
9.1 Amount of Provisions for taxation during the year:
(` in crores)

Provision for Income Tax 1,332.38 836.95
Deferred tax credit (149.57) 78.05
Provision for Wealth tax - 0.45
Total 1,182.81 915.45
9.2 Disclosure of penalties imposed by RBI:
During the year, RBI has not imposed any penalty on the Bank under section 46(4) of the Banking
Regulation Act, 1949 (Previous Year ` 0.10 crores).
9.3 Fixed Assets:
9.3.1 Cost of premises includes ` 4.09 crores (Previous Year ` 4.09 crores) in respect of properties for which
execution of documents and registration formalities are in progress. Of these properties, the Bank has not
obtained full possession of one property having written down value of ` 1.59 crores (Previous Year ` 1.63
crores) and has filed a suit for the same.
9.3.2 Computer software:
The movement in fixed assets capitalized as computer software is given below:
(` in crores)

At cost at the beginning of the year 209.36 178.11
Addition during the year 71.12 31.25
Deduction during the year - -
Accumulated Depreciation as at 31 March 160.31 127.96
Closing Balance as at 31 March 120.17 81.40
Depreciation charge for the year 32.35 24.52
9.4 Contingent Liabilities:
The Bank’s pending litigations comprise of claims against the Bank by the clients and proceedings
pending with Income Tax authorities. The Bank has reviewed all its pending litigations and proceedings
and has adequately provided for where provisions are required and disclosed as contingent liabilities
where applicable, in its financial statements. Claims against the Bank not acknowledged as debts
comprise of tax demands of ` 159.24 crores (Previous Year ` 161.32 crores) in respect of which the Bank
is in appeal and the legal cases sub judice of ` 489.35 crores (Previous Year ` 386.42 crores). The Bank
carries a provision of ` 4.48 crores (Previous Year ` 3.97 crores) against cases sub judice. The amount of
contingent liabilities is based on management’s estimate, and no significant liability is expected to arise
out of the same.
9.5 The Bank has a process whereby periodically all long term contracts (including derivative contracts)
are assessed for material foreseeable losses. At the year end, the Bank has reviewed and ensured that
adequate provision as required under any law / accounting standards for material foreseeable losses on
such long term contracts (including derivative contracts) has been made in the books of account.
180
9.6.1 Bancassurance business:
Commission, Exchange and Brokerage in Schedule 14 include the following fees earned on Bancassurance
business:
(` in crores)
Nature of Income 2015-16 2014-15

For selling life insurance policies 40.17 47.20
For selling non-life insurance policies 48.07 39.73
For selling mutual fund products 59.68 78.77
Others - -
Total 147.92 165.70
9.6.2 The Bank does not have any overseas branches and hence the disclosure regarding overseas assets,
NPAs and revenue is not applicable (Previous year Nil).
9.6.3 The Bank does not have any Off-Balance Sheet SPVs (which are required to be consolidated as per
accounting standards) (Previous year Nil).
9.7 Disclosure relating to Depositor Education and Awareness Fund (DEAF):
(` in crores)
Opening balance of amounts transferred to DEAF 12.53 Nil
Add: Amounts transferred during the year 3.17 12.72
Less: Amounts reimbursed by DEAF towards claims 0.11 0.19
Closing balance of amounts transferred to DEAF 15.59 12.53
9.8 There is no delay in transferring amounts to Investor Education and Protection Fund by the Bank (Previous
Year Nil).
9.9 Corporate Social Responsibility (CSR):
The Bank has spent an amount of ` 27.32 crores (Previous Year ` 17.54 crores ) towards CSR initiatives
through various projects in the areas of Rural Development and Inclusiveness, Environment Sustainability,
Preventive Healthcare and certain areas of special interest such as Environmental, Education, etc. Of
the total CSR spends, an amount of ` 22.30 crores (Previous Year ` 14.58 crores) was incurred towards
capital expenditure.
9.10 Drawdown from Reserves:
The Bank has not undertaken any drawdown from reserves during the year ended March 31, 2016, except
towards share issue expenses incurred for the equity share capital raised through a Qualified Institutions
Placement (QIP) and a Preferential Allotment, which have been adjusted against the share premium
account in terms of Section 52 of the Companies Act, 2013. There has been no drawdown from the
reserves during the year ended March 31, 2015.
9.11 Credit default swaps:
The Bank has not undertaken any transactions in Credit Default Swaps (CDS) during the year (Previous
Year Nil).
9.12 Marked to market gain or loss on forex and derivative transactions is presented on gross basis. Had this
been presented on net basis as hitherto, the amount of each of Other Liabilities and Provisions, Other
Assets and the total of Balance Sheet would have been lower by ` 1,789.66 crores on March 31, 2016 and
` 2,671.45 crores on March 31, 2015. The above change in presentation has no impact on the profit of the
Bank for the year ended March 31, 2016 or the previous period.
181
9.13 During the year, the Bank regrouped sourcing costs relating to small ticket retail loan origination and bank
charges incurred by the Consumer Finance Division under “Operating Expenses” which were hitherto
netted off from “Other income” in order to be aligned with practice followed by the industry. Figures for
the previous periods have been regrouped / reclassified accordingly. This change in classification has no
impact on the profit of the Bank for the year ended March 31, 2016 or the previous year.
9.14 During the year, the Bank acquired the Diamond and Jewellery financing business of Royal Bank of
Scotland N.V., which inter alia included an advance portfolio of ` 4,130.40 crores, as a going concern
on a slump sale basis. The business take-over was completed on July 24, 2015, and all the assets and
mutually agreed liabilities of the said Diamond and Jewellery financing business became part of the
Bank’s Balance Sheet on that date. The price paid towards acquisition of the business was allocated
to the assets and liabilities on the basis of their fair value on the acquisition date and accounted for
accordingly. The incomes generated by the business on and from that date, and the assets and liabilities
pertaining to the business have been duly considered in the Profit and Loss Account for the year ended
and the Balance Sheet as at March 31, 2016, respectively.
9.15 Movement in depreciation of Fixed Assets:
(` in crores)
Depreciation 2015-16 2014-15

Premises
At the beginning of the year 58.99 50.49
Transferred from Revaluation Reserve 6.20 6.26
Charge for the year 2.07 2.24
Deduction during the year 0.54 -
Depreciation to date 66.72 58.99
Other Fixed Assets
At the beginning of the year 649.79 563.44
Charge for the year 154.45 124.61
Deduction during the year 33.15 38.26
Depreciation to date 771.09 649.79
10. Employee Stock Option Scheme (ESOS):
10.1 The shareholders of the Bank approved Employee Stock Option Scheme (ESOS) on September 18, 2007.
ESOS enables the Board and / or the HR and Remuneration Committee to grant such number of stock
options of the Bank not exceeding 7% of the aggregate number of issued and paid up equity shares of
the Bank, in line with the guidelines of the Securities & Exchange Board of India (SEBI). The options vest
within a maximum period of five years from the date of grant of option. The exercise price for each grant is
decided by the Compensation Committee, which is normally based on the latest available closing price.
Upon vesting, the options have to be exercised within a maximum period of five years. The stock options
are equity settled where the employees will receive one equity share per stock option.
Pursuant to the ESOS 2007 scheme, the HR and Remuneration Committee of the Bank has granted
3,75,70,300 options as set out below:
Sr. No. Date of grant No of options Range of exercise price (`)

1. 18-Jul-08 1,21,65,000 48.00 - 50.60
2. 17-Dec-08 34,56,000 38.95
3. 05-May-09 8,15,500 44.00
4. 31-Aug-09 3,18,500 100.05
182
Sr. No. Date of grant No of options Range of exercise price (`)
5. 28-Jan-10 7,47,000 48.00 - 140.15
6. 28-Jun-10 13,57,450 196.50
7. 14-Sep-10 73,500 236.20
8. 26-Oct-10 1,43,500 274.80
9. 17-Jan-11 25,00,000 228.70
10. 07-Feb-11 20,49,000 95.45 - 220.45
11. 24-Jun-11 21,54,750 253.60
12. 16-Aug-11 89,500 254.90
13. 30-Sep-11 2,61,000 262.25
14. 21-Dec-11 9,20,000 231.95
15. 29-Feb-12 1,95,000 304.05
16. 19-Apr-12 1,40,500 345.60
17. 25-May-12 1,34,500 304.55
18. 10-Jul-12 2,67,000 343.25
19. 29-Aug-12 1,14,000 319.05
20. 10-Oct-12 23,500 365.75
21. 09-Jan-13 30,000 433.75
22. 18-Apr-13 12,500 419.60
23. 20-Jun-13 1,75,000 478.45
24. 18-Jul-13 18,35,000 453.90
25. 23-Sep-13 75,000 411.50
26. 29-Oct-13 22,000 412.25
27. 29-Jan-14 7,67,500 300.00 - 389.85
28. 25-Mar-14 1,76,500 490.30
29. 15-May-14 65,500 537.05
30. 02-Jun-14 32,69,500 533.95
31. 09-Jul-14 33,000 551.10
32. 13-Oct-14 74,500 623.25
33. 17-Jan-15 47,500 831.85
34. 23-Feb-15 48,000 876.80
35. 30-Mar-15 11,000 880.75
36. 22-May-15 52,600 848.20
37. 24-Jul-15 16,30,000 949.80
38. 21-Sep-15 1,93,000 918.65
39. 04-Nov-15 93,500 911.85
40. 12-Jan-16 10,33,500 886.75 – 936.75
183
10.2 Recognition of expense:
The Bank follows the intrinsic value method to recognize employee costs relating to ESOS, in accordance
with the Guidance Note on “Accounting for Employee Share-based Payments” issued by the ICAI. Excess
of fair market price over the exercise price of an option at the grant date, is recognized as a deferred
compensation cost and amortized on a straight-line basis over the vesting period of such options. The
compensation so recognised in respect of which exercise of options is outstanding is shown as Employee
Stock Options Outstanding on the face of the Balance Sheet.
The fair market price is the latest available closing price on the stock exchange on which the shares of the
Bank are listed, prior to the date of the meeting of the Compensation Committee in which stock options
are granted. Since shares are listed on more than one stock exchange, the exchange where the Bank’s
shares have been traded highest on the said date is considered for this purpose.
10.3 Stock option activity under the scheme during the year:
No. of options Weighted average

exercise price (`)
Outstanding at the beginning of the year 1,55,54,797 280.21
Granted during the year 30,02,600 923.69
Forfeited / surrendered during the year 1,90,020 631.41
Exercised during the year 55,36,126 171.88
Expired during the year - -
Outstanding at the end of the year 1,28,31,251 472.32
Options exercisable at the end of the year 68,09,156 261.46
The weighted average price of options exercised during the year is ` 877.86.
Following table summarizes the information about stock options outstanding as at March 31, 2016:
Date of grant Exercise Price Number of shares Weighted average life of

arising out of options options (in years)
18-Jul-08 48.00 5,00,000 0.84
18-Jul-08 50.60 1,17,000 0.30
17-Dec-08 38.95 42,800 0.72
31-Aug-09 100.05 39,240 1.00
28-Jan-10 A 48.00 6,00,000 0.83
28-Jun-10 196.50 90,227 1.46
26-Oct-10 274.80 1,790 2.24
17-Jan-11 228.70 18,35,000 1.90
07-Feb-11 A 220.45 5,22,550 1.92
07-Feb-11 95.45 1,38,000 0.86
24-Jun-11 253.60 2,29,013 2.47
30-Sep-11 262.25 10,000 3.35
21-Dec-11 231.95 4,06,000 3.36
29-Feb-12 304.05 1,20,000 3.05
19-Apr-12 345.60 59,350 3.34
25-May-12 304.55 30,460 3.23
10-Jul-12 343.25 1,73,005 3.61
29-Aug-12 319.05 2,250 4.17
184
Date of grant Exercise Price Number of shares Weighted average life of
arising out of options options (in years)
10-Oct-12 365.75 5,000 3.54
09-Jan-13 433.75 15,000 3.79
20-Jun-13 478.45 1,01,000 4.72
18-Jul-13 453.90 8,94,456 4.62
23-Sep-13 411.50 35,710 5.06
29-Oct-13 412.25 20,680 4.66
29-Jan-14 389.85 33,930 5.31
29-Jan-14A 300.00 7,00,000 4.84
25-Mar-14 490.30 1,59,505 5.10
15-May-14 537.05 40,730 5.38
02-Jun-14 533.95 27,96,725 5.30
09-Jul-14 551.10 21,700 5.44
13-Oct-14 623.25 43,040 5.64
17-Jan-15 831.85 44,000 5.81
23-Feb-15 876.80 44,490 5.82
30-Mar-15 880.75 11,000 6.01
22-May-15 848.20 49,600 6.16
24-Jul-15 949.80 15,94,000 6.33
21-Sep-15 918.65 1,83,000 6.49
04-Nov-15 911.85 87,500 6.61
12-Jan-16 936.75 33,500 6.80
12-Jan-16 886.76 10,00,000 6.80
10.4 Fair value methodology:
The fair value of options granted during the year has been estimated on the date of grant using the Black-
Scholes option pricing model with the following assumptions:
2015-16
Average dividend yield 0.43%
Expected volatility 32.61-36.43%
Risk free interest rates 7.55-7.84%
Expected life of options (in years) 4.50 - 4.51
Expected volatility is a measure of the amount by which the equity share price is expected to fluctuate
during a period. The measure of volatility used in Black-Scholes option pricing model is the annualized
standard deviation of the continuously compounded rates of return on the share over a period of time.
Expected volatility has been computed by considering the historical data on daily volatility in the closing
equity share price on the National Stock Exchange of India Limited (NSE), over a prior period equivalent
to the expected life of the options, till the date of the grant.
The stock-based compensation cost calculated as per the intrinsic value method for the year is ` 2.22
crores. Had the Bank adopted the Black-Scholes model based fair valuation, compensation cost for the
year ended March 31, 2016, would have increased by ` 67.88 crores and the proforma profit after tax
would have been lower by ` 44.39 crores. On a proforma basis, the basic and diluted earnings per share
would have been ` 38.91 and ` 38.49 respectively.
The weighted average fair value of options granted during the year is ` 382.98.
185
11. Disclosures – Accounting Standards:
11.1 Employee Benefits (AS-15):
Gratuity:
Gratuity is a defined benefits plan. The Bank has obtained qualifying insurance policies from two insurance
companies. The following table summarises the components of net expenses recognized in the Profit and
Loss account and funded status and amounts recognized in the Balance Sheet, on the basis of actuarial
valuation.
(` in crores)
March 31, 2016 March 31, 2015

Changes in the present value of the obligation
1. Opening balance of Present Value of Obligation 46.38 34.36
2. Interest Cost 3.42 2.87
3. Current Service Cost 10.75 9.95
4. Benefits Paid (6.48) (5.05)
5. Actuarial loss / (gain) on Obligation 7.60 4.25
6. Closing balance of Present Value of Obligation 61.67 46.38
Reconciliation of opening and closing balance of
the fair value of the Plan Assets
1. Opening balance of Fair value of Plan Assets 49.58 34.36
2. Adjustment to Opening Balance 0.62 1.03
3. Expected Return on Plan assets 4.33 3.14
4. Contributions 18.09 16.45
5. Benefits Paid (6.48) (5.05)
6. Actuarial loss Return on Plan Assets (0.80) (0.35)
7. Closing balance of Fair Value of Plan Assets 65.34 49.58
Profit and Loss – Expenses
1. Current Service Cost 10.75 9.95
2. Interest Cost 3.42 2.87
3. Expected Return on Plan assets (4.33) (3.14)
4. Net Actuarial loss recognised in the year 8.40 4.60
5. Expenses recognised in the Profit and Loss account 18.24 14.28
Funded status 100 % insurance 100 % insurance
managed funds managed funds
Actuarial Assumptions
1. Discount Rate 7.50% 7.90%
2. Expected Rate of Return on Plan Assets 8.00% 8.00%
3. Expected Rate of Salary Increase 5.00% 5.00%
4. Employee Attrition Rate
- Past Service 0 to 5 years 30% 30%
- Past Service above 5 years 0.50% 0.50%
Estimates of future salary increases, considered in actuarial valuation, take account of inflation, seniority,
promotion and other relevant factors, such as supply and demand in the employment market.
186
Experience Adjustment:
Particulars March 31, March 31, March 31, March 31, March 31,
2016 2015 2014 2013 2012
Defined Benefit 61.67 46.38 34.36 27.98 22.63
Obligations
Plan Assets 65.34 49.58 34.36 28.67 23.94
Surplus / (Deficit) 3.67 3.20 - 0.69 1.31
Experience Adjustments (7.60) (4.25) 1.63 1.23 1.24
on Plan Liabilities
Experience Adjustments (0.80) (0.35) (1.72) 0.19 (1.13)
on Plan Assets
Contributions expected to be paid to the plan during the annual period beginning after the Balance Sheet
date is ` 22.00 crores.
Provident Fund:
The guidance note on implementing AS 15, Employee Benefits (revised 2005) states that benefits involving
employer established provident funds, which require interest shortfalls to be recompensed are to be
considered as defined benefits plans.
The details of the fund and plan assets position as at March 31, 2016, are as follows:
(` in crores)
Assets / Liabilities March 31, 2016 March 31, 2015
Present value of Interest Rate guarantee on Provident Fund 1.25 1.45

Present value of Total Obligation 128.89 103.46
Fair value of Plan Assets 127.72 102.01
Net liability recognized in the Balance Sheet (1.17) (1.45)
Assumptions
Normal Retirement age 60 years 60 years
Expected guaranteed interest on PF in future 8.80% 8.75%
Discount rate 7.50% 7.90%
Expected average remaining working lives of employees 6.36-13.23 6.28 – 13.98
(years)
Benefit on normal retirement Accumulated Accumulated
account balance account balance
Benefit on early retirement / withdrawal / resignation Same as normal Same as normal
retirement benefit retirement benefit
Benefit on death in service Same as normal Same as normal
retirement benefit retirement benefit
187
11.2 Segment Reporting (AS 17):
The Bank operates in four business segments, viz. Treasury, Corporate / Wholesale Banking, Retail
Banking and Other Banking Operations. There are no significant residual operations carried by the Bank.
Business Segments:
(` in crores)
Business Segment Treasury Corporate / Retail Banking Other Banking Total

Wholesale Banking Operation
Particulars 31/03/16 31/03/15 31/03/16 31/03/15 31/03/16 31/03/15 31/03/16 31/03/15 31/03/16 31/03/15
Revenue 2,962.81 2,753.04 4,687.03 4,025.50 8,175.22 6,592.44 38.70 25.33 15,863.76 13,396.31
Inter Segment Revenue (986.15) (1,156.34)
Total Income 14,877.61 12,239.97
Result 557.42 366.59 1,161.85 877.84 2,566.52 1,972.89 12.15 7.75 4,297.94 3,225.07
Unallocated Expenses (156.52) (126.85)
Operating Profit 4,141.42 3,098.22
Provisions and Contingencies
(672.16) (389.05)
(other than tax)
Tax Expenses (1,182.81) (915.45)
Extraordinary profit / loss - -
Net Profit 2,286.45 1,793.72
Other Information:
Segment Assets 37,124.17 28,706.40 32,562.01 27,736.93 63,110.40 48,934.25 - - 1,32,796.58 1,05,377.58
Unallocated Assets 7,260.41 6,409.79
Total Assets 1,40,056.99 1,11,787.37
Segment Liabilities 22,376.74 21,002.71 44,550.15 39,144.35 49,665.41 35,618.94 - - 1,16,592.30 95,766.00
Unallocated Liabilities 23,464.69 16,021.37
Total Liabilities 1,40,056.99 1,11,787.37
Note:
Fixed Assets, tax paid in advance / tax deducted at source (net of provisions), stationery and stamps, non-
banking assets acquired in satisfaction of claims, and others which cannot be allocated to any segments,
have been classified as unallocated assets; Depreciation on Fixed Assets has been classified as unallocated
expenses. The unallocated liabilities include share capital, employee stock option outstanding, reserves and
surplus, proposed dividend and others.
Geographic Segments:
The business operations of the Bank are largely concentrated in India. Activities outside India are restricted to
resource mobilization in the international markets. Since the Bank does not have material earnings emanating
from foreign operations, the Bank is considered to operate only in domestic segment.
11.3 Related party transactions (AS-18):
The following is the information on transactions with related parties:
Key Management Personnel
Mr. Romesh Sobti, Managing Director
188
Associates
IndusInd Marketing and Financial Services Private Limited
Subsidiaries
ALF Insurance Services Private Limited (till February 24, 2016; the company is under liquidation and the
liquidator has repaid the entire share capital on February 24, 2016; the final formalities for striking off the name
from the Companies Register are in progress).
In accordance with RBI guidelines, details pertaining to the related party transactions have not been provided
as there is only one related party in each of the above categories.
11.4 Operating Leases (AS 19):
The Bank has taken a number of premises on operating lease for branches, offices, ATMs and residential
premises for staff. The Bank has not given any assets on operating lease. The details of maturity profile of future
operating lease payments are given below:
(` in crores)
March 31, 2016 March 31, 2015

Future lease rentals payable as at the end of the year:
- Not later than one year 216.49 189.85
- Later than one year but not later than five years 711.44 641.83
- Later than five years 293.85 293.86
Total of minimum lease payments recognized in the Profit and Loss 206.49 182.91
Account for the year
Total of future minimum sub-lease payments expected to be - -
received under non-cancellable sub-lease
Sub-lease payments recognized in the Profit and Loss account for - -
the year
The Bank has not sub-leased any of the properties taken on lease. There are no provisions relating to contingent
rent.
The terms of renewal and escalation clauses are those normally prevalent in similar agreements. There are no
undue restrictions or onerous clauses in the agreements.
11.5 Earnings per share (AS 20):
Details pertaining to earnings per share as per AS-20 are as under:

March 31, 2016 March 31, 2015
Net Profit after tax (` in crores) 2,286.45 1,793.72
Basic weighted average number of equity shares 57,62,52,656 52,77,22,078
Diluted weighted average number of equity shares 58,24,34,853 53,69,08,824
Nominal value of Equity Shares (`) 10 10
Basic Earnings per Share (`) 39.68 33.99
Diluted Earnings per Share (`) 39.26 33.41
189
11.6 Deferred Tax (AS 22):
The major components of deferred tax assets / liabilities are as under:
(` in crores)
March 31, 2016 March 31, 2015

Deferred Tax Deferred Tax
Timing difference on account of Assets Liabilities Assets Liabilities
Difference between book depreciation and depreciation - 26.47 - 25.96
under the Income Tax Act, 1961
Difference between Provisions for doubtful debts and 307.32 - 191.29 -
advances and amount allowable under Section 36(1)
(viia) of the Income Tax Act, 1961
Difference between book income and income offered - 144.49 - 175.17
under the Income Tax Act, 1961
Others 26.57 - 23.20 -
Sub-total 333.89 170.96 214.49 201.13
Net closing balance carried to the Balance Sheet 162.93 13.36
(included in Sch. 11 – Others)
12. Additional Disclosures:
12.1 Provisions and Contingencies charged to the Profit and Loss account for the year consist of:
(` in crores)

(Appreciation) / Depreciation on Investments 29.51 (66.43)
Provision for non-performing assets including bad debts written off 501.50 338.91
(net of write backs)
Provision towards Standard Assets 112.60 104.00
Income Tax / Wealth Tax / Deferred Tax (Refer Note 9.1) 1,182.81 915.45
Others 28.55 12.57
Total 1,854.97 1,304.50
12.2 Movement in provisions:
a) Movement in provision for credit card and debit card reward points:
(` in crores)

Opening provision 12.35 9.71
Provision for Reward Points made during the year 16.30 9.12
Utilisation / Write back of provision for Reward Points (12.58) (6.48)
Effect of change in rate for accrual of Reward Points - -
Closing provision for Reward Points 16.07 12.35
190
b) Movement in provision for frauds included under other liabilities:
(` in crores)

Opening provision 5.11 6.51
Provision during the year 0.62 1.25
Utilisation / Write back of provision (0.38) (2.65)
Closing provision 5.35 5.11
12.3 Disclosure relating to Complaints:

A) Customer Complaints:
No. Particulars 2015-16 2014-15

(a) No. of complaints pending at the beginning of the year 340 310
(b) No. of complaints received during the year 25467 22199
(c) No. of complaints redressed during the year 25352 22169
(d) No. of complaints pending at the end of the year 455 340
B) Awards passed by the Banking Ombudsman:
No. Particulars 2015-16 2014-15

(a) No. of unimplemented Awards at the beginning of the year Nil Nil
(b) No. of Awards passed by the Banking Ombudsman during the year Nil Nil
(c) No. of Awards implemented during the year Nil Nil
(d) No. of unimplemented Awards at the end of the year Nil Nil
(Compiled by management and relied upon by auditors)
12.4 The Ministry of Corporate Affairs (MCA) has notified the Companies (Accounting Standards) Amendment Rules,
2016, vide its notification dated March 30, 2016. The said notification, read with Rule 3(2) of the Companies
(Accounting Standards) Rules, 2006, is applicable to accounting period commencing on or after the date of
notification i.e. April 01, 2016.
12.5 Letters of Comfort:
The Bank has not issued any letters of comfort (Previous Year Nil).
12.6 Disclosure on Remuneration:
HR and Remuneration Committee:
The HR and Remuneration Committee of the Bank comprises four members of the Board of Directors of the
Bank, including one member from the Risk Management Committee of the Board. The mandate of the HR
and Remuneration Committee is to establish, implement and maintain remuneration policies, procedures
and practices that help to achieve effective alignment between remuneration and risks. The Committee is
also mandated to oversee framing, implementation and review of the Bank’s Compensation Policy as per the
RBI guidelines on Compensation of Whole Time Directors / Chief Executive Officers / Risk Takers and Control
191
function staff. The Committee is also required to ensure that the cost to income ratio of the Bank supports the
remuneration package consistent with maintenance of sound capital adequacy ratio. The HR and Remuneration
Committee reviews compensation structure and the policies of the Bank with a view to attract, retain and motivate
employees.
Compensation Policy:
The Compensation Policy is formulated by the Board in alignment with the RBI guidelines and covers all
components of compensation including fixed pay, variable pay, perquisites, retirement benefits as Provident
Fund and Gratuity, Long term incentive plans and Employee Stock Options.
The key objectives of the policy are:

(i) Benchmark employee compensation for various job positions and skills with that of the market.
(ii) Maintain an optimal balance between fixed and variable pay
(iii) Pay for ‘Position, Performance and Person’.
(iv) Build employee ownership and long term association through long term incentive plans (ESOPs)
Some of the important features of the Compensation Policy are as follows:
(i) The Bank has identified “Risk Takers and Risk Controllers” separately. Risk Takers includes all employees
in Grades Senior Vice President 3 (SVP3) and above belonging to business line functions of Corporate
& Commercial Banking Group, Global Markets Group, Transaction Banking Group, Consumer Banking
and Consumer Finance Division, whose functioning and decisioning impacts the Bank materially on
tangible financial performance aspects of revenues, costs, and profits. Risk Controllers are employees in
Grades SVP3 and above belonging to business support functions of Chief Operating Officer (Operations,
Finance & Accounts, Information Technology, Secretarial, etc.), Chief Risk Officer (Credit, Risk, Financial
Restructuring & Reconstruction Group, Credit Quality Loan Assurance Review), Human Resources,
Inspection and Audit, Investor Relations, Marketing, etc., who support the business line functions through
back office processes and activities and their functioning does not have a revenue impact through
business generation on the Bank’s financial performance.
(ii) The HR & Remuneration Committee will oversee the framing, implementation and review of the
Compensation Policy.
(iii) In respect of WTDs / CEO / Risk Takers / Control function staff of the Bank, the Compensation policy
provides for a reasonable annual increase in fixed pay in line with the market benchmarks. Their individual
increments are linked to their annual performance rating and increment percentages at various performance
rating levels, are decided on the basis of the financial performance of the Bank. Exceptions are restricted
to a select few high performers to reward performance, motivate and retain critical employees.
(iv) The quantum of overall variable pay to be disbursed in a year for all eligible employees including Risk
Takers and Risk Controllers as defined above would vary from year to year on the basis of the financial
performance of the Bank measured through various parameters such as Net Interest Margin, Net Interest
Income, Return on Assets, Profit After Tax and Return on Equity.
(v) Employee Compensation is linked to performance. Increments and variable pay are linked to their annual
performance rating. Annual Performance Rating for an employee is arrived on the basis of tangible
performance against pre–set Key Results Areas (KRAs) / measurable objectives set at the beginning of
the financial year.
(vi) The individual variable pay is linked to the annual performance rating, and based on variable pay grids
that outline variable pay as a percentage of Annual Guaranteed cash at various rating levels for a grade
band. Exceptional increments and variable pay may be paid to select high performers, but in no case
192
they would violate the stipulated RBI guidelines. The Bank also makes a distinction between Risk Takers
and Risk Controllers and incorporates separate parameters on variable pay for these segments in its
Compensation policy.
(vii) The individual variable pay would not exceed 70% of the fixed pay. Wherever variable pay exceeds a
substantial portion of fixed pay as defined by the Bank, (currently set at 65% of fixed pay), the variable pay
will be deferred over a period of 3 years in a ratio to be decided by the management in accordance with
the RBI guidelines.
(viii) The Bank will implement malus / claw-back arrangements with the concerned employees in case of deferred
variable pay as defined above. Malus arrangement lays down policies to adjust deferred remuneration
before vesting and claw-back arrangement lays down policies to adjust deferred remuneration after
vesting. The criteria would be negative contributions to the bank and / or relevant line of business in any
year.
(ix) The Compensation Policy does not provide for guaranteed bonus or sign on bonus in cash. However,
in case of select critical hires, sign on bonus can be granted in form of pre-hiring ESOPs (a one-time
grant made at the time of joining). The Compensation Policy does not provide for severance pay for any
employee of the Bank, irrespective of the reasons for severance.
(x) Retirement benefits in the form of Provident Fund and Gratuity are as per the Bank’s HR policies which are
in line with the statutory norms.
(xi) Perquisites are laid down in HR Policies of the Bank.
(xii) At present, the Bank uses cash based form of variable compensation. Cash based form of variable
compensation is easy to administer and leads to an instant reward to the concerned employees.
(xiii) ESOPs do not form a part of the variable pay and are kept outside the computation of total compensation
of an employee. They are very selectively granted to attract and retain employees. ESOPs are not granted
with a defined periodicity. ESOP grant criteria include grade of the employee, criticality of the position in
terms of business contribution, market value of the position, performance and behavioural track record of
the employee.
Other Disclosures:
Year ended March 31, 2016 Year ended March 31, 2015
Number of meetings held by During the year, two meetings of During the year, two meetings of
RC during the financial year and HR and Remuneration committee Remuneration committee were
remuneration paid to its members were held. The members were paid held. The members were paid
aggregate sitting fees of ` 1,40,000 aggregate sitting fee of ` 1,00,000
for the two meetings. for the two meetings.
During the year, two meetings of
HR and Remuneration committee
were held. The members were paid
aggregate sitting fees of ` 1,40,000
for the two meetings.
Number of employees having 66 employees belonging to the 64 employees belonging to the
received a variable remuneration category of WTD / CEO / Risk category of WTD / CEO / Risk
award during the financial year Takers / Other Control function Takers / Other Control function
staff had received a variable staff had received a variable
remuneration award. remuneration award.
193
Year ended March 31, 2016 Year ended March 31, 2015
Number and total amount of Nil Nil
‘sign on’ awards made during the
financial year
Details of guaranteed bonus if any Nil Nil
paid as sign on bonus
Details of severance pay in addition Nil Nil
to the accrued benefits
Total amount of outstanding The outstanding deferred The outstanding deferred
deferred remuneration split into remuneration is ` 1.36 crores to be remuneration is ` 1.22 crores to be
cash, shares and share linked paid as cash in FY 2016-17 and FY paid as cash in FY 2015-16 and FY
instruments and other forms 2017-18 2016-17
Total amount of deferred The deferred remuneration paid in Nil

remuneration paid out in the FY16 was ` 0.61 crores
financial year
Breakdown of amount of Breakup of remuneration awards Breakup of remuneration awards
remuneration awards for the for the 72 employees defined as for the 66 employees defined as
financial year WTD / CEO / Risk Takers / Other WTD / CEO / Risk Takers / Other
control function staff control function staff
(a) Fixed pay - ` 89.30 crores (a) Fixed pay - ` 76.01 crores
(b) Variable pay - ` 34.64 crores (b) Variable pay - ` 28.66 crores
for FY 2014-15 for FY 2013-14
(c) Deferred remuneration - (c) Deferred remuneration -

` 1.36 crores ` 1.22 crores
(d) Non-deferred remuneration - (d) Non-deferred remuneration -

` 33.28 crores ` 27.44 crores
Total amount of outstanding Nil Nil
deferred remuneration and
retained remuneration exposed
to ex-post explicit and implicit
adjustments.
Total amount of reductions during Nil Nil
the FY due to ex-post explicit
adjustments
Total amount of reductions during Nil Nil
the FY due to ex-post implicit
adjustments
194
13. The Micro, Small and Medium Enterprises Development Act, 2006 that came into force from October 2, 2006,
provides for certain disclosures in respect of Micro, Small and Medium enterprises. There have been no
reported cases of delays in payments to micro and small enterprises or interest payments due to delays in such
payments.
14. Previous year’s figures have been regrouped / reclassified wherever necessary.
As per our report of even date attached. For INDUSIND BANK LTD.

R. Seshasayee T. Anantha Narayanan
Chairman Director


195
DISCLOSURES UNDER BASEL III CAPITAL
REGULATIONS – 31st March 2016
DF-1: Scope of Application
Name of the head of the banking group to which the framework applies: INDUSIND BANK LTD.
(i) Qualitative Disclosures:
IndusInd Bank Limited (‘the Bank’) is a commercial bank, incorporated on January 31, 1994. The Bank had a
wholly owned subsidiary ALF Insurance Services Private Ltd., which was under liquidation. On February 24,
2016 the liquidator had returned the entire Capital and accumulated profits. As such the Bank does not have any
subsidiary as on March 31, 2016. The CRAR is computed on the financial position of the Bank alone.
a) List of group entities considered for consolidation:
Name of Whether Explain the Whether Explain the Explain the Explain the
the entity/ the entity is method of the entity is method of reasons for reason if
Country of included under consolidation included under consolidation difference in consolidated
incorporation accounting regulatory the method of under only
scope of scope of consolidation one of the
consolidation consolidation scopes of
(Yes/No) (Yes/No) consolidation
None / NA NA NA NA NA NA NA
b) List of group entities not considered for consolidation both under the accounting and regulatory scope
of consolidation:
Name of the Principle activity Total balance % of banks Regulatory Total balance
entity/Country of of the entity sheet equity holding in the treatment sheet assets
incorporation total equity of bank’s (as stated in
investments the accounting
in the capital balance sheet of
instruments of the legal entity)
the entity
None / NA NA NA NA NA NA
(ii) Quantitative Disclosures:

c) List of group entities considered for consolidation:
As mentioned above in Para (i) above, the Bank does not have any subsidiary.
d) There is no capital deficiency in any subsidiary, which is not included in the regulatory scope of consolidation.
e) As on March 31, 2016, the Bank does not have controlling interest in any insurance entity.
f) There are no restrictions or impediments on transfer of funds or regulatory capital within the banking group.
DF-2 Capital Adequacy

The Bank is subject to the capital adequacy guidelines laid down by Reserve Bank of India, which are based on the
framework of the Basel Committee on Banking Supervision. As per Basel III Capital Regulations, the Bank is required
to maintain a minimum Capital to Risk Weighted Assets (CRAR) of 9.625% (including Capital Conversion Buffer of
0.625%). The Basel III Capital Regulations are implemented effective from April 1, 2013 in a phased manner. The
minimum capital required to be maintained by the Bank for the period ended March 31, 2016 is 9.625% with minimum
Common Equity Tier 1 (CET1) of 6.125% (including CCB).
196
Besides computing CRAR under the Pillar I requirement, the Bank also periodically undertakes stress testing in
various risk areas to assess the impact of stressed scenario or plausible events on asset quality, liquidity, interest rate,
derivatives and forex on its profitability and capital adequacy. The assessment of future capital needs is effectively
done based on the business projections, asset mix, operating environment, growth outlook, new business avenues,
regulatory changes and risk and return profile of the business segments. The future capital requirement is assessed
by taking into account all risk elements and mapping these to the respective business segments.
The Summary of Capital requirements for Credit Risk, Market Risk and Operational Risk as on March 31, 2016,
is mentioned below:
Risk Type ` in millions
Capital requirements for Credit Risk 89,424
Portfolio Subject to Standardised approach 89,424
Securitisation exposures -
Capital requirements for Market Risk 4,926
Standardised Duration Approach
Interest Rate Risk 4,130
Foreign Exchange Risk (including gold) 304
Equity Risk 482
Capital requirements for Operational Risk 10,319
Basic Indicator Approach 10,319
Minimum Capital requirements at 9% 104,669
Minimum CRAR + CCB at 9.625% 111,938
Total Capital Funds 180,193
CRAR 15.50%
Organisation Structure:
Integrated Risk Management: Objectives and Organisation Structure
The Bank has established an Enterprise-wide Risk Management Department, independent of the Business segments,
responsible for Bank-wide risk management covering Credit risk, Market risk (including ALM) and Operational risk.
The Risk Management Department focuses on identification, measurement, monitoring and controlling of risks across
various segments. The Bank has been progressively adopting the best International practices so as to continually
reinforce its Risk Management functions.
197
Organisation Structure:
The set-up of Risk Management Department is hereunder:
Managing Director
Chief Risk Officer
Head – Risk Mgmt
Credit Risk Market Risk Operational Risk Asset Liability

Management Management Management Management
Separate Committees, as specified below, are set up to manage and control various risks:
5LVN0DQDJHPHQW&RPPLWWHH50&
&UHGLW5LVN0DQDJHPHQW&RPPLWWHH&50&
0DUNHW5LVN0DQDJHPHQW&RPPLWWHH050&
$VVHW/LDELOLW\0DQDJHPHQW&RPPLWWHH$/&2
2SHUDWLRQDO5LVN0DQDJHPHQW&RPPLWWHH250&
Bank has articulated various risk policies which specify the risks, controls and measurement techniques. The policies
are framed keeping risk appetite as the central objective. Against this background, the Bank identifies a number of key
risk components. For each of these components, the Bank determines a target that represents the Bank’s perception
of the component in question.
The risk policies are vetted by the sub-committees, viz. CRMC, MRMC, etc. and are put forth to RMC, which is a sub-
committee of the Board. Upon vetting of the policies by RMC, the same are placed for the approval of the Board and
implemented.
Bank has put in place a comprehensive policy on ICAAP, which presents a holistic view of the material risks faced,
control environment, risk management processes, risk measurement techniques, capital adequacy and capital
planning.
Policies are periodically reviewed and revised to address the changes in the economy / banking sector and Bank’s risk
profile. Monitoring of various risks is undertaken at periodic intervals and a report is submitted to Top Management /
Board.
198
Credit Risk
Bank manages credit risk comprehensively; both at Transaction level and at Portfolio level. Some of the major initiatives
taken are listed below :
%DQNXVHVDUREXVW5LVNUDWLQJIUDPHZRUNIRUHYDOXDWLQJFUHGLWULVNRIWKHERUURZHUV7KH%DQNXVHVVHJPHQW
specific rating models that are aligned to target segment of the borrowers.
5LVNVRQYDULRXVFRXQWHUSDUWLHVVXFKDVFRUSRUDWHVEDQNVDUHPRQLWRUHGWKURXJKFRXQWHUSDUW\H[SRVXUHOLPLWV
also governed by country risk exposure limits in case of international trades.
%DQNPDQDJHVULVNDWWKHSRUWIROLROHYHOWRRZLWKSRUWIROLROHYHOSUXGHQWLDOH[SRVXUHOLPLWVWRPLWLJDWHFRQFHQWUDWLRQ
risk.
%DQNKDVDZHOOGLYHUVLILHGSRUWIROLRDFURVVYDULRXVLQGXVWULHVDQGVHJPHQWVDVLOOXVWUDWHGE\WKHIROORZLQJGDWD
Retail and schematic exposures (which provide wider diversification benefits) account for as much as 48 %
of the total fund-based advances.
Bank’s corporate exposure is fully diversified over 85 industries, thus insulated/minimised from individual
industry cycles.
The above initiatives support qualitative business growth while managing inherent risks within the risk appetite.
Market Risk
Key sources of Market risk are Liquidity Risk, Interest Rate Risk, Price Risk and Foreign Exchange Risk. Bank has
implemented a state-of-the-art Treasury and Market Risk Management systems that supports robust risk management
capabilities and facilitates Straight-through Processing.
Market Risk is effectively managed through comprehensive framework which supports various measures such as
Mark-to-Market, Sensitivity analysis, Value-at-Risk and monitoring through operational limits such as stop-loss limits,
exposure limits, deal-size limits, maturity ladder, etc. Market risk measurement and monitoring is governed through a
comprehensive Market Risk Management Policy.
Asset Liability Management (ALM)
Bank’s ALM system supports effective management of liquidity risk and interest rate risk, covering 100% of its assets
and liabilities.
/LTXLGLW\ 5LVN LV PRQLWRUHG WKURXJK 6WUXFWXUDO /LTXLGLW\ *DSV '\QDPLF /LTXLGLW\ SRVLWLRQ /LTXLGLW\ &RYHUDJH
Ratios, Liquidity Ratios analysis and Behavioural analysis, with prudential limits for negative gaps in various time
buckets.
,QWHUHVW5DWH6HQVLWLYLW\LVPRQLWRUHGRQ(DUQLQJSHUVSHFWLYHDQG(FRQRPLF9DOXHSHUVSHFWLYHWKURXJKSUXGHQWLDO
OLPLWVIRU5DWH6HQVLWLYH*DSV0RGLILHG'XUDWLRQDQGRWKHUULVNSDUDPHWHUV
,QWHUHVW5DWH5LVNRQWKH,QYHVWPHQWSRUWIROLRLVPRQLWRUHGWKURXJK9DOXHDW5LVNDQG5LVN6HQVLWLYLWLHVRQDGDLO\
basis. Optimum risk is assumed through duration, to balance between risk containment and profit generation
from market movements.
ALCO meetings are convened frequently wherein detailed analysis are presented on liquidity position, interest rate
risks, product mix, business growth v/s budgets, interest rate outlook, which helps to review the business strategies
regularly and undertake new initiatives.
Operational Risk
Operational risk is managed by addressing People risk, Process risk, Systems risk as well as risks arising out of
external environment.
199
Bank has efficient audit mechanism, involving periodical on-site audit, concurrent audits, on the spot and off-site
surveillance enabled by the Bank’s advanced technology and Core Banking System.
Bank has constituted Fraud Risk Management Committee which is involved in root cause analysis and actions are
taken to mitigate frauds. A separate and independent KYC/AML cell has been in place to ensure compliance with
respect to customer on-boarding and transaction monitoring as per internal framework and regulatory guidelines of
KYC/AML.
Bank has implemented various Operational Risk management tools such as Risk and Control Self-Assessment
(RCSA), KRIs monitoring and Loss Data collection (Basel 8X7 matrix) including Near Miss Events. Bank weighs each
new Product and Process enhancements under Operational Risk Assessment Process (ORAP) framework.
The above frameworks help in mitigation of operational risks and optimization of capital requirement towards
operational risks under Basel III norms.
Systems Risk
As part of Systems-related Operational Risk Management initiatives, Bank has achieved the following :
%DQNKDVIRUPXODWHGDQGLPSOHPHQWHGDFRPSUHKHQVLYH%XVLQHVV&RQWLQXLW\3ODQ%&3WRHQVXUHFRQWLQXLW\RI
its critical operations and extension of banking services to its customers.
%DQN KDV ,QIRUPDWLRQ 6HFXULW\ 3ROLF\ LQ SODFH WR HQVXUH FRQILGHQWLDOLW\ LQWHJULW\ DQG DFFHVVLELOLW\ RI DOO LWV
information security assets.
%DQNKDVHVWDEOLVKHGDQHIIHFWLYH'LVDVWHU5HFRYHU\VLWHDWDGLVWDQWORFDWLRQZLWKRQOLQHUHDOWLPHUHSOLFDWLRQRI
data, both in Mumbai and Chennai.
&RPSUHKHQVLYH,7VHFXULW\IUDPHZRUNKDVEHHQSXWLQSODFHWRHQVXUHFRPSOHWHGDWDVHFXULW\DQGLQWHJULW\
%DQN KDV KRXVHG LWV GDWD FHQWHU LQ D SURIHVVLRQDOO\ PDQDJHG HQYLURQPHQW ZLWK VRSKLVWLFDWHG DQG IRROSURRI
security features and assured supply of utilities.
The robust Risk Management framework created in the Bank supports rapid and qualitative growth with optimization
of risks and maximization of shareholder value.
DF-3: Credit Risk: General Disclosures
“Credit Risk” is defined as the probability / potential that the borrower or counter-party may fail to meet its
obligations in accordance with agreed terms. It involves inability or unwillingness of a borrower or counter-party
to meet commitments in relation to lending, trading, hedging, settlement and other financial transactions.
Credit Risk is made up of two components:
1. Transaction Risk (or Default Risk), which represents the risk arising from individual credit exposures and
2. Portfolio Risk, which represents the risk inherent in the portfolio of credit assets (concentration of assets,
correlation among portfolios, etc.).
Credit risk is found in a variety of transactions across Bank’s portfolio including not only loans, off balance sheet
exposures, investments and financial guarantees, but also the risk of a counterparty in a derivative transaction
becoming unable to meet its obligations. Credit risk constitutes the largest risk to which the Bank is exposed. Bank
has adequate system support which facilitates credit risk management and measurement across its portfolio. The
system support is strengthened and expanded as and when new exposures are added to the Bank’s portfolio.
Bank has articulated comprehensive guidelines for managing credit risk as outlined in Credit Risk Policy and
related Policies framework, Bank Risk Policy, Country Risk Policy, Loan Review Policy and Recovery Policy. The
credit risk management systems used at the Bank have been implemented in accordance with these guidelines
and best market practices. The credit risk management process focuses on both specific transactions and on
groups of specific exposures as portfolios.
200
Bank’s credit risk policy and related policies and systems are framed to achieve the following key objectives:
¾ Monitoring concentration risk in particular products, segments, geographies etc thereby avoiding concentration
risk from excessive exposures to any particular products, segments, geographies etc.
¾ Assisting in building quality credit portfolio and balancing risks and returns in line with Bank’s risk appetite
¾ Tracking Credit quality migration
¾ Determining how much capital to hold against each class of the assets
¾ Undertaking Stress testing to evaluate the credit portfolio strength
¾ To develop a greater ability to recognize and avoid potential problems
¾ Alignment of Risk Strategy with Business Strategy
¾ Adherence to regulatory guidelines
Credit Risk Management at specific transaction level
The central objective for managing credit risk at each transaction level is development of risk measurement and
monitoring systems that cover the entire life cycle of the exposure, i.e. opportunity for transaction, assessing the
credit risk, granting of credit, disbursement and subsequent monitoring, identifying the obligors with emerging credit
problems, remedial action in the event of credit quality deterioration and repayment or termination of the obligation.
The Credit Policies of the Bank stipulates applicability of various norms for managing credit risk at a specific transaction
level and more relevant to the target segment of the obligors. It covers all the types of obligors, viz. Corporate, SME,
7UDGHUDQG6FKHPDWLF/RDQVVXFKDV/RDQDJDLQVW3URSHUW\%XVLQHVV/RDQ5HWDLO$JUL/$6*ROG/RDQ+RPH/RDQ
Personal Loan, etc.
Major components of Credit Risk and related Policies are mentioned below:
¾ Transaction with customer / prospective customer is undertaken with an aim to build long term relationship.
¾ All the related internal and regulatory guidelines such as KYC norms, RBI prudential norms, etc. are adhered to
while assessing the credit request of the borrower.
¾ Credit is granted with due diligence and detailed insight into the customer’s circumstances and of specific
assessments that provide a context for such credits.
¾ Facility is granted based on customer’s creditworthiness, capital base or assets to assure that the customer is
able to substantiate the repayment. Due regard is also placed to the industry in which the customer is operating,
the business specific risks and management capability and their risk appetite.
¾ Regular follow-up of overall health of the borrower is undertaken to assess whether the basis of granting credit
has changed.
¾ When loans and credits are granted to borrowers falling outside preferred credit rating, the Bank normally obtains
sufficient collateral. However, collaterals are not the sole criterion for lending, which is generally done based on
assessing the business viability of the borrower and the adequacy of the expected cash flows.
¾ Bank has defined exposures limit on the basis of internal risk rating of the borrower.
¾ Bank is particularly cautious while granting credits to businesses in affected or seasonal industries.
¾ Bank also grants unsecured credit to borrowers with high standing and low credit risk profile based on detailed
financial analysis & established credit history.
¾ In terms of Bank’s Country risk Policy, due caution is exercised when assuming risk in countries with an unstable
economic or political scenario.
201
Beside the acceptability norms defined in the policies/manual for an individual transaction, Bank has also implemented
various credit related product programmes which enables efficient appraisal, assessment, delivery, supervision and
control of tailor made loan products targeted at specific customer segments. Customers covered under Business
Banking product programme are evaluated using a scoring/rating model developed based on segment specific risk
profile.
Consumer Finance Division appraises loan application based on robust set criteria defined in the respective product
programmes. Further as a mechanism to assess the credit quality, customers are also evaluated through application
scoring models which are segment specific. Further, post disbursement, the quality of the account is tracked by
means of a Behavioral score.
Customers under Credit Cards segment are evaluated by means of robust customer selection criteria that include
variety of factors.
Bank has also put in place a detailed policy for portfolio acquisition which stipulates various criteria for asset selection
including due diligence, transfer of risks and rewards of the underlying portfolio, credit enhancements, portfolio risk
management and monitoring in accordance with RBI guidelines.
Credit Approval Committee
%DQNKDVSXWLQSODFHWKHSULQFLSOHRI¶&RPPLWWHH·RU¶$SSURYDO*ULGV·DSSURDFKZKLOHDFFRUGLQJVDQFWLRQVWRFUHGLW
proposals. This provides for an unbiased, objective assessment/evaluation of credit proposals. Such Committees
include atleast one official from an independent department, which has no volume or profits targets to achieve.
The official of the independent department is a mandatory member of the Credit Committee. The spirit of the credit
approving system is that no credit proposals are approved or recommended to higher authorities unless all the
PHPEHUVRIWKH¶&RPPLWWHH·RU¶$SSURYDO*ULGV·DJUHHRQWKHDFFHSWDELOLW\RIWKHSURSRVDOLQDOOUHVSHFWV,QFDVHRI
disagreement the proposal is referred to next higher Committee whose decision to approve or decline with conditions
is final.
)ROORZLQJ¶$SSURYDO*ULGV·DUHFRQVWLWXWHG
Corporate & Commercial Banking Segment :
" Zonal Credit Committee (ZCC) / Join Sanction on Four Eye Principle
" Corporate Office Credit Committee (COCC) – I
" Corporate Office Credit Committee (COCC) – II
" Executive Credit Committee (ECC)
Consumer Banking (CB) Segment :
Scheme of delegation under Consumer Banking Segment includes Vehicle financing, personal loans, housing
loans and other schematic loans under multi-tier Committee based approach as under:
¾ Branch Credit Committee – Consumer Banking (BCC – CB)
¾ Regional Credit Committee – Consumer Banking (RCC - CB)
¾ Corporate Office Credit Committee – Consumer Banking (COCC- CB I & II)
¾ Executive Credit Committee
$SDUWIURPWKLV%DQNKDVVFKHPDWLFORDQVDOVROLNH*ROG/RDQ /$6ZKLFKDUHVDQFWLRQHGE\EUDQFKHV2SHUDWLRQV
upto defined limit of exposure under the respective product program. These are relatively smaller loans and fully
secured by liquid collaterals.
Scheme of delegation of power applicable for all business segments are approved by Board of Directors.
The credit proposals which are beyond the delegated powers of ECC are placed to Committee of Directors (COD) or
Board of Directors (BOD) for approval.
202
Risk Classification
Bank monitors the overall health of its customers on an on-going basis to ensure that any signal of weakening of a
customer’s earnings or liquidity is detected as early as possible. As part of the credit process, customers are classified
according to the credit quality in terms of internal rating, and the classification is regularly updated on receipt of new
information/ changes in the factors affecting the position of the customer.
Bank has operationalised following risk rating/ scoring models basis on the target segment of the borrower:
/DUJH&RUSRUDWH6PDOO 0HGLXP(QWHUSULVHV1%)&
7UDGLQJHQWLWLHV&DSLWDO0DUNHW%URNHUDQG&RPPRGLW\([FKDQJH%URNHU
)LQDQFLDO,QVWLWXWLRQV3ULPDU\'HDOHUVDQG%DQNV
5HWDLOFXVWRPHUV6FKHPDWLF/RDQV²ZKRDUHDVVLJQHGFUHGLWVFRULQJ
Customers under Business Banking segment, Retail Agri, Loan against credit card receivables are assessed for credit
quality using a scoring/rating model. The score serves a measure to categorise the customers into various risk classes
which are further calibrated to different risk grades. Bank has also implemented rating models for assessing risk under
Lease Rental Discounting and Warehouse Receipts Financing products.
Rating grades in each rating model, other than the segments driven by product programmes, is on a scale of 1 to
8, which are further categorised by assigning +/- modifiers to reflect the relative standing of the borrower within the
specific risk grade. Model-specific rating grades are named distinctly. Each model-specific rating grade reflects the
relative ratings of the borrowers under that particular segment. For instance, L4 indicates a superior risk profile of a
Large Corporate, when compared to another Large Corporate rated L5.
In order to have a common risk yardstick across the Bank, these model specific ratings are mapped to common scale
ratings which facilitate measurement of risk profile of different segments of borrower by means of common risk ladder.
Various purposes for which the rating/scoring models are used are mentioned hereunder:
" Portfolio Management
" Efficiency in lending decision
" To assess the quality of the borrower – single point reference of credit risk of the borrower
" Preferred rating norms for assuming exposures
" Prudential ceiling for single borrower exposures – linked to rating
" Frequency of review of exposures
" Frequency of internal auditing of exposures
" To measure the portfolio quality
" Target for quality of advances portfolio is monitored by way of Weighted Average Credit Rating (WACR).
" Pricing credit
" Capital allocation (under Basel II – IRB approaches)
Credit Quality Assurance:
Bank has also adopted Loan Review Mechanism (LRM), which involves independent assessment of quality of an
advance, effectiveness of loan administration, compliance with internal policies of Bank and regulatory framework
and portfolio quality. It also helps in tracking weaknesses developing in the account for initiating corrective measures
in time. LRM is carried out by Credit Quality Assurance team, which is independent of Credit and Business functions.
203
Credit Risk Management at Portfolio level:
Accumulation of individual exposures leads to portfolio, which creates the possibility of concentration risk.
Concentration risk, on account of borrowers/ products with similar risk profile, may arise in various forms such as
6LQJOH%RUURZHU*URXSRI%RUURZHUV6HQVLWLYH6HFWRU,QGXVWU\²ZLVHH[SRVXUH8QVHFXUHGH[SRVXUH5DWLQJZLVH
exposure, Off Balance sheet exposure, Product wise exposure, etc. Credit risk concentration is addressed by means
of structural and prudential limits stipulated in the Credit Risk Policy and other related policies.
Concentration risk on account of exposures to counter-parties (both single borrower and group of borrowers),
Industry-wise, Rating-wise, Product-wise, etc., is being monitored by Risk Management Dept (RMD). For the purpose,
exposures in all business units, viz. branches, treasury, investment banking, etc., by way of all instruments (loans,
equity/debt investments, derivative exposures, etc.) are considered. Such monitoring is carried out at monthly intervals.
Besides this, respective business units are monitoring the exposure on continuous real-time basis.
Concentration risk is further evaluated in terms of statistical measures and benchmarks. Detail analysis of portfolio
risk and control measures is carried out on a monthly basis on various parameters. Direction of risks and controls
(decreasing, stable, and increasing) and resultant net risk is also done. Further, a comprehensive Stress Testing
framework based on several factors and risk drivers assessing the impact of stressed scenario on Credit quality, its
impact on Bank’s profitability and capital adequacy is placed to Top Management /Board every quarter. The framework
highlights the Bank’s credit portfolio under 3 different levels of intensity across default, i.e. mild, medium and severe,
and analyses its impact on the portfolio quality and solvency level.
Impaired credit - Non Performing Assets (NPAs):
Bank has an independent Credit Administration Department that constantly monitors accounts for irregularities,
identifies accounts for early warning signals for potential problems and identifies individual NPA accounts systematically.
Bank has also set up Financial Restructuring and Reconstruction (FRR) Dept for managing and monitoring defaulted
accounts, carrying out restructuring, wherever feasible and following up for recoveries of dues.
The guidelines as laid down by RBI Master Circular No. DBR.No.BP.BC.2/21.04.048/2015-16 dated July 1, 2015, on
Asset classification, Income Recognition and Provisioning to Advances portfolio are followed while classifying Non-
performing Assets (NPAs). The guidelines are as under:
a) An asset, including a leased asset, becomes non-performing when it ceases to generate income for the bank;
b) A Non Performing Asset (NPA) is a loan or an advance where:
i. interest and / or installment of principal remains overdue for a period of more than 90 days in respect of a
term loan,
ii. the account remains 'out of order', in respect of an Overdraft / Cash Credit (OD/ CC),
iii. the bill remains overdue for a period of more than 90 days in the case of bills purchased and discounted,
iv. installment of principal or interest thereon remains overdue for two crop seasons for short duration crops,
v. installment of principal or interest thereon remains overdue for one crop season for long duration crops,
vi. amount of liquidity facility remains outstanding for more than 90 days, in respect of a securitisation transaction
undertaken in terms of RBI guidelines on Securitisation dated February 1, 2006.
vii. in respect of derivative transactions, the overdue receivables representing positive mark-to-market value of a
derivative contract, if these remain unpaid for a period of 90 days from the specified due date for payment.
204
Out of Order status: An account should be treated as 'out of order' if the outstanding balance remains continuously
in excess of the sanctioned limit / drawing power. In cases where the outstanding balance in the principal operating
account is less than the sanctioned limit / drawing power, but there are no credits continuously for 90 days as on the
date of Balance Sheet or credits are not enough to cover the interest debited during the same period, these accounts
should be treated as 'out of order'.
Overdue: Any amount due to the bank under any credit facility is 'overdue' if it is not paid on the due date fixed by the
bank.
Credit Risk Exposures
(a) Total Gross Credit Risk Exposures as on 31st March, 2016
(` in millions)
Fund Based* 1,232,022
Non-Fund Based** 557,410
Total Exposures 1,789,432
* Includes all exposures such as Cash Credit, Overdrafts, Term Loan, Cash, SLR securities etc., which are held
in banking book.
2II%DODQFH LWHPV VXFK DV /HWWHU RI &UHGLW %DQN *XDUDQWHH DQG FUHGLW H[SRVXUH HTXLYDOHQW RI ,QWHUEDQN
forwards, merchant forward contracts and derivatives, etc.
(b) Geographic Distribution of Exposures as on 31st March, 2016
(` in millions)
Domestic Overseas
Fund Based 1,232,022 -
Non-Fund Based 557,410 -
Total Exposures 1,789,432 -
(c) Industry-Wise Distribution of Exposures as on 31st March, 2016
(` in millions)
Industry Name Fund Based Non-Fund Based
NBFCs
NBFCs (other than HFCs) 7,610 4,503
NBFC – AFC (Asset Finance Company) 1,967 2
NBFC – IFC (Infrastructure Finance Company) - 412
NBFC IC (Investment Company) - -
NBFCs (Micro Finance Institution) 10,133 71
Construction
Constn related to infra.- EPC 13,891 8,335
Roads/other infra project 5,989 8,404
205
(` in millions)
Contract Construction - Civil 11,131 20,530
Real Estate
Real Estate Developers 42,424 4,113
Lease Rental Discounting - Real Estate 41,045 222
Housing Finance Companies 12,831 3,433
Loans against Property - Corporate 3,980 6
Loans against Property- Consumer Finance Division 52,937 -
Power
3RZHU*HQHUDWLRQ 10,657 48,273
Power Transmission 21,962 1,079
Power Distribution 760 129
Power Trading - 3,235
Cables
Telecom Cables 573 779
Power Cables 414 476
Steel
Steel-Long Products 1,665 6,713
6WHHO)ODWV&5*3*& 785 1,199
Steel Flats- HR 279 1,168
Steel – Alloy 2,027 358
Steel Pipes 1,753 4,227
Sponge Iron - 907
Casting & Forgings 4,601 218
Stainless Steel 1,232 3,243
Iron and Steel Rolling Mills 954 168
Pig Iron 1,936 464
Textiles
7H[WLOHV5HDG\PDGH*DUPHQWV 3,260 227
Textiles - Cotton fabrics 791 517
206
(` in millions)
Textiles - Cotton fibre / yarn 224 237
Textiles - Manmade fibres / yarn 556 240
Textiles-Texturising 185 59
Textile-Blended Yarn 230 0
Textile – Jute 110 -
Textiles - Synthetic Fabrics 799 8
Textile – Silk - 11
Textile – Machinery 24 6
Cotton ginning, Cleaning, Baling 672 0
Telecom
Telecom – Cellular 27,563 64,759
Telecom Equipments 996 455
Pharmaceuticals
Pharmaceuticals - Bulk Drugs 3,706 3,646
Pharmaceuticals – Formulations 4,464 3,477
Chemicals
Chemicals – Organic 2,772 1,136
Chemicals – Inorganic 1,291 569
Fertilisers
Fertilisers – Phosphatic - -
Fertilizers – Nitrogenous 1,292 5,558
Paper
Paper - Writing and Printing 1,204 3,468
Paper – Industrial 3,840 3,434
Paper Newsprint 310 84
Petroleum & Products 379 14,427

Engineering & Machinery 6,333 29,002
*HPVDQG-HZHOOHU\ 52,743 2,392
207
(` in millions)
Edible Oils 650 905
Auto Ancillaries 4,700 2,692
Diversified 15,946 2,284
Hospital & Medical Services 2,412 342
Food Credit 8,063 338
Aluminium 1,442 2,798
Capital Market Brokers 2,606 13,105
Microfinance Institution 399 -
Rubber & Rubber Products 3,295 327
Lease Rental Discounting – Others 10,042 13
Plastic & Plastic Products 4,791 1,140
Food Product & Beverages and other food processing 7,154 257
Sugar - 2,686
SME - Miscellaneous-Mfng 1,541 257
Electronic componets 1,140 652
Commodity Market Brokers 905 2,445
Beverage, Breweries, Distileries - -
Hotels & Tourism 2,116 1,603
*ODVV *ODVV3URGXFWV 564 215
Shipping - 5,468
Educational Institutions 2,924 237
Computers – Hardware 76 329
Coal - 626
IT Enabled Services 4,299 2,340
Electrical fittings 253 192
Petrochemicals 1,126 2,563
Banks 56,643 71,978
Animal Husbandry 78 -
Mining, Quarrying & Minerals 1,280 1,440
Construction Equipments 1,652 1,030
Airlines 177 1
Wood and Wood Product 493 30
Leather & leather Products 874 456
208
(` in millions)
Tiles / Sanitaryware 438 535
Transport Services 2,794 653
2LODQG*DV([SORUDWLRQ 297 16,504
Electric Equipment 2,882 6,537
Media, Entertainment & Advt 14,022 3,681
Organised Retailing 135 -
Trading – Wholesale 40,854 14,099
Trading – Retail 26,912 3,405
Services 12,616 14,666
Credit Cards 12,040 -
Consumer Finance Division 281,347 -
Other Industries 45,532 44,245
Residual Assets 287,231 77,963
Total Exposure 1,232,022 557,410
Exposures to industries (other than consumer finance division) in excess of 5% of total exposure
(` in millions)
Industry Fund Based Non-Fund Based
Banks 56,643 71,978
(d) Residual Contractual Maturity breakdown of assets
(` in millions)
Assets Next 2 days 8 Days 15 to 30 31 days Over 2 Over 3 Over 6 Over 1 Over 3 Over 5 Total
Day to 7 to 14 Days to 2 months months months year to years to years
days Days months to 3 to 6 to 1 3 years 5 years
months months year
Cash 7,395 - - - - - - - - - - 7,395
Balances with - - - 4,137 1,919 2,512 3,900 2,586 6,645 4,873 11,243 37,815
RBI
Balances with 11,982 17,794 1,556 2,725 - - 80 6,790 13,433 1,548 - 55,908
other Banks
Investments** - 312 500 - - 19,309 28,760 43,456 30,390 40,554 177,262 340,543
Advances* 7,285 79,759 19,096 28,144 50,104 74,910 57,835 108,887 327,910 91,266 55,997 901,193
Fixed Assets - - - - - - - - - - 12,553 12,553
Other Assets 7,705 919 30,512 2,233 4,461 2,228 9,435 9,783 11,586 4,070 7,630 90,561
** Includes Net Repo 28400 mio
* Includes BRDS17000 mio
209
(e) Movement of NPAs and Provision for NPAs as on 31.03.16
(` in millions)
A Amount of NPAs (Gross) 7768
Sub-standard 3,072
Doubtful 1 1,311
Doubtful 2 2,608
Doubtful 3 483
Loss 294
B Net NPAs 3217
C NPA ratios
*URVV13$WR*URVVDGYDQFHV 0.87%
Net NPA to Net advances (%) 0.36%
D Movement of NPAs (Gross)
Opening Balance as on 01.04.15 5,629
Additions during the period 8,486
Reductions during the period 6,347
Closing Balance as on 31.03.16 7,768
E Movement of provision for NPAs**
Opening as on 01.04.15 3,524
Provision made till 31.03.16 5,173
Write off 2807
Write back of excess provisions 1340
Any other adjustments, including transfers between provisions -
Closing as on 31.03.16 4551
Particulars Amount (` in millions)

Write offs booked directly to income statement Refer to E above
Recoveries booked directly to income statement 723
(f) Non Performing Investments and Movement of provision for depreciation on Non Performing
Investments
(` in millions)
A Amount of Non-Performing Investments 23
B Amount of provisions held for non-performing investments 23
C Movement of provisions for depreciation on investments
Opening as on 01.04.15 269
Add: Provisions made till 31.03.16 295
Less: Write-off/ write-back of excess provisions -
Closing Balance as on 31.03.16 564
210
(g) Major Industry Break up of NPA and Provision
(` in millions)
Industry Gross NPA Specific Provision
NPA in Top 5 Industry 416 344
(h) Geography wise Distribution of NPA and Provision
(` in millions)
*HRJUDSK\ *URVV13$ Specific Provision
Domestic 7768 4451
Overseas - -
Total 7768 4451
DF-4: Credit risk: Disclosures for Portfolios Subject to the Standardised Approach
As per the Basel II guidelines on Standardised approach, the risk weight on certain categories of domestic
counter parties is determined based on the external rating assigned by any one of the accredited rating agencies,
i.e. CRISIL, ICRA, CARE, India Rating Pvt. Ltd, Brickworks Ratings India Pvt. Ltd and SMERA. For Foreign
counterparties and banks, rating assigned by S&P, Moody’s and Fitch are used.
Bank computes risk weight on the basis of external rating assigned, both Long Term and Short Term, for the
facilities availed by the borrower. The external ratings assigned are generally facility specific. Bank follow below
mentioned procedures as laid down in Basel II guidelines for usage of external ratings:
5DWLQJVDVVLJQHGE\RQHUDWLQJDJHQF\DUHXVHGIRUDOOWKHW\SHVRIFODLPVRQWKHERUURZLQJHQWLW\
/RQJWHUPUDWLQJVDUHXVHGIRUIDFLOLWLHVZLWKFRQWUDFWXDOPDWXULW\RIRQH\HDU DERYH6KRUWWHUPUDWLQJVDUH
generally applied for facilities with contractual maturity of less than one year.
,IHLWKHUWKHVKRUWWHUPRUORQJWHUPUDWLQJVDWWUDFWVULVNZHLJKWRQDQ\RIWKHFODLPVRQWKHERUURZHU
Bank assigns uniform risk weight of 150% on all the unrated claims, both short term and long term unless the
exposure is subjected to credit risk mitigation.
,QFDVHRIPXOWLSOHUDWLQJVLIWKHUHDUHWZRUDWLQJVDVVLJQHGWRWKHIDFLOLW\WKDWPDSVWRGLIIHUHQWULVNZHLJKWV
the rating that maps to higher risk weight is used. In case of three or more ratings, the ratings corresponding
to the two lowest risk weights is referred to and the higher of those two risk weights is be applied. i.e., the
second lowest risk weight.
)RU VHFXULWL]HG DQG JXDUDQWHHG WUDQVDFWLRQV 62 UDWLQJV DVVLJQHG E\ WKH UDWLQJ DJHQF\ DUH DSSOLHG IRU
arriving at the risk weights.
Risk Weight-wise distribution of Gross Credit Exposures -
Category (` in millions)
Below 100% Risk Weights 1,238,494
100% Risk Weights 390,639
More than 100% Risk Weights 160,299
Deducted -
211
DF-5: Credit risk mitigation: Disclosures for standardised approach
Bank mitigates credit exposure with eligible collaterals and guarantees to reduce the credit risk of obligors as
stipulated under Basel II. In principle with mitigating credit risk, Bank has put in place a comprehensive Policy
on Credit Risk Mitigants and Collaterals for recognizing the eligible collaterals and guarantors for netting the
exposures and reducing the credit risk of obligors. Basic procedures and descriptions of controls as well as types
of standard/acceptable collaterals, guarantees necessary in granting credit, evaluation methods for different types
of credit and collateral, applicable “haircuts” to collateral, frequency of revaluation and release of collateral are
stipulated in the Bank’s credit policy, policy on collateral management and credit risk mitigant policy. The Bank
uses net exposure for capital calculations after taking cognizance of eligible financial collaterals. All collaterals
and guarantees are recorded and the details are linked to individual accounts. Perfection of security interest, date,
currency and correlation between collateral and counterparty are also considered.
As lending is subject to default risk, Bank accepts collateral securities to minimize the impact of loss and
consequently reducing the credit risk. The type of collaterals is determined based on the nature of facility, product
type, counter party risk and its credit quality. However, as explained earlier, collateral is not the sole criteria for
granting credit. For Corporate and SME clients, working capital facility is generally secured by charge on current
assets and Term loan is secured by charge on fixed assets. In case of project financing, Bank generally stipulates
escrow of receivables/project cash flows along with the charge on underlying project assets. The credit risk policy
clearly defines the types of secondary securities and minimum percentage in relation to the total exposures that
is required to be obtained in case of credit granted to obligors falling outside the preferred rating grade. Credit
facilities are also granted against the security of assets such as cash deposits, NSC, guarantee, mortgages,
pledge of shares and commodities, bank guarantees, accepted bills of exchange, assignment of receivables etc.
The credit facilities, in terms of risk policies, are secured by secondary collaterals such as cash deposits, NSC,
guarantee, mortgages, fixed assets etc. Bank also grants unsecured credit to the borrowers with high standing
and low credit risk profile. Customers under Credit card programme are assessed by means of comprehensive
customer selection parameters.
For Business Banking clients, who are driven by product programmes and templated scoring models, the
facilities are ordinarily secured by adequate collaterals. The programmes have a robust mechanism for collateral
acceptance, valuation and monitoring.
In case of schematic products such as Home Loan, LAP, Auto Loan, etc., Loan to value ratio, margin and valuation/
revaluation of collaterals is defined in the respective product programme. The valuation is generally carried out
by the empanelled valuer of the Bank. Bank has also put in place approved product paper on loan against
warehouse receipts, shares and other securities. The margin, valuation and revaluation of the assets are specified
in the product note.
The credit approving authorities also decides on the type and amount of collaterals for each type of facility on a
case-to-case basis. For schematic loans and facilities offered under product programme, securities are obtained
as defined in the product notes.
Eligible financial asset collateral and guarantor
For the purpose of credit risk mitigation, i.e. offsetting the amount of collateral/ basket of collaterals against the
individual / pool of exposures to which the collaterals are assigned, financial asset collateral types are defined
by the Bank as per the Capital Adequacy Framework to include Fixed deposits, KVP, IVP, NSC, Life Insurance
3ROLFLHV*ROG6HFXULWLHVLVVXHGE\&HQWUDODQG6WDWH*RYHUQPHQWVDQGXQLWVRI0XWXDO)XQG2QDVLPLODUQRWH
the eligible guarantors are classified into the following categories:
Sovereigns, Sovereign entities, Banks and Primary Dealers with lower risk weights than the counterparty
Other entities including guarantee cover provided by parent, subsidiary and affiliate companies when they
have lower risk weight than the obligor.
212
(` in millions)
Particulars Eligible Financial Collaterals Supported by guarantee

Exposure before applying eligible mitigants 221881 8063
Exposure after applying eligible mitigants 147335 -
DF-6: Securitisation Exposures: Disclosure for standardised approach
Securitisation "means a process by which a single performing asset or a pool of performing assets are sold to a
bankruptcy remote Special Purpose Vehicle (SPV) and transferred from the balance sheet of the originator to the
SPV in return for an immediate cash payment.
SPV" means any company, trust, or other entity constituted or established for a specific purpose - (a) activities of
which are limited to those for accomplishing the purpose of the company, trust or other entity as the case may
be; and (b) which is structured in a manner intended to isolate the corporation, trust or entity as the case may be,
from the credit risk of an originator to make it bankruptcy remote.
Bank had neither originated any securitization transactions by way of sale of securitised assets, nor retained any
exposure on such assets, actual conditional, or contingent, during the period ended March 31, 2016.
The Bank, in the past, had carried out securitization transaction and such deals were done on the basis of ‘True
Sale’, which provides 100% protection to the Bank from the default in case of assets originated by it. All risks in the
securitised portfolio were transferred to the Special Purpose Vehicle (SPV). Post-securitisation, Bank continued to
service the loans transferred under securitization. Bank had also provided for credit enhancements in the form of
cash collaterals to a minimum extent.
The Bank, in the past, had securitized its assets with the objectives of managing its funding requirements,
improving liquidity, reducing credit risk and diversifying the portfolio risk, managing interest rate risk, and capital
adequacy. The Bank has not securitised any of its portfolios for the past 8 years.
Apart from managing credit risk, Bank also considers different types of risks viz. interest rate risk and liquidity risk
for the retained assets or acquired portfolio and ensure its adequate assessment and mechanism for mitigating
the same. The securitized portfolio, both the retained part and acquired assets are monitored regularly in terms
of various risk parameters such as repayment, cash flows to service the interest, principal and other charges,
counterparty risk, servicer’s capability, underlying asset risk profile and interest rate risk.
Exposure details on account of securitization transactions
(a) Securitisation exposures in Banking Book
There are no outstanding under the securitization exposures as on 31st March 2016. No securitization
activities were undertaken by the Bank during the period ended 31st March 2016.
(b) Amount of Assets intended to be securitized within a year:
For the time being Bank does not have any plans to undertake securitization of its assets. However, for the
purpose of balance sheet management and if the opportunities arises, securitization of exposure may be
explored.
(c) Securitisation exposures in Trading Book:
Aggregate amount of on-balance sheet securitisation exposures retained or purchased broken down by
exposure type
Exposure Type Amount (` in millions)

Micro Finance Loans 4,599.41
Vehicle Loans 545.63
213
Aggregate amount of securitisation exposures retained or purchased subject to Comprehensive Risk
Measure for specific risk
Exposure Type Amount (` in millions)

Micro Finance Loans 4,599.41
Vehicle Loans 545.63
Aggregate amount of securitisation exposures retained or purchased subject to securitisation framework

for specific risk broken down into different risk weight bands
Risk Weight band Amount (` in millions)

<100% risk weight 4090.70
100% risk weight 1054.34
>100% risk weight -
Total 5145.04
Aggregate amount of the capital requirements for the securitisation exposures, subject to the securitisation
framework broken down into different risk weight bands:
Risk Weight band Capital Charge Amount (` in millions)

<100% risk weight 227.24
100% risk weight 121.01
>100% risk weight -
Total 348.24
Securitisation exposures deducted from capital
Exposure Type Exposures deducted Credit enhancing interest- Other exposures deducted
entirely from Tier-1 capital only strips deducted from from total capital
total capital
NA
DF-7: Market risk in Trading book
Market Risk may be defined as the possibility of loss to a bank caused by changes in the market variables.
The market risk for the Bank is governed by the Market Risk Policy and Funds and Investment policy which are
approved by the Board. These policies serve to outline the Bank’s risk appetite and risk philosophy in respect
of Treasury / Forex / Equity / Derivatives / Bullion operations, and the controls that are considered essential for
the management of market risks. The policies are reviewed periodically to update it with changed business
requirements, economic environment and revised regulatory guidelines.
Sources of market risk:
Market risks arise from the following risk factors:
Price risk for bonds, forex, equities and bullion
Interest rate risk for investments, derivatives, etc.
Exchange rate risk for currencies; and
Trading / liquidity risk.
214
Objectives of Market risk management:
The broad objectives of Market Risk management are:
Management of interest rate risk and currency risk of the trading portfolio.
Adequate control and suitable reporting of investments, Forex, Equity and Derivative portfolios
Compliance with regulatory and internal guidelines.
Monitoring and Control of transactions of market related instruments.
Scope and nature of risk reporting and measurement systems:
Reporting
Market Risk group reports various investments, Foreign exchange positions and derivatives position with their related
risk measures to top management daily and to Committees of the Board on a periodic basis. Bank periodically reports
the related positions to regulators in compliance with regulatory requirements.
Measurement
Bank monitoring its risks through risk management tools and techniques such as are Value-at-Risk, Modified Duration,
PV01, Stop Loss, amongst others. Based on risk appetite of the Bank, various risk limits are placed which are monitored
on a daily basis.
Capital requirements for Market risks @ 9%
(` in millions)
Market Risk elements Amount of capital required
Interest Rate Risk 4,130
Foreign Exchange Risk (including gold) 304
Equity Risk 482
DF-8: Operational Risk
Bank has framed Operational Risk Management Policy duly approved by the Board. Other policies adopted by
the Board that deals with management of operational risk are (a) Information System Security Policy (b) Policy
on Know Your Customer (KYC) and Anti Money Laundering Policy (AML) process (c) IT business continuity and
Disaster Recovery Plan and (d) Business Continuity Plan (BCP) (e) New Product Programme Policy (f) Framework
for Risk and Control Self Assessment (RCSA) and (g) Risk Event Reporting Framework.
Operational Risk Management Policy adopted by the Bank outlines organization structure and detailed process
for management of Operational Risk. Basic objective of the policy is to closely integrate operational management
system to risk management processes of the Bank by clearly assigning roles for effectively identifying,
assessing, monitoring and controlling / mitigating operational risk exposures, including material operational
losses. Operational risks in the Bank are managed through comprehensive and well-articulated internal control
frameworks. Bank has implemented the process of capturing, reporting and assessing risk events at the process
level using RCSA framework.
DF-9: Interest rate risk in the banking book (IRRBB)
Interest Rate Risk is the risk of loss in the Bank’s net income and net equity value arising out of a change in level
of interest rates and / or their implied volatility. Interest rate risk arises from holding assets and liabilities with
different principal amounts, maturity dates and re-pricing dates. The Bank holds assets, liabilities and off balance
sheet items across various markets with different maturity or re-pricing dates and linked to different benchmark
rates, thus creating exposure to unexpected changes in the level of interest rates in such markets. Interest rate
risk in the banking book refers to the risk associated with interest rate sensitive instruments that are not held in
the trading book of the Bank.
215
Risk management framework
The Board of the Bank has overall responsibility for management of risks and it decides the risk management
policy of the Bank and set limits for liquidity, interest rate, foreign exchange and equity price risks. The Asset
Liability Management Committee (ALCO) consisting of Bank’s senior management including Managing Director
is responsible for ensuring adherence to the limits set by the Board as well as for deciding the business strategy
of the Bank (for the assets and liabilities) in line with the Bank’s budget and decided risk management objectives.
ALCO decides strategies and specifies prudential limits for management of interest rate risk in the banking book
within the broad parameters laid down by Board of Directors. These limits are monitored periodically and the
breaches, if any, are reported to ALCO.
Monitoring and Control
The Board of Directors has approved the Asset-Liability Management policy. The policy is intended to be flexible
to deal with rapidly changing conditions; any variations from policy should be reported to the Board of Directors
with recommendations and approval from the ALCO.
The Bank has put in place a mechanism for regular computation and monitoring of prudential limits and ratios for
liquidity and interest rate risk management. The Bank uses its system capability for limits and ratio monitoring.
The ALCO support group generates periodic reports for reporting these to ALCO and senior management of
the Bank. The ALM support group carries out various analyses related to assets and liabilities, forecast financial
market outlook, compute liquidity ratios and interest rate risk values based on the earnings and economic value
perspective.
Risk measurement and reporting framework:
The estimation of interest rate risk involves interest rate sensitive assets (RSAs) and interest rate sensitive liabilities
(RSLs).
The techniques for managing interest rate risk include:
Interest rate sensitivity gap Analysis
Earning at Risk Analysis
Stress Testing
Interest rate sensitivity gap: The gap or mismatch risk as at a given date, is measured by calculating gaps
RYHUGLIIHUHQWWLPHLQWHUYDOV*DSDQDO\VLVPHDVXUHVPLVPDWFKHVEHWZHHQUDWHVHQVLWLYHOLDELOLWLHV56/DQGUDWH
sensitive assets (RSA) (including off-balance sheet positions). The report is prepared by grouping liabilities,
assets and off-balance sheet positions into time buckets according to residual maturity or next re-pricing period,
whichever is earlier. The difference between RSA and RSL for each time bucket signifies the gap in that time
bucket. The gap report provides a good framework for determining the earnings impact.
Earning at Risk: Any change in interest rate would impact Bank’s net interest income (NII) and the value of its
fixed income portfolio (price risk). The interest rate risk is measured by EaR that is the sensitivity of the NII to a
100 basis points adverse change in the level of interest rates.
Stress Testing: The Bank measures the impact on net interest margin (NIM) / EaR after taking into account various
possible movement in interest rates across tenor and their impact on the earnings and economic value of the
Bank is calculated for each of these scenarios. These reports are prepared on a monthly basis for measurement
of interest rate risk
:LWK DQ XSZDUG UDWH VKRFN RI DFURVV WKH FXUYH DV SHU 5DWH 6HQVLWLYH *DSV LQ ,15 DV RQ WKH
earning shows a decline of `126 million.
The impact of change in interest rate by 100 bps and 50 bps has been computed on open positions
(as on March 31, 2016) and shown hereunder against the respective currencies.
216
Change in interest rates (in bps)
Impact on NII (` in millions)
Currency -100 -50 50 100
INR 131 66 (66) (131)
USD (0.00) (0.00) 0.00 0.00
JPY (0.00) (0.00) 0.00 0.00
*%3 (0.00) (0.00) 0.00 0.00
EUR (0.00) (0.00) 0.00 0.00
Others 0.00 0.00 (0.00) (0.00)
Total 131 66 (66) (131)
DF-10: General Disclosures for Exposures Related to Counterparty Credit Risk

Counterparty Credit Risk (CCR) is the risk that the counterparty to a transaction could default before the final
settlement of the transaction's cash flows. An economic loss would occur if the transactions or portfolio of
transactions with the counterparty has a positive economic value for the Bank at the time of default. Unlike
exposure to credit risk through a loan, where the exposure to credit risk is unilateral and only the lending bank
faces the risk of loss, CCR creates a bilateral risk of loss whereby the market value for many different types of
transactions can be positive or negative to either counterparty. The market value is uncertain and can vary over
time with the movement of underlying market factors.
Capital is allocated to CCR exposures taking into consideration the regulatory guidelines on Basel – III capital
adequacy computation.
Counterparty credit risk is managed and controlled through variety of risk policies and monitoring procedures
including, but not limited, to the following:
&UHGLW5LVN3ROLF\
%DQN5LVN3ROLF\
'HULYDWLYHV3ROLF\DQG
&RXQWU\5LVN3ROLF\
It is possible for the counterparty's credit quality to be co-dependent with the level of exposure. This effect is
called wrong-way risk if the exposure tends to increase when the counterparty credit quality gets worse. Wrong
way risk is controlled through policies that manage industry, country and individual counterparty concentrations.
Exposure on account of Counterparty Credit Risk
(` in millions)
Particulars Amount
*URVVSRVLWLYHYDOXHRIFRQWUDFWV 28,216.97
Netting Benefits -
Netted current credit exposure 85,126.74
Collateral held 2,748.09
Net derivative credit exposure 82,378.64
217
DF-11 to DF-14: Capital Disclosures
Detailed disclosures with respect to (i) Composition of Capital, (ii) Composition of Capital –Reconciliation
Requirements, (iii) Main features of Regulatory Capital Instruments and (iv) Full terms and conditions of Regulatory
Capital Instruments are enclosed as per Tables XI, XII and XIII respectively. XIV has been disclosed separately on
the Bank’s website under ‘Regulatory Disclosures Section’.
DF-16: Equities – Disclosure for Banking Book Positions
Bank does not have any Equities under Banking Book.
DF-17: Summary comparison of accounting assets vs. leverage ratio exposure measure
Leverage Ratio:
Leverage ratio is a non-risk based measure of exposure over capital. The leverage ratio is calibrated to act as a
credible supplementary measure to the risk based capital requirements
The Basel III leverage ratio is defined as the capital measure (the numerator) divided by the exposure measure
(the denominator), with this ratio expressed as a percentage
Leverage Ratio = Capital Measure (Tier I Capital)
Exposure Measure
Summary comparison of accounting assets vs. leverage ratio exposure measure

Item (` in millions)
1 Total consolidated assets as per published financial statements 1,374,159
2 Adjustment for investments in banking, financial, insurance or commercial entities that are -
consolidated for accounting purposes but outside the scope of regulatory consolidation
3 Adjustment for fiduciary assets recognised on the balance sheet pursuant to the operative (1629)
accounting framework but excluded from the leverage ratio exposure measure
4 Adjustments for derivative financial instruments 82,379
5 Adjustment for securities financing transactions (i.e. repos and similar secured lending) 60,963
6 Adjustment for off-balance sheet items (i.e. conversion to credit equivalent amounts of 343,834
off- balance sheet exposures)
7 Other adjustments -
8 Leverage ratio exposure 1,859,705
218
DF-18: Leverage ratio
Leverage ratio
Leverage ratio framework
Item
(` in Million)
On balance sheet exposure
On-balance sheet items (excluding derivatives and SFTs, but including
1 1,374,159
collateral)
2 (Asset amounts deducted in determining Basel III Tier 1 capital) (1,629)
Total on-balance sheet exposures (excluding derivatives and SFTs) (sum
3 1,372,530
of lines 1 and 2)
Replacement cost associated with all derivatives transactions (i.e. net of

4 25,469
eligible cash variation margin)
5 Add-on amounts for PFE associated with all derivatives transactions 56,910
*URVVXSIRUGHULYDWLYHVFROODWHUDOSURYLGHGZKHUHGHGXFWHGIURPWKH
6 -
balance sheet assets pursuant to the operative accounting framework
(Deductions of receivables assets for cash variation margin provided in
7 -
derivatives transactions)
8 (Exempted CCP leg of client-cleared trade exposures) -
9 Adjusted effective notional amount of written credit derivatives -
(Adjusted effective notional offsets and add-on deductions for written credit
10 -
derivatives)
11 Total derivative exposures (sum of lines 4 to 10) 82,379
*URVV6)7DVVHWVZLWKQRUHFRJQLWLRQRIQHWWLQJDIWHUDGMXVWLQJIRUVDOH

12 58,436
accounting transactions
(Netted amounts of cash payables and cash receivables of gross SFT
13 -
assets)
14 CCR exposure for SFT assets 2527
15 Agent transaction exposures -
16 Total securities financing transaction exposures (sum of lines 12 to 15) 60,963
Other off-balance sheet exposures
17 Off-balance sheet exposure at gross notional amount 689,964
18 (Adjustments for conversion to credit equivalent amounts) (346,130)
19 Off-balance sheet items (sum of lines 17 and 18) 343,834
Capital and total exposures
20 Tier 1 capital 173,498
21 Total exposures (sum of lines 3, 11, 16 and 19) 1,859,705
Leverage ratio
22 Basel III leverage ratio 9.33%
219
Independent Auditors’ Report
To the Members of IndusInd Bank Limited

Report on the Consolidated Financial Statements
1. We have audited the accompanying Consolidated Financial Statements of IndusInd Bank Limited (hereinafter
referred to as “the Bank”) and its associate company (refer Schedule 17(1) to the attached Consolidated Financial
Statements), comprising of the Consolidated Balance Sheet as at March 31, 2016, the Consolidated Profit and
Loss Account, the Consolidated Cash Flow Statement for the year then ended, and a summary of significant
accounting policies and other explanatory information prepared based on the relevant records (hereinafter
referred to as “the Consolidated Financial Statements”).
Management’s Responsibility for the Consolidated Financial Statements
2. The Board of Directors of the Bank is responsible for the preparation of these Consolidated Financial Statements
in terms of the requirements of the Companies Act, 2013 (hereinafter referred to as “the Act”) that give a true and
fair view of the consolidated financial position, consolidated financial performance and consolidated cash flows
of the Bank and its associate in accordance with accounting principles generally accepted in India including
the Accounting Standards specified under Section 133 of the Act read with Rule 7 of the Companies (Accounts)
Rules, 2014 and the requirements of Section 29 of the Banking Regulation Act, 1949 (B R Act) and other applicable
Reserve Bank of India (RBI) directions in so far as it relates to the financial statements of the Bank. The Bank’s
Board of Directors is also responsible for ensuring accuracy of records including financial information considered
necessary for the preparation of Consolidated Financial Statements. The respective Board of Directors of the
Bank and its associate company is responsible for maintenance of adequate accounting records in accordance
with the provisions of the Act for safeguarding the assets of the Bank and its associate respectively and for
preventing and detecting frauds and other irregularities; the selection and application of appropriate accounting
policies; making judgements and estimates that are reasonable and prudent; and the design, implementation and
maintenance of adequate internal financial controls, that were operating effectively for ensuring the accuracy and
completeness of the accounting records, relevant to the preparation and presentation of the financial statements
that give a true and fair view and are free from material misstatement, whether due to fraud or error, which has
been used for the purpose of preparation of the Consolidated Financial Statements by the Directors of the Bank,
as aforesaid.
3. Our responsibility is to express an opinion on these Consolidated Financial Statements based on our audit.
While conducting the audit, we have taken into account the provisions of the Act and the Rules made thereunder
including the accounting standards and matters which are required to be included in the audit report.
4. We conducted our audit in accordance with the Standards on Auditing specified under Section 143(10) of the
Act and other applicable authoritative pronouncements issued by the Institute of Chartered Accountants of India.
Those Standards and pronouncements require that we comply with ethical requirements and plan and perform
the audit to obtain reasonable assurance about whether the Consolidated Financial Statements are free from
material misstatement.
5. An audit involves performing procedures to obtain audit evidence about the amounts and disclosures in the
Consolidated Financial Statements. The procedures selected depend on the auditors’ judgement, including the
assessment of the risks of material misstatement of the Consolidated Financial Statements, whether due to fraud
or error. In making those risk assessments, the auditor considers internal financial control relevant to the Bank’s
preparation of the Consolidated Financial Statements that give a true and fair view, in order to design audit
procedures that are appropriate in the circumstances. An audit also includes evaluating the appropriateness of
the accounting policies used and the reasonableness of the accounting estimates made by the Bank’s Board of
Directors, as well as evaluating the overall presentation of the Consolidated Financial Statements.
6. We believe that the audit evidence obtained by us and the audit evidence obtained by the other auditor in terms
of their reports referred to in sub-paragraph 8 of the Other Matters paragraph below, is sufficient and appropriate
to provide a basis for our audit opinion on the Consolidated Financial Statements.
220
Opinion
7. In our opinion and to the best of our information and according to the explanations given to us, the aforesaid
Consolidated Financial Statements give the information required by the Act and the provisions of section 29 of
the B R Act and other applicable RBI directions insofar it relates to the financial statements of the Bank included
in these Consolidated Financial Statements, in the manner so required and give a true and fair view in conformity
with the accounting principles generally accepted in India of the consolidated state of affairs of the Bank and its
associate as at March 31, 2016, and their consolidated profit and their consolidated cash flows for the year ended
on that date.
Other Matter
8. The consolidated financial statements also include the Bank’s share of net profit of ` 27,68,040 for the year ended
March 31, 2016 as considered in the Consolidated Financial Statements, in respect of one associate company
whose financial statements have not been audited by us. These financial statements have been audited by other
auditor whose reports have been furnished to us by the Management, and our opinion on the Consolidated
Financial Statements insofar as it relates to the amounts and disclosures included in respect of the associate
company and our report in terms of sub-sections (3) and (11) of Section 143 of the Act insofar as it relates to the
aforesaid associate, is based solely on the reports of the other auditor.
Our opinion on the consolidated financial statements and our report on Other Legal and Regulatory Requirements
below, is not modified in respect of the above matters with respect to our reliance on the work done and the
reports of the other auditor.
Report on Other Legal and Regulatory Requirements

9. In our opinion, the Consolidated Financial Statements dealt with by this report have been drawn up in accordance
with applicable provisions of section 133 of the Act read with Rule 7 of the Companies (Accounts) Rules, 2014 and
the provisions of section 29 of the B R Act insofar as it relates to the financial statements of the Bank included in
these Consolidated Financial Statements.
10. As required by Section 143(3) of the Act and Section 30 of the B R Act, we report, to the extent applicable, that:
(a) We have sought and obtained all the information and explanations which to the best of our knowledge and
belief were necessary for the purposes of our audit of the aforesaid Consolidated Financial Statements.
(b) The transactions of the Bank, which have come to our notice during the course of our audit, have been within
the powers of the Bank;
(c) In our opinion, proper books of account as required by law maintained by the Bank and its associate company
incorporated in India including relevant records relating to preparation of the aforesaid Consolidated Financial
Statements have been kept so far as it appears from our examination of those books and records of the Bank
and the reports of the other auditor.
(d) The Consolidated Balance Sheet, the Consolidated Profit and Loss Account, and the Consolidated Cash Flow
Statement dealt with by this Report are in agreement with the relevant books of account maintained by the
Bank and its associate company incorporated in India including relevant records relating to the preparation
of the Consolidated Financial Statements.
(e) In our opinion, the aforesaid Consolidated Financial Statements comply with the Accounting Standards
specified under Section 133 of the Act, read with Rule 7 of the Companies (Accounts) Rules, 2014 and the
requirements of Section 29 of the Banking Regulation Act and other applicable RBI directions in so far as it
relates to the financial statements of the Bank included in these Consolidated Financial Statements.
(f) On the basis of the written representations received from the Directors of the Bank as on March 31, 2016
taken on record by the Board of Directors of the Bank and the reports of the statutory auditor of its associate
221
company incorporated in India, none of the directors of the Bank and its associate company incorporated in
India is disqualified as on March 31, 2016 from being appointed as a Director in terms of Section 164(2) of
the Act.
(g) With respect to the adequacy of the internal financial controls over financial reporting of the Bank, and
its associate company incorporated in India and the operating effectiveness of such controls, refer to our
separate Report in Annexure A.
(h) With respect to the other matters to be included in the Auditors’ Report in accordance with Rule 11 of the
Companies (Audit and Auditors) Rules, 2014, in our opinion and to the best of our information and according
to the explanations given to us:
i The Consolidated Financial Statements disclose the impact, if any, of pending litigations as at March 31,
2016 on the consolidated financial position of the Bank – Refer Schedule 12 and Note 9 of Schedule 18
to the Consolidated Financial Statements.
ii. Provision has been made in the Consolidated Financial Statements, as required under the applicable
law or accounting standards, for material foreseeable losses, if any, on long-term contracts including
derivative contracts as at March 31, 2016 – Refer (a) Note 11 of Schedule 18 to the Consolidated
Financial Statements in respect of such items as it relates to the Bank and its associate and (b) the
Bank’s share of net profit in respect of its associate.
iii. There has been no delay in transferring amounts, required to be transferred, to the Investor Education
and Protection Fund by the Bank and its associate company during the year ended March 31, 2016.

Russell I Parera
222
Annexure A to Independent Auditors’ Report
Referred to in paragraph 10(g) of the Independent Auditors’ Report of even date to the members of IndusInd
Bank Limited on the Consolidated Financial Statements for the year ended March 31, 2016
Report on the Internal Financial Controls under Clause (i) of Sub-section 3 of Section 143 of
the Act
1. In conjunction with our audit of the Consolidated Financial Statements of the Bank as of and for the year ended
March 31, 2016, we have audited the internal financial controls over financial reporting of IndusInd Bank Limited
(hereinafter referred to as “the Bank”) and its associate company which is company incorporated in India, as of
that date.
Management’s Responsibility for Internal Financial Controls
2. The respective Board of Directors of the Bank, and its associate company, which are companies incorporated
in India, are responsible for establishing and maintaining internal financial controls based on internal control
over financial reporting criteria established by the companies considering the essential components of internal
control stated in the Guidance Note on Audit of Internal Financial Controls Over Financial Reporting issued by the
Institute of Chartered Accountants of India (ICAI). These responsibilities include the design, implementation and
maintenance of adequate internal financial controls that were operating effectively for ensuring the orderly and
efficient conduct of its business, including adherence to the respective company’s policies, the safeguarding of
its assets, the prevention and detection of frauds and errors, the accuracy and completeness of the accounting
records, and the timely preparation of reliable financial information, as required under the Act.
3. Our responsibility is to express an opinion on the Bank’s internal financial controls over financial reporting based
on our audit. We conducted our audit in accordance with the Guidance Note on Audit of Internal Financial Controls
Over Financial Reporting (the “Guidance Note”) issued by the ICAI and the Standards on Auditing deemed to
be prescribed under section 143(10) of the Companies Act, 2013, to the extent applicable to an audit of internal
financial controls, both applicable to an audit of internal financial controls and both issued by the ICAI. Those
Standards and the Guidance Note require that we comply with ethical requirements and plan and perform the
audit to obtain reasonable assurance about whether adequate internal financial controls over financial reporting
was established and maintained and if such controls operated effectively in all material respects.
4. Our audit involves performing procedures to obtain audit evidence about the adequacy of the internal financial
controls system over financial reporting and their operating effectiveness. Our audit of internal financial controls
over financial reporting included obtaining an understanding of internal financial controls over financial reporting,
assessing the risk that a material weakness exists, and testing and evaluating the design and operating
effectiveness of internal control based on the assessed risk. The procedures selected depend on the auditor’s
judgement, including the assessment of the risks of material misstatement of the financial statements, whether
due to fraud or error.
5. We believe that the audit evidence we have obtained and the audit evidence obtained by the other auditor in
terms of their reports referred to in the Other Matters paragraph below, is sufficient and appropriate to provide a
basis for our audit opinion on the Bank’s internal financial controls system over financial reporting.
Meaning of Internal Financial Controls Over Financial Reporting
6. A company’s internal financial control over financial reporting is a process designed to provide reasonable
assurance regarding the reliability of financial reporting and the preparation of financial statements for external
purposes in accordance with generally accepted accounting principles. A company’s internal financial control
over financial reporting includes those policies and procedures that (1) pertain to the maintenance of records that,
in reasonable detail, accurately and fairly reflect the transactions and dispositions of the assets of the company;
(2) provide reasonable assurance that transactions are recorded as necessary to permit preparation of financial
statements in accordance with generally accepted accounting principles, and that receipts and expenditures of the
company are being made only in accordance with authorisations of management and directors of the company;
and (3) provide reasonable assurance regarding prevention or timely detection of unauthorised acquisition, use,
or disposition of the company’s assets that could have a material effect on the financial statements.
223
Inherent Limitations of Internal Financial Controls Over Financial Reporting
7. Because of the inherent limitations of internal financial controls over financial reporting, including the possibility of
collusion or improper management override of controls, material misstatements due to error or fraud may occur
and not be detected. Also, projections of any evaluation of the internal financial controls over financial reporting
to future periods are subject to the risk that the internal financial control over financial reporting may become
inadequate because of changes in conditions, or that the degree of compliance with the policies or procedures
may deteriorate.
Opinion
8. In our opinion, the Bank and its associate company, which are companies incorporated in India, have, in all
material respects, an adequate internal financial controls system over financial reporting and such internal
financial controls over financial reporting were operating effectively as at March 31, 2016, based on the internal
control over financial reporting criteria established by the Bank considering the essential components of internal
control stated in the Guidance Note on Audit of Internal Financial Controls Over Financial Reporting issued by the
Institute of Chartered Accountants of India.
Other Matters
9. Our aforesaid reports under Section 143(3)(i) of the Act on the adequacy and operating effectiveness of the
internal financial controls over financial reporting insofar as it relates to one associate company, which is company
incorporated in India, is based on the corresponding report of the auditor of such company incorporated in India.
Our opinion is not qualified in respect of this matter.

Russell I Parera
224
Consolidated Balance Sheet as at March 31, 2016
` in ‘000s
SCHEDULE As at
31.03.2016
Capital 1 594,98,63
Employee Stock Options Outstanding 18 (Note 3) 13,76,64
Reserves and Surplus 2 17088,42,78
Deposits 3 93000,34,61
Borrowings 4 22155,86,48
Other Liabilities and Provisions 5 7204,80,65
TOTAL 140058,19,79
ASSETS
Cash and Balances with Reserve Bank of India 6 4521,04,05
Balances with Banks and Money at Call and Short Notice 7 5590,83,10
Investments 8 31215,51,98
Advances 9 88419,34,19
Fixed Assets 10 1255,32,39
Other Assets 11 9056,14,08
TOTAL 140058,19,79
Contingent Liabilities 12 285101,32,08
Bills for Collection 13760,84,54
Notes to the Consolidated Financial Statements 18
The schedules referred to above form an integral part of the Consolidated Balance Sheet
As per our report of even date. For and on behalf of Board of Directors
For Price Waterhouse Chartered Accountants LLP R. Seshasayee T. Anantha Narayanan

Chartered Accountants Chairman Director


225
Consolidated Profit and Loss Account for the year ended
March 31, 2016
` in ‘000s
SCHEDULE Year ended
31.03.2016
I. INCOME
Interest Earned 13 11580,65,89
Other Income 14 3296,94,62
TOTAL 14877,60,51
II. EXPENDITURE
Interest Expended 15 7064,08,65
Operating Expenses 16 3672,10,09
Provisions and Contingencies 1854,96,76
TOTAL 12591,15,50
III. PROFIT
Net Profit for the year 2286,45,01
Add: Share in profit / (loss) of Associate 27,68
Profit brought forward 3664,94,13
TOTAL 5951,66,82
IV. APPROPRIATIONS
Transfer to
a) Statutory Reserve 571,61,25
b) Capital Reserve 13,21,00
c) Investment Reserve Account -
d) Proposed dividend 292,62,03
e) Corporate Dividend Tax 59,57,06
937,01,34
Balance carried over to the Balance Sheet 5014,65,48
TOTAL 5951,66,82
V. EARNINGS PER EQUITY SHARE
(Face value of ` 10/- per share)
Basic (`) 18 (Note 7) 39.68
Diluted (`) 18 (Note 7) 39.26
Notes to the Consolidated Financial Statements 18
The schedules referred to above form an integral part of the Consolidated Profit and Loss Account.



226
Consolidated Cash Flow Statement for the year ended
March 31, 2016
` in ‘000s
Year ended
31.03.2016
A. Cash Flow from Operating Activities
Net Profit before taxation 3469,26,11
Adjustments for :
Depreciation on Fixed assets 156,51,93
(Appreciation) / Depreciation on Investments 29,51,23
Employees Stock Option expenses 2,22,46
Loan Loss and Other Provisions 642,64,44
Amortisation of premium on HTM investments 36,33,24
Loss / (Profit) on sale of fixed assets (6,98,95)
Share in Current Year profit of Associate 27,68
Operating Profit before Working Capital changes 4329,78,14
Adjustments for :
Increase in Advances (20273,78,73)
Increase in Investments (8402,09,83)
Increase in Other Assets (705,99,49)
Increase in Deposits 18865,98,19
Increase in Other Liabilities 747,03,26
Cash generated from / (used in) Operations (5439,08,46)
Direct Taxes paid (net of refunds) (1348,84,10)
Net Cash used in Operating Activities (6787,92,56)
B. Cash Flow from Investing Activities
Purchase of Fixed Assets (including WIP) (269,02,26)
Proceeds from sale of Fixed Assets 11,50,78
Net Cash used in Investing Activities (257,51,48)
C. Cash Flow from Financing Activities
Proceeds from issue of equity shares (net of issue expenses) 5125,19,57
Proceeds from issue of Long Term Infrastructure Bonds -
Dividends paid (284,83,42)
Redemption of Sub-ordinated Tier-2 capital (535,00,00)
Increase in Borrowings 2072,80,85
Net Cash generated from Financing Activities 6378,17,00
Net Increase / (Decrease) in Cash and Cash Equivalents (667,27,04)
Cash and Cash Equivalents at the beginning of the year 10779,14,19
Cash and Cash Equivalents at the end of the year 10111,87,15
Notes:
1. The above Consolidated Cash Flow Statement has been prepared under the indirect method as set out in Accounting
Standard 3 on Cash Flow Statements.
2. Figures in bracket indicate cash outflow.
3. Cash and cash equivalents comprises of Cash in Hand and Balances with RBI (Schedule 6) and Balances with Banks
and Money at Call and Short Notice (Schedule 7).
227
Schedules to the Consolidated Financial Statements
` in ‘000s
As at
31.03.2016
SCHEDULE - 1 CAPITAL
Authorised Capital
70,00,00,000 equity shares of ` 10/- each 700,00,00
Issued, Subscribed and Called Up Capital

Paid up Capital
Refer Schedule 18 (Note 1.1 & 1.2)
TOTAL 594,98,63
SCHEDULE - 2 RESERVES AND SURPLUS

I Statutory Reserve
Opening balance 1634,18,43
Additions during the year 571,61,25
2205,79,68
II Share Premium Account
Less: Share issue expenses 50,67,39
9274,10,55
III General Reserve
Balance as at the end of the year 1,35,57
1,35,57
IV Capital Reserve
170,21,21
V Capital Reserve on Consolidation
Opening Balance 35
Addition during the Year -
35
228
Schedules to the Consolidated Financial Statements (Contd.)
` in ‘000s
As at
31.03.2016
VI Investment Allowance Reserve
Balance as at the end of the year 1,00,00
1,00,00
VII Investment Reserve Account
Opening Balance 40,52,98
Additions during the year -
40,52,98
VIII Revaluation Reserve
Addition during the year -
Less : Deductions during the year 10,23,85
380,76,96
IX Balance in the Profit and Loss Account 5014,65,48
TOTAL 17088,42,78
SCHEDULE - 3 DEPOSITS
A I Demand Deposits
i) From Banks 567,66,73
ii) From Others 14910,35,03
II Savings Bank Deposits 17246,24,53
III Term Deposits
i) From Banks 5001,20,36
ii) From Others 55274,87,96
TOTAL 93000,34,61
B Deposits of Branches
I In India 93000,34,61
II Outside India -
TOTAL 93000,34,61
229
` in ‘000s
As at
31.03.2016
SCHEDULE - 4 BORROWINGS
I Borrowings in India
i) Reserve Bank of India -
ii) Other Banks 4769,68,99
iii) Other Institutions and Agencies 14622,75,24
iv) Unsecured Non-Convertible Redeemable Non-Cumulative 308,90,00
(Subordinated Upper Tier-2 Bonds)
v) Long Term Infrastructure Bonds 500,00,00
II Borrowings outside India 1954,52,25
TOTAL 22155,86,48
Secured borrowings included in I & II above -
SCHEDULE - 5 OTHER LIABILITIES AND PROVISIONS

I Inter-office Adjustments (Net) 126,86,21
II Bills Payable 520,03,19
III Interest Accrued 789,19,18
IV Proposed Dividend 322,25,01
V Others 5446,47,06
TOTAL 7204,80,65
SCHEDULE - 6 CASH AND BALANCES WITH RESERVE BANK OF INDIA

I Cash in hand (including foreign currency notes) 739,52,90
II Balances with Reserve Bank of India
i) In Current Account 3781,51,15
ii) In Other Accounts -
TOTAL 4521,04,05
SCHEDULE - 7 BALANCES WITH BANKS AND MONEY AT CALL AND SHORT NOTICE
I In India
i) Balances with Banks
a) In Current Accounts 454,27,01
b) In Other Deposit Accounts 3059,52,75
ii) Money at Call and Short Notice - With Other Institutions -
TOTAL 3513,79,76
230
` in ‘000s
As at
31.03.2016
II Outside India
i) In Current Accounts 751,93,34
ii) In Other Deposit Accounts -
iii) Money at Call and Short Notice 1325,10,00
TOTAL 2077,03,34
GRAND TOTAL 5590,83,10
SCHEDULE - 8 INVESTMENTS
I In India
Gross Value 31271,88,25
Less : Aggregate of provision / depreciation 56,36,27
Net value of Investments in India 31215,51,98
Comprising :
i) Government securities*++ 25268,03,95
ii) Other approved securities -
iii) Shares 41,32,53
iv) Debentures and bonds 1812,88,69
v) Subsidiaries and / or Joint Ventures -
vi) Others - Security Receipt, Units of schemes of Mutual Funds and Others 4092,06,00
(1)
vii) Associate 1,20,81
II Outside India -
TOTAL 31215,51,98
(1)
Investment in Associate
Investment at Cost 30
Add : Capital Reserve on the date of Acquisition 35
Equity Investment in Associate 65
Add : Post-acquisition profit / loss of Associate (Equity method) 1,20,16
Less : Share of Unrealised Profit in Associate -
TOTAL 1,20,81
*Includes securities costing ` 403.18 crores pledged for clearing facility and margin requirements.
++Net of Repo Borrowings of ` 2,839.99 crores under the Liquidity Adjustment Facility in line
with RBI requirements.
231
` in ‘000s
As at
31.03.2016
SCHEDULE - 9 ADVANCES
A i) Bills Purchased and Discounted 869,52,78
ii) Cash Credits, Overdrafts and Loans Repayable on Demand 23144,94,88
iii) Term Loans 64404,86,53
TOTAL 88419,34,19
B i) Secured by Tangible Assets (includes advances against book debts) 76778,24,12
ii) Covered by Bank / Government Guarantees (includes advances against L/Cs issued by 1125,55,91
Banks)
iii) Unsecured 10515,54,16
TOTAL 88419,34,19
C I) Advances in India
i) Priority Sector 28066,51,54
ii) Public Sector 808,25,51
iii) Banks 29,69
iv) Others 59544,27,45
TOTAL 88419,34,19
II) Advances Outside India -
TOTAL 88419,34,19
SCHEDULE - 10 FIXED ASSETS

I Premises
i) At cost, as at the beginning of the year 595,92,11
ii) Revaluation during the year -
iii) Additions during the year -
595,92,11
iv) Less : Deductions during the year 5,90,29
v) Less : Depreciation to date [Refer Schedule 18 (Note 2.2)] 66,72,06
TOTAL 523,29,76
II Other Fixed Assets (including furniture and fixtures)
i) At cost, as at the beginning of the year 1232,41,88
ii) Additions during the year 269,56,04
1501,97,92
iii) Less : Deductions during the year 36,34,79
iv) Less : Depreciation to date [Refer Schedule 18 (Note 2.2)] 771,08,26
TOTAL 694,54,87
III Capital Work in Progress 37,47,76
GRAND TOTAL 1255,32,39
232
` in ‘000s
As at
31.03.2016
SCHEDULE - 11 OTHER ASSETS
I Interest Accrued 962,60,98
II Tax Paid in Advance / tax deducted at source (net of provision) 456,98,06
III Stationery and Stamps 40,35
IV Non-banking assets acquired in satisfaction of claims 45,52,82
V Others [Marked to market gain or loss on forex and derivative transactions 7590,61,87
(Refer Schedule 18 (Note 15))]
[Deferred Tax Assets (Refer Schedule 18 (Note 8))]
TOTAL 9056,14,08
SCHEDULE - 12 CONTINGENT LIABILITIES

I Claims against the Bank not acknowledged as debts 648,59,09
II Liability on account of outstanding Forward Exchange Contracts 143761,31,22
III Liability on account of outstanding Derivative Contracts 99741,53,69
IV Guarantees given on behalf of constituents
- In India 32722,19,60
- Outside India -
V Acceptances, Endorsements and Other Obligations 6512,09,48
VI Other Items for which the Bank is contingently liable 1715,59,00
TOTAL 285101,32,08
` in ‘000s
Year ended
31.03.2016
SCHEDULE - 13 INTEREST EARNED
I Interest / Discount on Advances/ Bills 9244,55,57
II Income on Investments 1780,63,24
III Interest on Balances with RBI and Other Inter-Bank Funds 408,50,31
IV Others 146,96,77
TOTAL 11580,65,89
233
` in ‘000s
Year ended
31.03.2016
SCHEDULE - 14 OTHER INCOME

I Commission, Exchange and Brokerage 2231,47,71
II Profit / (Loss) on Sale of Investments (Net) 145,25,65
III Profit / (Loss) on Sale of Land, Buildings and Other Assets (Net) 6,98,95
IV Profit on exchange transactions / Derivatives (Net) 836,99,93
V Income earned by way of dividend from companies in India 3,39,65
VI Miscellaneous Income 72,82,73
TOTAL 3296,94,62
SCHEDULE - 15 INTEREST EXPENDED

I Interest on Deposits 5708,78,69
II Interest on Reserve Bank of India / Inter-Bank Borrowings 272,40,52
III Others (including interest on Subordinated Debts and Upper Tier-2 bonds) 1082,89,44
TOTAL 7064,08,65
SCHEDULE - 16 OPERATING EXPENSES

I Payments to and Provisions for Employees 1236,08,80
II Rent, Taxes and Lighting (includes operating lease rentals) 271,32,58
III Printing and Stationery 49,45,74
IV Advertisement and Publicity 21,01,43
V Depreciation on Bank's Property 156,51,93
VI Directors' Fees, Allowances and Expenses 1,30,95
VII Auditors' Fees and Expenses 1,42,24
VIII Law Charges 44,76,42
IX Postage, Telegrams, Telephones, etc. 111,00,91
X Repairs and Maintenance 201,67,45
XI Insurance 103,35,29
XII Service Provider Fees 334,39,88
XIII Other Expenditure 1139,76,47
TOTAL 3672,10,09
234
Schedule 17
Significant accounting policies
1. General
IndusInd Bank Limited (‘‘the Bank’’) was incorporated in 1994 under the Companies Act, 1956, and is licensed by
the Reserve Bank of India (RBI) to operate as a commercial bank under the Banking Regulation Act, 1949. The
Bank is publicly held and provides a wide range of banking products and financial services to corporate and retail
clients besides undertaking treasury operations. The Bank operates in India and does not have a branch in any
foreign country.
Principles of Consolidation
The consolidated financial statements comprise the financial statements of IndusInd Bank Limited (‘‘the Bank’’)
and its Associate, which together constitute ‘‘the Group’’.
The Bank consolidates investments in associates in accordance with AS-23, “Accounting for Investments in
Associates in “consolidated financial statement” notified under Section 133 of the Companies Act, 2013, read
together with paragraph 7 of the Companies (Accounts) Rules, 2014, using the equity method of accounting.
The Difference between the Cost of investment in the associate and the share of net asset,at the time of acquisition
of share in the associate, is identified in the consolidated financial statement as goodwill or capital reserve, as the
case may be.
Basis of preparation
The accompanying financial statements have been prepared under the historical cost convention except where
otherwise stated, and in accordance with statutory requirements prescribed under the Banking Regulation Act,
1949, circulars and guidelines issued by RBI from time to time (RBI guidelines), accounting standards referred to
in Section 133 of the Companies Act, 2013, (the Act) and practices prevailing within the banking industry in India.
The preparation of the financial statements in conformity with generally accepted accounting principles in India
requires management to make estimates and assumptions that affect the reported amounts of assets, liabilities,
revenues, expenses and disclosure of contingent liabilities on the date of the financial statements. Management
believes that the estimates and assumptions used in the preparation of the financial statements are prudent and
reasonable. Any revision to accounting estimates is recognised prospectively in current and future periods.
The consolidated financial statements present the accounts of IndusInd Bank Limited with its Associate IndusInd
Marketing & Financial Services Private Limited.
In accordance with Para 30 on Transitional provision of Accounting Standard 21 on preparation of consolidated
financial statements on the first occasion, comparative figures for the previous year are not required to be
presented. Consequently, the Bank has prepared the consolidated financial statements of the Bank and its
Associate for the year ending March 2016, and no comparative figures for the previous year are presented in the
current year financial statements as the consolidated financials are presented to the Board for the first time.
In accordance with para 26 of AS - 23, on the first occasion when investment in an associate is accounted for in
consolidated financial statements, the carrying amount of investment in the associate should be brought to the
amount that would have resulted had the equity method of accounting been followed since the acquisition of the
associate and the corresponding adjustment should be made in the retained earnings in the consolidated financial
statements. Consequently, the Bank has brought the carrying amount of investment in an associate considering
the equity method of accounting been followed since the acquisition of the associate and the corresponding
adjustment is made in the retained earnings in the consolidated financial statements.
As per AS-23, the Consolidated Financial Statements incorporate the audited result of the following associate:
% Shareholding of Group
Name of the Associate Country of Origin
(31st March 2016)
IndusInd Marketing & Financial Services Private Limited India 30%
235
2. Transactions involving Foreign Exchange
2.1 Monetary assets and liabilities denominated in foreign currency are translated at the Balance Sheet date at
the closing rates of exchange notified by the Foreign Exchange Dealers’ Association of India (FEDAI) and the
resulting gains or losses are recognised in the Profit and Loss account.
2.2 Non-monetary items which are carried in terms of historical cost denominated in a foreign currency are
reported using the exchange rate at the date of the transaction; and non-monetary items which are carried at
fair value or other similar valuation denominated in a foreign currency are reported using the exchange rates
that existed when the values were determined.
2.3 All foreign exchange contracts outstanding at the Balance Sheet date are re-valued on present value basis
2.4 Swap Cost arising on account of foreign currency swap contracts to convert foreign currency funded
liabilities and assets into rupee liabilities and assets is amortised to the Profit and Loss account under the
head ‘Interest – Others’ over the underlying swap period.
2.5 Income and expenditure denominated in a foreign currency is translated at the rates of exchange prevailing
on the date of the transaction.
2.6 Contingent liabilities at the Balance Sheet date on account of outstanding forward foreign exchange contracts,
guarantees, acceptances, endorsements and other obligations denominated in a foreign currency are stated
at the closing rates of exchange notified by the FEDAI.
3. Investments
Significant accounting policies in accordance with RBI guidelines are as follows:
3.1 Categorisation of Investments:
The Bank classifies its investment at the time of purchase into one of the following three categories:
(i) Held to Maturity (HTM) – Securities acquired with the intention to hold till maturity.
(ii) Held for Trading (HFT) – Securities acquired with the intention to trade.
(iii) Available for Sale (AFS) – Securities which do not fall within the above two categories.
Subsequent shifting amongst the categories is done in accordance with RBI guidelines.
3.2 Classification of Investments:
For the purpose of disclosure in the Balance Sheet, investments are classified under six groups viz., (i)
Government Securities, (ii) Other Approved Securities, (iii) Shares, (iv) Debentures and Bonds, (v) Investments
in Subsidiaries and Joint Ventures, and (vi) Other Investments.
3.3 Acquisition cost:
(i) Broken period interest on debt instruments is treated as a revenue item.
(ii) Brokerage, commission, etc., pertaining to investments, paid at the time of acquisition is charged to the
Profit and Loss account.
(iii) Cost of investments is computed based on the weighted average cost method.
3.4 Valuation of Investments:
(i) Held to Maturity – Each security in this category is carried at its acquisition cost. Any premium on
acquisition of the security is amortised over the balance period to maturity. The amortized amount is
classified under Interest earned – Income on investments (Item II of Schedule 13). The book value of the
236
security is reduced to the extent of amount amortized during the relevant accounting period. Diminution,
other than temporary, is determined and provided for each investment individually.
(ii) Held for Trading – Securities are valued scrip-wise and depreciation / appreciation is aggregated for
each classification. Net appreciation in each classification is ignored, while net depreciation is provided
for.
(iii) Available for Sale – Securities are valued scrip-wise and depreciation / appreciation is aggregated for
each classification. Net appreciation in each classification, is ignored, while net depreciation is provided
for.
(iv) Market value of government securities (excluding treasury bills) is determined on the basis of the prices
/ YTM declared by Primary Dealers Association of India (PDAI) jointly with Fixed Income Money Market
and Derivatives Association (FIMMDA).
(v) Treasury bills are valued at carrying cost, which includes discount amortised over the period to maturity.
(vi) Fair value of other debt securities is determined based on the yield curve and spreads provided by
FIMMDA.
(vii) Quoted equity shares are valued at lower of cost and the closing price on a recognised stock exchange.
Unquoted equity shares are valued at their break-up value or at ` 1/- per company where the latest
Balance Sheet is not available.
(viii) Units of the schemes of mutual funds are valued at the lower of cost and Net Asset Value (NAV) provided
by the respective schemes of mutual funds.
(ix) Investments in equity shares held as long-term investments by erstwhile IndusInd Enterprises &
Finance Limited and Ashok Leyland Finance Limited (since merged with the Bank) are valued at cost
and classified as part of HTM category. Provision towards diminution in the value of such long-term
investments is made only if the diminution in value is not temporary in the opinion of management.
(x) Security Receipts (SR) are valued at the lower of redemption value and NAV obtained from the
Securitisation Company (SC) / Reconstruction Company (RC).
(xi) Trade date method of accounting is followed for purchase and sale of investments, except for Government
of India and State Government securities where settlement date method of accounting is followed in
accordance with RBI guidelines.
(xii) Provision for non-performing investments is made in conformity with RBI guidelines.
(xiii) Repurchase (Repo) / Reverse Repurchase (Reverse Repo) transactions (except transactions under
Liquidity Adjustment Facility (LAF) with RBI) are accounted for as Borrowing / Lending respectively.
On completion of the second leg of the Repo / Reverse Repo transaction, the difference between the
consideration amounts is reckoned as Interest Expenditure / Income. Amounts outstanding in Repo /
Reverse Repo account as at the Balance Sheet date is shown as part of Borrowings / Money at Call
and at Short Notice respectively, and the accrued expenditure / income till the Balance Sheet date is
recognised in the Profit and Loss account.
In respect of repo transactions under LAF with RBI, monies borrowed from RBI are credited to investment
account and reversed on maturity of the transaction. Costs thereon are accounted for as interest expense.
In respect of reverse repo transactions under LAF, monies lent to RBI are debited to investment account
and reversed on maturity of the transaction. Revenues thereon are accounted for as interest income.
(xiv) In respect of the short sale transactions in Central Government dated securities, the short position is
covered by outright purchase of an equivalent amount of the same security within a maximum period of
three months including the day of trade. The short position is reflected as the amount received on sale in
a separate account and is classified under ‘Other Liabilities’. The short position is marked to market and
237
loss, if any, is charged to the Profit and Loss account, while gain, if any, is not recognized. Profit / loss on
settlement of the short position is recognized in the Profit and Loss account.
(xv) Profit in respect of investments sold from HTM category is included in the Profit on Sale of Investments
and an equivalent amount (net of taxes, if any, and net of transfer to Statutory Reserves as applicable to
such profits) is appropriated from the Profit and Loss Appropriation account to Capital Reserve account.
(xvi) In the event, provisions created on account of depreciation in the AFS or HFT categories are found to be
in excess of the required amount in any year, the excess is credited to the Profit and Loss account and
an equivalent amount (net of taxes, if any, and net of transfer to Statutory Reserves as applicable to such
excess provisions) is appropriated to an Investment Reserve Account (IRA).
The balance in IRA account is used to meet provision on account of depreciation in AFS and HFT
categories by transferring an equivalent amount to the Profit and Loss Appropriation account as and
when required.
3.5 Investments in unquoted units of Venture Capital Funds (VCF) are categorised under HTM category for initial
period of three years and valued at cost as per RBI guidelines. Units of VCF held under AFS category where
current quotations are not available are marked to market based on the Net Asset Value (NAV) shown by VCF
as per the latest audited financials of the fund. In case the audited financials are not available for a period
beyond 18 months, the investments are valued at ` 1/- per VCF.
4. Derivatives
Derivative contracts are designated as hedging or trading and accounted for as follows:
4.1 The hedging contracts comprise of Forward Rate Agreements, Interest Rate Swaps, and Currency Swaps
undertaken to hedge interest rate and currency risk on certain assets and liabilities. The net interest
receivable / payable is accounted on an accrual basis over the life of the swaps. However, where the hedge
is designated with an asset or liability that is carried at market value or lower of cost and market value, then
the hedging instrument is also marked to market with the resulting gain or loss recorded as an adjustment to
the market value of designated assets or liabilities.
4.2 The trading contracts comprise of trading in Interest Rate Swaps, Interest Rate Futures and Currency Futures.
The gain / loss arising on unwinding or termination of the contracts, is accounted for in the Profit and Loss
account. Trading contracts outstanding as at the Balance Sheet date are re-valued at their fair value and
resulting gains / losses are recognised in the Profit and Loss account.
4.3 Gains or losses on the termination of hedge swaps is deferred and recognised over the shorter of the
remaining life of the hedge swap or the remaining life of the underlying asset / liability.
4.4 Premium paid and received on currency options is accounted when due in the Profit and Loss Account.
4.5 Fair value of derivative is determined with reference to bid/ asks quoted market price or by using valuation
models. Where the fair value is calculated using valuation models, the methodology is to calculate the expected
cash flows under the terms of each specific contract and then discount these values back to the present
value. The valuation takes into consideration all relevant market factors (eg. prices, interest rate, currency
exchange rates, volatility, liquidity, etc). Most market parameters are either directly observable or implied
from instrument prices. The model may perform numerical procedures in the pricing such as interpolation
when input values do not directly correspond to the most actively traded market trade parameters.
4.6 Provisioning of overdue customer receivable on derivative contracts is made as per RBI guidelines.
238
5. Advances
5.1 Advances are classified as per RBI guidelines into standard, sub-standard, doubtful and loss assets after
considering subsequent recoveries to date.
5.2 Specific provisions for non-performing advances and floating provisions are made in conformity with RBI
guidelines. In addition, the Bank considers accelerated provisioning based on past experience, evaluation of
securities and other related factors.
5.3 A general provision on standard assets is made in accordance with RBI guidelines. Provision made against
standard assets is included in ‘Other Liabilities and Provisions’.
5.4 Advances are disclosed in the Balance Sheet, net of provisions and interest suspended for non-performing
advances, and floating provisions.
5.5 Advances exclude derecognised securitised advances, inter-bank participation certificates issued and bills
rediscounted.
5.6 Amounts recovered during the year against bad debts written off in earlier years are recognised in the Profit
and Loss account.
5.7 Provision no longer considered necessary in the context of the current status of the borrower as a performing
asset, are written back to the Profit and Loss account to the extent such provisions were charged to the Profit
and Loss account.
5.8 For restructured / rescheduled assets, provision is made in accordance with the guidelines issued by RBI,
which requires the diminution in the fair value of the assets to be provided at the time of restructuring.
The restructured accounts are classified in accordance with RBI guidelines, including special dispensation
wherever allowed.
6. Securitisation transactions and direct assignments
6.1 The Bank transfers its loan receivables both through Direct Assignment route as well as transfer to Special
Purpose Vehicles (SPV).
6.2 The securitization transactions are without recourse to the Bank. The transferred loans and such securitized
receivables are de-recognized as and when these are sold (true sale criteria being fully met) and the
consideration has been received by the Bank. Gains / losses are recognized only if the Bank surrenders the
rights to the benefits specified in the loan contracts.
6.3 In terms of RBI guidelines, profit / premium arising on account of sale of standard assets, being the difference
between the sale consideration and book value, is amortized over the life of the securities issued by the
Special Purpose Vehicles (SPV). Any loss arising on account of the sale is recognized in the Profit and Loss
account in the period in which the sale occurs.
6.4 In case of sale of non-performing assets through securitization route to SC / RC by way of assignment of
debt against issuance of SRs, the recognition of sale and accounting of profit and loss thereon is done in
accordance with applicable RBI guidelines. Generally, the sale is recognized at the lower of redemption value
of SR and the Net Book Value (NBV) of the financial asset sold, and the surplus is recognized in the Profit and
Loss Account; shortfall if any, is charged to the Profit and Loss account subject to regulatory forbearance, if
any, allowed from time to time.
Profit or loss realized on ultimate redemption of the SR is recognized in the Profit and Loss Account.
239
7. Property, Plant and Equipment
7.1 Fixed assets are stated by Group at cost (except in the case of premises which were re-valued based on
values determined by approved valuers) less accumulated depreciation and impairment, if any. Cost includes
incidental expenditure incurred on the assets before they are ready for intended use.
7.2 The appreciation on account of revaluation is credited to Revaluation Reserve. Depreciation relating to
revaluation is adjusted against the Revaluation Reserve.
7.3 Depreciation is provided by Group over the useful life of the assets, pro rata for the period of use, on a
straight-line method. The useful life estimates prescribed in Part C of Schedule II to the Companies Act, 2013,
are generally adhered to, except in respect of asset classes where, based on technical evaluation, a different
estimate of useful life is considered suitable. The useful life of an asset class is periodically assessed taking
into account various criteria such as changes in technology, changes in business environment, utility and
efficacy of an asset class to meet with intended user needs, etc. Whenever there is a revision in the estimated
useful life of an asset, the unamortised depreciable amount is charged over the revised remaining useful life
of the said asset.
7.4 The carrying amount of fixed assets is reviewed at the Balance Sheet date to determine if there are any
indications of impairment based on internal / external factors. In case of impaired assets, the impairment
loss i.e. the amount by which the carrying amount of the asset exceeds its recoverable value is charged to
the Profit and Loss account to the extent the carrying amount of assets exceeds its estimated recoverable
amount.
8. Revenue Recognition
8.1 Interest and discount income on performing assets is recognised on accrual basis. Interest and discount
income on non-performing assets is recognised on realisation.
8.2 Interest on Government securities, debentures and other fixed income securities is recognised on a period
proportion basis. Income on discounted instruments is recognised over the tenor of the instrument on a
constant Yield to Maturity method.
8.3 Dividend income is accounted on accrual basis when the right to receive dividend is established.
8.4 Commission (except for commission on Deferred Payment Guarantees which is recognised over the term
on a straight line basis), Exchange and Brokerage are recognised on a transaction date and net of directly
attributable expenses.
8.5 Fees are recognised on an accrual basis when binding obligation to recognise the fees has arisen as per
agreement, except in cases where the Bank is uncertain of realisation.
8.6 Income from distribution of third party products is recognised on the basis of business booked.
8.7 For Associate, Service Charges are accounted on accrual basis.
9. Operating Leases
9.1 Lease rental obligations in respect of assets taken on operating lease are charged to the Profit and Loss
account on a straight-line basis over the lease term.
9.2 Assets given under leases in respect of which all the risks and benefits of ownership are effectively retained
by the Bank are classified as operating leases. Lease rentals received under operating leases are recognized
in the Profit and Loss account as per the terms of the contracts.
240
10. Employee Benefits
10.1 The Gratuity scheme of the Group is a defined benefit scheme and the expense for the year is recognized
on the basis of actuarial valuation at the Balance Sheet date. The present value of the obligation under
such benefit plan is determined based on independent actuarial valuation using the Projected Unit Credit
Method which recognizes each period of service that gives rise to additional unit of employee benefit
entitlement and measures each unit separately to build up the final obligation. Payment obligations under
the Group Gratuity scheme are managed through purchase of appropriate policies from insurers.
10.2 Provident Fund contributions are made under trusts separately established for the purpose and the
scheme administered by Regional Provident Fund Commissioner (RPFC), as applicable. The rate at which
the annual interest is payable to the beneficiaries by the trusts is being administered by the government.
The Bank has an obligation to make good the shortfall, if any, between the return from the investments of
the trusts and the notified interest rates. Actuarial valuation of this Provident Fund Interest shortfall is done
as per the guidance note on Valuation of Interest Rate Guarantees on Exempt Provident Funds under AS
15 (Revised) issued by the Institute of Actuaries of India, and such shortfall, if any, is provided for.
10.3 Provision for compensated absences is made on the basis of actuarial valuation as at the Balance Sheet
date. The actuarial valuation is carried out using the Projected Unit Credit Method.
10.4 Intrinsic value method is applied to account for the compensation cost of ESOP granted to the employees
of the Bank. Intrinsic value is the amount by which the quoted market price of the underlying shares on the
grant date exceeds the exercise price of the options. Accordingly, such compensation cost is amortized
over the vesting period.
11. Segment Reporting
In accordance with the guidelines issued by RBI, the Bank has adopted Segment Reporting as under:
(a) Treasury includes all investment portfolios, Profit / Loss on sale of Investments, Profit / Loss on foreign
exchange transactions, equities, income from derivatives and money market operations. The expenses
of this segment consist of interest expenses on funds borrowed from external sources as well as internal
sources and depreciation / amortisation of premium on Held to Maturity category investments.
(b) Corporate / Wholesale Banking includes lending to and deposits from corporate customers and identified
earnings and expenses of the segment.
(c) Retail Banking includes lending to and deposits from retail customers and identified earnings and expenses
of the segment.
(d) Other Banking Operations includes all other operations not covered under Treasury, Corporate / Wholesale
Banking and Retail Banking.
Unallocated includes Capital and Reserves, Employee Stock Options (Grants) Outstanding and other unallocable
assets, liabilities, income and expenses.
12. Debit and Credit Card reward points liability
The liability towards Credit Card reward points is computed based on an actuarial valuation and the liability
towards Debit Card reward points is computed on the basis of management estimates considering past trends.
13. Bullion
13.1 The Bank imports bullion including precious metal bars on a consignment basis for selling to its customers.
The imports are on a back-to-back basis and are priced to the customer based on the prevailing price
quoted by the supplier and the local levies related to the consignment like customs duty etc. The profit
earned is included in commission income.
13.2 The Bank sells gold coins to its customers. The difference between the sale price to customers and
purchase price is reflected under commission income.
241
14. Income-tax
Tax expenses comprise of current and deferred taxes. Current tax is measured at the amount expected to be
paid to the tax authorities in accordance with the Income Tax Act, 1961. Deferred taxes reflect the impact of
current year timing differences between taxable income and accounting income for the year and reversal of
timing differences of earlier years. Deferred tax is measured based on the tax rates and the tax laws enacted
or substantively enacted at the Balance Sheet date. Deferred tax assets are recognized, in general, only to the
extent that there is reasonable certainty that sufficient future taxable income will be available against which such
deferred tax assets can be realized; where there are unabsorbed depreciation and / or carry forward of losses
under tax laws, deferred tax assets are recognized only if there is virtual certainty supported by convincing
evidence that such deferred tax asset can be realized against future taxable income. Unrecognized deferred tax
assets of earlier years are re-assessed and recognised to the extent that it has become reasonably certain that
future taxable income will be available against which such deferred tax assets can be realized.
15. Earnings per share
Earnings per share is calculated by dividing the Net Profit or Loss for the period attributable to equity shareholders
by the weighted average number of equity shares outstanding during the period. Diluted earnings per equity
share are computed using the weighted average number of equity shares and dilutive potential equity shares
outstanding as at end of the year.
16. Provisions, contingent liabilities and contingent assets
16.1 A provision is recognized when there is an obligation as a result of past event, and it is probable that an
outflow of resources will be required to settle the obligation, and in respect of which a reliable estimate can
be made. Provisions are not discounted to their present value and are determined based on best estimate
required to settle the obligation at the Balance Sheet date. These are reviewed at each Balance Sheet date
and adjusted to reflect the current best estimates.
16.2 A disclosure of contingent liability is made when there is:
(a) A possible obligation arising from a past event, the existence of which will be confirmed by
occurrence or non-occurrence of one or more uncertain future events not within the control of the
bank; or
(b) A present obligation arising from a past event which is not recognized as it is not probable that an
outflow of resources will be required to settle the obligation or a reliable estimate of the amount of
the obligation cannot be made.
16.3 When there is a possible obligation or a present obligation in respect of which the likelihood of outflow of
resources is remote, no provision or disclosure is made.
16.4 Contingent assets are not recognized or disclosed in the financial statements. However, contingent assets
are assessed continually and if it is virtually certain that an inflow of economic benefits will arise, the assets
and related income are recognized in the period in which the change occurs.
17. Cash and Cash equivalents
Cash and cash equivalents comprises of Cash in Hand and Balances with RBI and Balances with Banks and
Money at Call and Short Notice.
242
Schedule 18
Notes forming part of the consolidated financial statements
1. Capital:
1.1 Authorised Capital:
The Authorised Capital of the Bank was increased on June 8, 2015, to ` 600 crores consisting of 60,00,00,000
equity shares of ` 10/- each from ` 550 crores consisting of 55,00,00,000 equity shares of ` 10/- each based
on a special resolution passed by the members through postal ballot, and further on August 17, 2015, to
` 700 crores consisting of 70,00,00,000 equity shares of ` 10/- each based on a special resolution passed by
the members in the twenty first Annual General Meeting.
1.2 Capital Issue:
During the year ended March 31, 2016, through a Qualified Institutions Placement (QIP), 5,12,18,640 equity
shares of ` 10/- each were allotted at a price of ` 845.00 per share aggregating to ` 4,327.98 crores. Further,
the promoters of the Bank were allotted 87,81,360 equity shares of ` 10/- each at a price of ` 857.20 per
share, aggregating to ` 752.74 crores through a Preferential Allotment. Besides, 55,36,126 equity shares
aggregating to ` 95.14 crores were allotted on various dates to the employees who exercised their stock
options.
2. Fixed Asset:
2.1 Cost of premises includes ` 4.09 crores in respect of properties for which execution of documents and reg-
istration formalities are in progress. Of these properties, the Bank has not obtained full possession of one
property having written down value of ` 1.59 crores and has filed a suit for the same.
2.2 Movement in depreciation of Fixed Assets:
(` in crores)
Depreciation 2015-16
Premises
At the beginning of the year 58.99
Transferred from Revaluation Reserve 6.20
Charge for the year 2.07
Deduction during the year 0.54
Depreciation to date 66.72
Other Fixed Assets
At the beginning of the year 649.79
Charge for the year 154.45
Deduction during the year 33.15
Depreciation to date 771.09
3. Employee Benefit (AS 15):
3.1. Employee Stock Option Scheme (ESOS):
3.1.1 The shareholders of the Bank approved Employee Stock Option Scheme (ESOS) on September 18, 2007.
ESOS enables the Board and / or the HR and Remuneration Committee to grant such number of stock
options of the Bank not exceeding 7% of the aggregate number of issued and paid up equity shares of the
Bank, in line with the guidelines of the Securities & Exchange Board of India (SEBI). The options vest within a
maximum period of five years from the date of grant of option. The exercise price for each grant is decided by
the Compensation Committee, which is normally based on the latest available closing price. Upon vesting,
the options have to be exercised within a maximum period of five years. The stock options are equity settled
where the employees will receive one equity share per stock option.
243
Pursuant to the ESOS 2007 scheme, the HR and Remuneration Committee of the Bank has granted
3,75,70,300 options as set out below:
Sr. No Date of grant No of options Range of exercise price (`)

1. 18-Jul-08 1,21,65,000 48.00 - 50.60
2. 17-Dec-08 34,56,000 38.95
3. 05-May-09 8,15,500 44.00
4. 31-Aug-09 3,18,500 100.05
5. 28-Jan-10 7,47,000 48.00 - 140.15
6. 28-Jun-10 13,57,450 196.50
7. 14-Sep-10 73,500 236.20
8. 26-Oct-10 1,43,500 274.80
9. 17-Jan-11 25,00,000 228.70
10. 07-Feb-11 20,49,000 95.45 - 220.45
11. 24-Jun-11 21,54,750 253.60
12. 16-Aug-11 89,500 254.90
13. 30-Sep-11 2,61,000 262.25
14. 21-Dec-11 9,20,000 231.95
15. 29-Feb-12 1,95,000 304.05
16. 19-Apr-12 1,40,500 345.60
17. 25-May-12 1,34,500 304.55
18. 10-Jul-12 2,67,000 343.25
19. 29-Aug-12 1,14,000 319.05
20. 10-Oct-12 23,500 365.75
21. 09-Jan-13 30,000 433.75
22. 18-Apr-13 12,500 419.60
23. 20-Jun-13 1,75,000 478.45
24. 18-Jul-13 18,35,000 453.90
25. 23-Sep-13 75,000 411.50
26. 29-Oct-13 22,000 412.25
27. 29-Jan-14 7,67,500 300.00 - 389.85
28. 25-Mar-14 1,76,500 490.30
29. 15-May-14 65,500 537.05
30. 02-Jun-14 32,69,500 533.95
31. 09-Jul-14 33,000 551.10
32. 13-Oct-14 74,500 623.25
33. 17-Jan-15 47,500 831.85
34. 23-Feb-15 48,000 876.80
35. 30-Mar-15 11,000 880.75
36. 22-May-15 52,600 848.20
37. 24-Jul-15 16,30,000 949.80
38. 21-Sept-15 1,93,000 918.65
39. 04-Nov-15 93,500 911.85
40. 12-Jan-16 10,33,500 886.75 – 936.75
244
3.1.2 Recognition of expense:
The Bank follows the intrinsic value method to recognize employee costs relating to ESOS, in accordance
with the Guidance Note on “Accounting for Employee Share-based Payments” issued by the ICAI. Excess of
fair market price over the exercise price of an option at the grant date, is recognized as a deferred compen-
sation cost and amortized on a straight-line basis over the vesting period of such options. The compensation
so recognised in respect of which exercise of options is outstanding is shown as Employee Stock Options
Outstanding on the face of the Balance Sheet.
The fair market price is the latest available closing price on the stock exchange on which the shares of the
Bank are listed, prior to the date of the meeting of the Compensation Committee in which stock options are
granted. Since shares are listed on more than one stock exchange, the exchange where the Bank’s shares
have been traded highest on the said date is considered for this purpose.
3.1.3 Stock option activity under the scheme during the year:
No. of options Weighted average

exercise price (`)
Outstanding at the beginning of the year 1,55,54,797 280.21
Granted during the year 30,02,600 923.69
Forfeited / surrendered during the year 1,90,020 631.41
Exercised during the year 55,36,126 171.88
Expired during the year - -
Outstanding at the end of the year 1,28,31,251 472.32
Options exercisable at the end of the year 68,09,156 261.46
The weighted average price of options exercised during the year is ` 877.86.
Following table summarizes the information about stock options outstanding as at March 31, 2016:
Date of grant Exercise Price Number of shares Weighted average life

arising out of options of options (in years)
18-Jul-08 48.00 5,00,000 0.84
18-Jul-08 50.60 1,17,000 0.30
17-Dec-08 38.95 42,800 0.72
31-Aug-09 100.05 39,240 1.00
28-Jan-10 A 48.00 6,00,000 0.83
28-Jun-10 196.50 90,227 1.46
26-Oct-10 274.80 1,790 2.24
17-Jan-11 228.70 18,35,000 1.90
7-Feb-11 A 220.45 5,22,550 1.92
7-Feb-11 95.45 1,38,000 0.86
24-Jun-11 253.60 2,29,013 2.47
30-Sep-11 262.25 10,000 3.35
21-Dec-11 231.95 4,06,000 3.36
29-Feb-12 304.05 1,20,000 3.05
19-Apr-12 345.60 59,350 3.34
245
Date of grant Exercise Price Number of shares Weighted average life
arising out of options of options (in years)
25-May-12 304.55 30,460 3.23
10-Jul-12 343.25 1,73,005 3.61
29-Aug-12 319.05 2,250 4.17
10-Oct-12 365.75 5,000 3.54
09-Jan-13 433.75 15,000 3.79
20-Jun-13 478.45 1,01,000 4.72
18-Jul-13 453.90 8,94,456 4.62
23-Sep-13 411.50 35,710 5.06
29-Oct-13 412.25 20,680 4.66
29-Jan-14 389.85 33,930 5.31
29-Jan-14A 300.00 7,00,000 4.84
25-Mar-14 490.30 1,59,505 5.10
15-May-14 537.05 40,730 5.38
02-Jun-14 533.95 27,96,725 5.30
09-Jul-14 551.10 21,700 5.44
13-Oct-14 623.25 43,040 5.64
17-Jan-15 831.85 44,000 5.81
23-Feb-15 876.80 44,490 5.82
30-Mar-15 880.75 11,000 6.01
22-May-15 848.20 49,600 6.16
24-Jul-15 949.80 15,94,000 6.33
21-Sep-15 918.65 1,83,000 6.49
04-Nov-15 911.85 87,500 6.61
12-Jan-16 936.75 33,500 6.80
12-Jan-16 886.76 10,00,000 6.80
3.1.4 Fair value methodology:
The fair value of options granted during the year has been estimated on the date of grant using the Black-
Scholes option pricing model with the following assumptions:
2015-16
Average dividend yield 0.43%
Expected volatility 32.61-36.43%
Risk free interest rates 7.55-7.84%
Expected life of options (in years) 4.50 - 4.51
Expected volatility is a measure of the amount by which the equity share price is expected to fluctuate during
a period. The measure of volatility used in Black-Scholes option pricing model is the annualized standard
deviation of the continuously compounded rates of return on the share over a period of time. Expected
volatility has been computed by considering the historical data on daily volatility in the closing equity share
price on the National Stock Exchange of India Limited (NSE), over a prior period equivalent to the expected
life of the options, till the date of the grant.
246
The stock-based compensation cost calculated as per the intrinsic value method for the year is ` 2.22 crores.
Had the Bank adopted the Black-Scholes model based fair valuation, compensation cost for the year ended
March 31, 2016, would have increased by ` 67.88 crores and the proforma profit after tax would have been
lower by ` 44.39 crores. On a proforma basis, the basic and diluted earnings per share would have been
` 38.91 and ` 38.49 respectively.
The weighted average fair value of options granted during the year is ` 382.98.
3.2 Gratuity:
Gratuity is a defined benefits plan. The Bank has obtained qualifying insurance policies from two insurance
companies. The following table summarises the components of net expenses recognized in the Profit and
Loss account and funded status and amounts recognized in the Balance Sheet, on the basis of actuarial
valuation.
(` in crores)
March 31, 2016
Changes in the present value of the obligation
1. Opening balance of Present Value of Obligation 46.38
2. Interest Cost 3.42
3. Current Service Cost 10.75
4. Benefits Paid (6.48)
5. Actuarial loss / (gain) on Obligation 7.60
6. Closing balance of Present Value of Obligation 61.67
Reconciliation of opening and closing balance of the fair value of the Plan
Assets
1. Opening balance of Fair value of Plan Assets 49.58
2. Adjustment to Opening Balance 0.62
3. Expected Return on Plan assets 4.33
4. Contributions 18.09
5. Benefits Paid (6.48)
6. Actuarial loss Return on Plan Assets (0.80)
7. Closing balance of Fair Value of Plan Assets 65.34
Profit and Loss – Expenses
1. Current Service Cost 10.75
2. Interest Cost 3.42
3. Expected Return on Plan assets (4.33)
4. Net Actuarial loss recognised in the year 8.40
5. Expenses recognised in the Profit and Loss account 18.24
Funded status 100% insurance
managed funds
Actuarial Assumptions
1. Discount Rate 7.50%
2. Expected Rate of Return on Plan Assets 8.00%
3. Expected Rate of Salary Increase 5.00%
4. Employee Attrition Rate
- Past Service 0 to 5 years 30%
- Past Service above 5 years 0.50%
Estimates of future salary increases, considered in actuarial valuation, take account of inflation, seniority,
promotion and other relevant factors, such as supply and demand in the employment market.
247
Experience Adjustment:
Particulars March 31, 2016

Defined Benefit Obligations 61.67
Plan Assets 65.34
Surplus / (Deficit) 3.67
Experience Adjustments on Plan Liabilities (7.60)
Experience Adjustments on Plan Assets (0.80)
Contributions expected to be paid to the plan during the annual period beginning after the Balance Sheet
date is ` 22.00 crores.
3.3 Provident Fund:
The guidance note on implementing AS 15, Employee Benefits (revised 2005) states that benefits involving
employer established provident funds, which require interest shortfalls to be recompensed are to be consid-
ered as defined benefits plans.
The details of the fund and plan assets position as at March 31, 2016, are as follows:
(` in crores)
Assets / Liabilities March 31, 2016

Present value of Interest Rate guarantee on Provident Fund 1.25
Present value of Total Obligation 128.89
Fair value of Plan Assets 127.72
Net liability recognized in the Balance Sheet (1.17)
Assumptions
Normal Retirement age 60 years
Expected guaranteed interest on PF in future 8.80%
Discount rate 7.50%
Expected average remaining working lives of employees (years) 6.36-13.23
Benefit on normal retirement Accumulated

account balance
Benefit on early retirement / withdrawal / resignation Same as normal
retirement
benefit
Benefit on death in service Same as normal
retirement
benefit
4. Segment Reporting (AS 17):

The Bank operates in four business segments, viz. Treasury, Corporate / Wholesale Banking, Retail Banking and
Other Banking Operations. There are no significant residual operations carried by the Bank.
248
Business Segments:
(` in crores)
Business Segment Treasury Corporate/ Retail Other Total
Wholesale Banking Banking 31/03/2016
Banking Operation
Particulars
Revenue 2,962.81 4,687.03 8,175.22 38.70 15,863.76
Inter Segment Revenue (986.15)
Total Income 14,877.61
Result 557.42 1,161.85 2,566.52 12.15 4,297.94
Unallocated Expenses (156.52)
Operating Profit 4,141.42
Provisions and Contingencies (672.16)
(other than tax)
Tax Expenses (1,182.81)
Extraordinary profit / loss -
Net Profit before minority interest 2,286.45
and earnings from Associate
Other Information:
Add: Share of Profit in Associate 0.28
Net Profit 2,286.73
Segment Assets 37,125.38 32,562.01 63,110.40 - 1,32,797.79
Unallocated Assets 7,260.41
Total Assets 1,40,058.20
Segment Liabilities 22,376.74 44,550.15 49,665.41 - 1,16,592.30
Unallocated Liabilities 23,465.90
Total Liabilities 1,40,058.20
Fixed Assets, tax paid in advance / tax deducted at source (net of provisions), stationery and stamps, non-banking
assets acquired in satisfaction of claims, and others which cannot be allocated to any segments, have been
classified as unallocated assets; Depreciation on Fixed Assets has been classified as unallocated expenses. The
unallocated liabilities include share capital, employee stock option outstanding, reserves and surplus, proposed
dividend and others.
Geographic Segments:
The business operations of the Bank are largely concentrated in India. Activities outside India are restricted to
resource mobilization in the international markets. Since the Bank does not have material earnings emanating
from foreign operations, the Bank is considered to operate only in domestic segment.
5. Related Party Transaction (AS 18):
The following is the information on transactions with related parties:
Key Management Personnel
Mr. Romesh Sobti, Managing Director
Associates
IndusInd Marketing & Financial Services Private Limited
249
Subsidiaries
ALF Insurance Services Private Limited (till February 24, 2016; the company is under liquidation and the liquidator
has repaid the entire share capital on February 24, 2016; the final formalities for striking off the name from the
Companies Register are in progress)
In accordance with RBI guidelines, details pertaining to the related party transactions have not been provided as
there is only one related party in each of the above categories.
6. Operating Leases (AS 19):
The Bank has taken a number of premises on operating lease for branches, offices, ATMs and residential premises
for staff. The Bank has not given any assets on operating lease. The details of maturity profile of future operating
lease payments are given below:
(` in crores)
March 31, 2016

Future lease rentals payable as at the end of the year:
- Not later than one year 216.49
- Later than one year but not later than five years 711.44
- Later than five years 293.85
Total of minimum lease payments recognized in the Profit and Loss Account for the year 206.49
Total of future minimum sub-lease payments expected to be received under non-cancellable -
sub-lease
Sub-lease payments recognized in the Profit and Loss account for the year -
The Bank has not sub-leased any of the properties taken on lease. There are no provisions relating to contingent
rent.
The terms of renewal and escalation clauses are those normally prevalent in similar agreements. There are no
undue restrictions or onerous clauses in the agreements.
7. Earnings per share (AS 20):
Details pertaining to earnings per share as per AS-20 are as under:
Year ended
March 31, 2016
Net Profit after tax (` in crores) 2,286.45
Basic weighted average number of equity shares 57,62,52,656
Diluted weighted average number of equity shares 58,24,34,853
Nominal value of Equity Shares (`) 10
Basic Earnings per Share (`) 39.68
Diluted Earnings per Share (`) 39.26
250
8. Deferred Tax (AS 22):
The major components of deferred tax assets / liabilities are as under:
(` in crores)
March 31, 2016
Deferred Tax
Timing difference on account of Assets Liabilities
Difference between book depreciation and depreciation under the Income - 26.47
Tax Act, 1961
Difference between Provisions for doubtful debts and advances and 307.32 -
amount allowable under Section 36(1)(viia) of the Income Tax Act, 1961
Difference between book income and income offered under the Income - 144.49
Tax Act, 1961
Others 26.57 -
Sub-total 333.89 170.96
Net closing balance carried to the Balance Sheet 162.93
(included in Sch. 11 – Others)
9. Contingent Liabilities:
The Bank’s pending litigations comprise of claims against the Bank by the clients and proceedings pending with
Income Tax authorities. The Bank has reviewed all its pending litigations and proceedings and has adequately
provided for where provisions are required and disclosed as contingent liabilities where applicable, in its financial
statements. Claims against the Bank not acknowledged as debts comprise of tax demands of ` 159.24 crores
(Previous Year ` 161.32 crores) in respect of which the Bank is in appeal and the legal cases sub judice of
`489.35 crores (Previous Year ` 386.42 crores). The Bank carries a provision of ` 4.48 crores (Previous Year ` 3.97
crores) against cases sub judice. The amount of contingent liabilities is based on management’s estimate, and
no significant liability is expected to arise out of the same.
10. The Ministry of Corporate Affairs (MCA) has notified the Companies (Accounting Standards) Amendment Rules,
2016 vide its notification dated 30 March, 2016. The said notification read with Rule 3(2) of the Companies
(Accounting Standards) Rules, 2006 is applicable to accounting period commencing on or after the date of
notification i.e. April 01, 2016.
11. The Bank has a process whereby periodically all long term contracts (including derivative contracts) are assessed
for material foreseeable losses. At the year end, the Bank has reviewed and ensured that adequate provision
as required under any law / accounting standards for material foreseeable losses on such long term contracts
(including derivative contracts) has been made in the books of account.
12. Computer software:
The movement in fixed assets capitalized as computer software is given below:
(` in crores)
Particulars 31 March 2016
At cost at the beginning of the year 209.36
Addition during the year 71.12
Deduction during the year -
Accumulated Depreciation as at 31 March 160.31
Closing Balance as at 31 March 120.17
Depreciation charge for the year 32.35
251
13. There is no delay in transferring amounts to Investor Education and Protection Fund by the Bank.
14. Corporate Social Responsibility (CSR):
The Bank has spent an amount of ` 27.32 crores towards CSR initiatives through various projects in the areas
of Rural Development and Inclusiveness, Environment Sustainability, Preventive Healthcare and certain areas of
special interest such as Environmental, Education, etc. Of the total CSR spends, an amount of ` 22.30 crores was
incurred towards capital expenditure.
15. Marked to market gain or loss on forex and derivative transactions is presented on gross basis. Had this been
presented on net basis as hitherto, the amount of each of Other Liabilities and Provisions, Other Assets and the
total of Balance Sheet would have been lower by ` 1,789.66 crores on March 31, 2016.
The above change in presentation has no impact on the profit of the Bank for the year ended March 31, 2016.
16. During the year, the Bank acquired the Diamond and Jewellery financing business of Royal Bank of Scotland N.V.,
which inter alia included an advance portfolio of ` 4,130.40 crores, as a going concern on a slump sale basis. The
business take-over was completed on July 24, 2015, and all the assets and mutually agreed liabilities of the said
Diamond and Jewellery financing business became part of the Bank’s Balance Sheet on that date. The price paid
towards acquisition of the business was allocated to the assets and liabilities on the basis of their fair value on the
acquisition date and accounted for accordingly. The incomes generated by the business on and from that date,
and the assets and liabilities pertaining to the business have been duly considered in the Profit and Loss Account
for the year ended and the Balance Sheet as at March 31, 2016, respectively.
252
US DOLLAR DENOMINATED
Standalone Balance Sheet as at March 31, 2016
(Million of US$)
As at As at
1 USD = ` 66.255 31.03.2016 31.03.2015
Capital 89.80 79.91
Employee Stock Option Outstanding 2.08 2.12
Reserves and Surplus 2,579.01 1,524.57
Deposits 14,036.73 11,189.25
Borrowings 3,344.03 3,111.92
Other Liabilities & Provisions 1,087.44 964.53
TOTAL 21,139.09 16,872.30
ASSETS
Cash and Balances with Reserve Bank of India 682.37 609.03
Balances with Banks & Money at Call and Short Notice 843.84 1,017.89
Investments 4,711.24 3,453.07
Advances 13,345.31 10,382.34
Fixed Assets 189.47 174.72
Other Assets 1,366.86 1,235.25
TOTAL 21,139.09 16,872.30
Contingent Liabilities 43,030.91 31,540.73
Bills for Collection 2,076.95 1,015.61
Standalone Profit and Loss Account for the year ended March 31, 2016
(Million of US$)
1 USD = ` 66.255 31.03.2016 31.03.2015
I. INCOME
Interest earned 1,747.89 1,462.83
Other Income 497.61 384.58
TOTAL 2,245.50 1,847.41
II. EXPENDITURE
Interest expended 1,066.20 946.60
Operating expenses 554.24 433.18
Provisions & contingencies 279.97 196.89
TOTAL 1,900.41 1,576.67
III. PROFIT 345.09 270.74

Profit brought forward 553.03 395.95
AMOUNT AVAILABLE FOR APPROPRIATION 898.12 666.69
IV. APPROPRIATIONS
Transfer to
(a) Statutory Reserves 86.27 67.68
(b) Capital Reserves 1.99 1.86
(c) Investment Reserve Account - 5.61
(d) Dividend on equity 44.17 32.00
(e) Corporate Dividend Tax 8.99 6.51
141.42 113.66
Balance carried over to Balance Sheet 756.70 553.03
TOTAL 898.12 666.69
253
Branch Network Nellore Barpeta Road Paltan Bazar Guwahati
Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Andhra Pradesh Tel. No.:- 0861-6522208 Tel. No.:- 03666-261009 Tel. No.:- 0361-2732238/234/
Amalapuram 231/ 230
One Town Area, Vijaywada Beltola, Guwahati
Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Shilphukuri
Tel. No.:- 08856-233405/406/407 Tel. No.:- 0361-2220212/3/6/8
Tel. No.:- 0866- Email ID:- [email protected]
Anantapur 2568416/17/18/19 Tel. No.:- 0361 -2660017/26/
Dibrugarh
Email ID:- [email protected] 46/ 30
Ongole (SP) Email ID:- [email protected]
Tel. No.:- 08554-244955/
Tel. No.:- 08592-281955/280955 Tel. No.:- 0373-2323756/
249373/651286, 244955 Sibsagar
2323759, 2323757
Rajamundhry Email ID:- [email protected]
Chinamiram Tel. No.:- 03772-223223
Email ID:- [email protected] Duliajan
Email ID:- [email protected]
Tel. No.:- 0883-2420501, Email ID:- [email protected]
Tel. No.:- 08816-221608 Silchar
2420431 Tel. No.:- 0374-2803225/26/27
Chittoor Email ID:- [email protected]
Ramachandrapuram Fancy Bazar Guwahati Tel. No.:- 03842 -226466/
Email ID:- [email protected] 226477/226759, 225328
Tel. No.:- 08572-221166 / Email ID:- [email protected]
230044, 222220 Tel. No.: -0361-2733302/
Tel. No.:- 08857-244402/03, Tezpur
28/52/32
244404 Email ID:- [email protected]
Dwarkanagar, Visakhapatnam
Email ID:- [email protected] Ganeshguri, Guwahati Tel. No.:- 03712-230922/ 924/
Sarpavaram
Tel. No.:- 0891-3987100 Email ID:- [email protected] 926, 223417
Tel. No.:- 0361
Gajuwaka Tel. No.:- 0884-2347033/44, -2232538/531/516/546 Tinsukia
Email ID:- [email protected] 2347055
Tel. No.:- 0891-2514125 / 33/ Golaghat (SP)
Seethammadhara Tel. No.:- 0374-2340122,
2758223/ 2512720/ 2512724. Tel. No.:- 03774-243459
,2514124 Tel. No.:- 0891-2707326/29, Guwahati
Email ID:- [email protected] Zoo Road, Guwahati
Gudiwada 2707349
Tel. No.:- 0361-2452864/65/ Email ID:- [email protected]
Tanuku 2463503, 2452867 Tel. No.:- 0361-
Tel. No.:- 08674-249033/
Email ID:- [email protected] 2200094/012/0361/ 095 / 092
249044, 249055 Hailakandi
Tel. No.:- 08819-243812/13/14
Guntur (Gudur) Email ID:- [email protected] Bihar
Email ID:- [email protected] Tirupathi (SP) Tel. No.:- 03844-223475/76/77,
Tel. No.:- 0877-2255559 223474 Andar
Tel. No.:- 0863-2331001/2,
2330960 Vijayawada Jogighopa Tel. No.:- 06154-284059
Kadapa (Cuddapah) Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0866-2492633/44, Tel. No.:- 03664-210021 Anishabad, Patna
Tel. No.:- 08562-221915/221916, 2492626 Email ID:- [email protected]
Jorhat Tel. No.:- 0612-2250231/ 32 /
274552
Visakhapatnam Email ID:- [email protected] 34/ 35
Kadapa (Cuddapah) (SP) Email ID:- [email protected] Tel. No.:- 0376-2301408,
Tel. No.:- 08562-244060 Tel. No.:- 0891-2702202/198, 2301424 Ashiana Nagar, Patna
Kothapet Maligaon
Tel. No.:- 0612-
Arunachal Pradesh 3223040/3223041/3223042,
Tel. No.:- 0863-2225142 Tel. No.:- 0361-2673001/ 002/
2580080
Itanagar 003/ 004
Kothavalasa Email ID:- [email protected]
Email ID:- [email protected] Margherita (SP) Begusarai (SP)
Tel. No.:- 08966-263153/ Tel. No.:- 03751-272093 Tel. No.:- 06243-245057
Assam
154/157, 263158 Bhagalpur
North Lakhimpur
Ambari, Guwahati Email ID:- [email protected]
Kurnool Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 06412-301024/
Tel. No.:- 7578003301/ 2/3 /4 301054/301074, 301085
Tel. No.:- 08518-223425/248327 24421214, 24421212
Nakapalle Athgaon, Guwahati Bhagwanpur
Numaligarh
Tel. No.:- 08931-227856/ Tel. No.:- 0361-2735322/ Tel. No.:- 0622-4245398/
Tel. No.:- 03776-265566/
227845, 227860 2735349/ 2735329, 2735319
265567, 265565 4245399 / 4245400
254
Bihta Mani Majra Chandigarh Biladi Sirsa(SP)
Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 07762-234001
Tel. No.:- 06115-252931/ 932/ Tel. No.:- 0172-4604733 Tel. No.:- 0851-8883215
933/ 934 Raipur
Sec - 22, Chandigarh Bilaspur
Boring Road, Patna Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0771-403 3401/02/03,
Email ID:- [email protected] Tel. No.:- 0172-4008657 Tel. No.:- 0775-2429591
403 3404
Tel. No.:- 0612-2570236/40/41,
Bilaspur (SP)
2570235 Sector - 20D, Chandigarh Rajnandgaon (SP)
Tel. No.:- 07752-237933/237955
Email ID:- [email protected] Tel. No.:- 07744-227522
Dehri (SP) Tel. No.:- 0172-2546021 Dhamtari (SP)
Tel. No.:- 06184-250009 Tel. No.:- 07722-237315 Saraipali (SP)
Sector 16 Chandigarh Tel. No.:- 07725-227654
Kaem Nagar Dhanora
Tel. No.:- 0172-5174001 Shankar Nagar
Tel. No.:- 06182-277001/277002 Tel. No.:- -8518883218 Email ID:- [email protected]
Sector 27 Chandigarh
Kankerbagh, Patna G E Road, Raipur Tel. No.:- 0771 -4033403/402
Tel. No.:- 0172-4946400 Email ID:- [email protected]
Tel. No.:- 0612-2356651/2/3/4 Tel. No.:- 0771-2254115/6/8 Simga
Sector 32 Chandigarh Email ID:- [email protected]
Khajanchi Road, Patna Gujara Tel. No.:- 077262-74310
Tel. No.:- 0612-2300551/2/3 Tel. No.:- 0172-4979600 Tel. No.:- 8085959067 Tilda Newra
Sector 35 Chandigarh Email ID:- [email protected]
Muzafarrpur Jagdalpur
Tel. No.:- 0621 -2245265/6/7 Tel. No.:- 0172-5002359/60 Tel. No.:- 07782-22 Tuta
2039/6091/3540, 223520 Email ID:- [email protected]
Patna Sector 38D Chandigarh
Email ID:- [email protected] Email ID:- [email protected] Kanker
Email ID:- [email protected] Dadra & Nagar Haveli
Tel. No.:- 0612-2500114/15/16, Tel. No.:- 0172-4965104
2500119 Tel. No.:- 07868 -222260/ Dadra
Sector 40 Chandigarh 222297/ 222155 Email ID:- [email protected]
Patna City, Patna Email ID:- [email protected] Tel. No.:- 0260-
Email ID:- [email protected] Tel. No.:- 0172-4651351/52/53 Kawardha (SP)
Tel. No.:- 07741-232253 2667041/42/43/44, 2667041
Tel. No.:- 0612-2640084
Sector 47 Chandigarh Silvassa
Purnia (SP) Kendri
Tel. No.:- 0172-5015260 Tel. No.:- 0260-
Tel. No.:- -8518883217
Rajendra Nagar, Patna 2641712/2993712/2993713,
Chhattisgarh Korba (SP) 2641713
Tel. No.:- 0612--2665602/5603 Tel. No.:- 07759-245549
Abhanpur Daman and Diu
Rukanpura Email ID:- [email protected] Manendragarh
Daman
Email ID:- [email protected] Tel. No.:- 0771-2120182 Email ID:- [email protected]
Tel. No.:- 0612-2593338/39/40 Tel. No.:- 07771-
Ambikapur 243142/143/144/145, 243146 Tel. No.:- 0260-2254042
Saguna More Email ID:- [email protected] Delhi
Tel. No.:- 07774-231802/3, MG Road, Raipur
Email ID:- [email protected] Anand Vihar
231803
Samastipur Tel. No.:- 0771-229701-5 Email ID:- [email protected]
Email ID:- [email protected] Bansankra Nehru Nagar Ashok Vihar
Tel. No.:- 06274-294169/70/71 Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0851-8883216
Chandigarh Pachpadinaka Tel. No.:- 011-27231115 - 7,
Bhatgaon Email ID:- [email protected] 27231113 (Telefax)
Chandigarh
Email ID:- [email protected] Email ID:- [email protected] Chandani Chowk
Pandri
Tel. No.:- 0172-500 1872/3/4, Tel. No.:- 0771-2274835 Email ID:- [email protected]
2541657 Tel. No.:- 0771-2439705 Tel. No.:- 011-23255006
Bhilai
Industrial Area Chandigarh Email ID:- [email protected] Parsada Defence Colony
Email ID:- [email protected] Tel. No.:- 0788-2290602/ Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0172-4605477 2290605/ 2290609/ 2290610 Tel. No.:- 8085959065 Tel. No.:- 011-24337704
255
Dwarka Naya Bazaar Vasant Kunj Ashram Road, Ahmedabad
Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 011- Tel. No.:- 011-23987633/44/11, Tel. No.:- 011-43884400 Tel. No.:- 079-30618000
28088260/61/62/63/64 23987622
Vikaspuri Bardoli
GK 1, Kailash Colony Nehru Place Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 011-43465790/91/92 Tel. No.:- 02622-22 9375/329,
Tel. No.:- 011- Tel. No.:- 011-26280041 22 9311
West Patel Nagar
43394500/501/510/511 Nehru Place (Greater Kailash) Email ID:- [email protected] Baroda (Vadodara)
Gujranwala Town Email ID:- [email protected] Tel. No.:- 011-2588 3221 Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 011-47168700, Tel. No.:- 0265-
47168713 Goa 2332409/16/18/232 6113,
Tel. No.:- 011-47542999
Candolim 2332413
Gulmohar-Yusuf Sarai New Delhi Main Barakhamba
Email ID:- [email protected] Email ID:- [email protected] Bechari
Tel. No.:- 011-43394800 Goa (Margaon)
23738040/8408/8407, 23738041 Tel. No.:- 7574812691
I.P.Extension Tel. No.:- 0832-2712238 - 42,
New Friends Colony Bhadeli Jagalala
Tel. No.:- 011-
Tel. No.:- 011-45515716
43107691/92/93/98, 43107699 Panjim (Panaji) Bharuch
Okhla Email ID:- [email protected] Email ID:- [email protected]
Janakpuri Email ID:- [email protected] Tel. No.:- 0832-242 9044/46/47, Tel. No.:- 02642-228201-06
Email ID:- [email protected] Tel. No.:- 011-26385031, 242 7799
Tel. No.:- 011-41000141 - 43, 26385032 Bhavanipura
41000145 Ponda (SP) Email ID:- [email protected]
Paschim Vihar Tel. No.:- 08322313208 Tel. No.:- 7574812689
Jasola Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 011-45605427 Porvorim Bhavnagar
Tel. No.:- 011-29949860 Email ID:- [email protected] Email ID:- [email protected]
Pitampura Tel. No.:- 0832- Tel. No.:- 0278-2512055/2011,
Kalkaji, Delhi Email ID:- [email protected] 2410030/071/216/263, 2410133 26564292/0401
Tel. No.:- 011-49066701 Sanvordem Bhuj
Preet Vihar Email ID:- [email protected] Email ID:- [email protected]
Karol Bagh Email ID:- [email protected] Tel. No.:- 0832-2654351/ 52/ 53/ Tel. No.:- 02832-230127/230128
Email ID:- [email protected] Tel. No.:- 011- 54,265455
Tel. No.:- 011-43394600 22051623/32/64/28, 22051644 Bodakdev
Gujarat
Krishna Nagar, New Delhi Punjabi Baug Ahmedabad Tel. No.:- 079-26857435/36/37
Tel. No.:- 011- Tel. No.:- 011- Tel. No.:- 079-66633142- Bopal, Ahmedabad
45271401/45380701/45143601 45511272/73/74/76/78, 143/07966633147-153 Email ID:- [email protected]
25220046 Tel. No.:- 02717-298512
Lajpat Nagar Akota, Baroda
Email ID:- [email protected] Rajori Gardens Email ID:- [email protected] Borsad
Tel. No.:- 011-43394100 Email ID:- [email protected] Tel. No.:- 0265-2335592/93 Email ID:- [email protected]
Tel. No.:- 011- Tel. No.:- 0269-
Mayur Vihar 43882200/02/04/06/11/13 Amalsad 6220360/61/62/63
Rohini Tel. No.:- 02634-273006/07/11, CG Road, Ahmedabad
Tel. No.:- 011-43016901/02/03
Email ID:- [email protected] 273012 Email ID:- [email protected]
Mohan Cooperative Tel. No.:- 011-27047095 Tel. No.:- 079-26409971- 976
Email ID:- [email protected] Anand
Safdurjung Enclave Email ID:- [email protected] Chandkheda, Ahmedabad
Tel. No.:- 011-41324908
Email ID:- [email protected] Tel. No.:- 02692-267351/ 52/ Email ID:- [email protected]
Najafgarh Tel. No.:- 011-26715313 53/54 - 266630/ 26631 Tel. No.:- 079-
Email ID:- [email protected] 29299052/53/54/55
Sec. 9, Rohini Ankleshwar
Naraina Vihar Email ID:- [email protected] Email ID:- [email protected] Changodar
Email ID:- [email protected] Tel. No.:- 011- Tel. No.:- 02646-226405-08, Email ID:- [email protected]
Tel. No.:- 011-25895333 27553024/25/26/27 226409 Tel. No.:- 02717-294892
256
Chordi Kachhai Naroda, Ahmedabad Sarkhej
Tel. No.:- 7574818174 Tel. No.:- 7574812687 Tel. No.:- 079-22811206/7/8/9/10
Science City, Ahmedabad
Dandia Bazar - Baroda Kamrej Navsari Email ID:- [email protected]
Tel. No.:- 0265-2410750 Tel. No.:- 02621-250031/32/33 Tel. No.:- 02637-322629/
322630/ 244700/ 244900, 02637 Shahibaug
Dhanali Karelibaug, Baroda Email ID:- [email protected]
244400
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 079-25621053/58
Tel. No.:- 0265-2467111 Nehru Nagar, Ahmedabad
Tel. No.:- 7574818175 Shyamal Road, Ahmedabad
Katosan Email ID:- [email protected]
Dharmaj Tel. No.:- 079-26409706
Email ID:- [email protected] New Sama Road, Baroda
Tel. No.:- 7574812693
Tel. No.:- 02697- Email ID:- [email protected] Subhanpura - Baroda
245096/97/245102, 245098 Kherda Email ID:- [email protected]
Email ID:- [email protected] Nikol, Ahmedabad
Tel. No.:- 0265-2280171-
Dhedhal Tel. No.:- 7574812692 Email ID:- [email protected]
72/2280370-372/2280316-17
Madhapar Nizampura - Baroda
Tel. No.:- 7574812692 Surat
Gandhidham Tel. No.:- 02832-241888 Tel. No.:- 0265-2780155
Tel. No.:- 0261-
Email ID:- [email protected] Odhav, Ahmedabad
Magod Dungri 2366823/24/27/30, 2346469
Email ID:- [email protected] Udwada
233517/230646/233541/2711 Tel. No.:- 079-29297025
Mahesana Email ID:- [email protected]
Gandhinagar Paldi Cross Road Tel. No.:- 0260-2342061/71/81
Email ID:- [email protected] Tel. No.:- 02762-241492/93, Email ID:- [email protected]
Tel. No.:- 079- Umbergaon
242090 Paneli
23240597/84/85/86, 23240596 Email ID:- [email protected]
Mani Nagar (Ahmedabad) Email ID:- [email protected] Tel. No.:- 0260 -2560052/53/85
Ghodasar, Ahmedabad Email ID:- [email protected] Tel. No.:- 7574812698
Email ID:- [email protected] Vadu
Tel. No.:- 079-25440183-85, Prahlad Nagar (Ahmedabad)
Tel. No.:- 7574812694
Ghora Manjalpur (Vadodara) Tel. No.:- 079-2693 7872/93
Email ID:- [email protected] Email ID:- [email protected] Vallabh Vidya Nagar Anand
Rajkot
Tel. No.:- 7574812690 Tel. No.:- 0265-3074979/ Email ID:- [email protected]
3075929 Tel. No.:- 0281-2460642/ Valsad
Gotri - Baroda
Mankwa 2461894/ 2461893, 2461892 Email ID:- [email protected]
Email ID:- [email protected] Rajkot (SP) Tel. No.:- 02632-254555/ 254972
Tel. No.:- 0265-
2390121/321/421/422/171/381 Tel. No.:- 7574812686 Tel. No.:- 02812-463258/259 Vanagla
Mansi Circle, Ahmedabad Rajpipla Email ID:- [email protected]
Hazira
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 02767-271465
Tel. No.:- 0261-2861223/ Tel. No.:- 079-26752611-18 Tel. No.:- 02640-223 077/277, Vapi
2861224, 2861222 220 377 Email ID:- [email protected]
Mevad
Email ID:- mmgu@indusind. Rangpar Tel. No.:- 0260-2425175/
Heranj 2428129/2428624, 2428621
com Email ID:- [email protected]
Tel. No.:- 7574812697 Varachha Road, Surat
Tel. No.:- -7574812685 Ring Road - Rajkot
Morbi Email ID:- [email protected] Email ID:- [email protected]
Himatnagar Email ID:- [email protected] Tel. No.:- 0281- 2571850/60/70 Tel. No.:- 0261-2901364
Email ID:- [email protected] Tel. No.:- 02822-251 760/251 Samroli Vasna Road - Baroda
Jamnagar 808, 231461 Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Nadiad Tel. No.:- 02634- Tel. No.:- 0265-2251595
Tel. No.:- 0288-2664322/5760, Email ID:- [email protected] 234070/233138/232111, 235060
2664321 Vesu
Tel. No.:- 7574812696
Santhal Email ID:- [email protected]
Jamnagar (SP) Naranpar Pasayali Email ID:- [email protected] Tel. No.:- 0261-2215818/
Tel. No.:- 0288-2661174 Email ID:- [email protected] Tel. No.:- 027262-265155 2215819/2215953/2215954
257
Vijay Cross Road Ahmedabad Dhakola Gurgaon - Sushant Lok Malibu Town, Gurgaon
Tel. No.:- 079- Tel. No.:- 0171-2822177/277/377 Tel. No.:- 0124-2578477 Tel. No.:- 0124 -6521930- 45
26409871/72/73/74/75/76
Dhola Gurgaon - Udyog Vihar Mallekan Mandi
Waghodia, Baroda Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 01667 -244273 /74 Tel. No.:- 0124- Tel. No.:- 0169 -8285729
Tel. No.:- 0265-2565450 4114107/069/033/032
DLF Phase III Gurgaon Manbharwala
Warasia Email ID:- [email protected] Hissar Email ID:- [email protected]
Tel. No.:- 0265-2512595/ Tel. No.:- 01662- Manesar
2512597, 2512596 Faridabad 226340/41/42/44 Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0124 -3269956
Haryana Tel. No.:- 0129-4327000 IFFCO Chowk, Gurgaon
Email ID:- [email protected] Maujgarh
Arjun Marg Gurgaon Faridpur Tel. No.:- 0124-3817009 Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 7027199745
Tel. No.:- 0124-2352350 Israna
Tel. No.:- -7027199752
Email ID:- [email protected] Mustafabad
Assandh Farwain Tel. No.:- 0180-2579102/103/104 Email ID:- [email protected]
Tel. No.:- 01749-277222/23/24 Jagdishpura
Tel. No.:- 01666- Email ID:- [email protected] Nagla Megha
Badshahpur, Gurgaon 258003/7027199748 Tel. No.:- -7027199746 Email ID:- [email protected]
Email ID:- [email protected] Fatehabad Tel. No.:- 0184-2381301/2/3
Jalmana
Tel. No.:- 0124-2361121 Email ID:- [email protected] Email ID:- [email protected] Narnaul (SP)
Bagthala Tel. No.:- 01667-220484 Tel. No.:- 01749-284201/202/203 Tel. No.:- 0128-2254594
Gurgaon Jhajjar Niawal
Tel. No.:- 01744-276011
Bahadurpur Tel. No.:- 0124-2388883-5, Tel. No.:- 01251-253391, 253392 Tel. No.:- 0184-6990013 – 20
Jind (SP) Nigdhu
Bahmanwala Gurgaon - Golf Course Road Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 01745-
Tel. No.:- 0124-2572567 Kalarheri
Barna 267003/267004/267005
Email ID:- [email protected] Gurgaon - Sadar Bazar Tel. No.:- 0171-2671190 NIT Faridabad
Tel. No.:- 7027199749 Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0124-4027167 Karnal
Barwala Tel. No.:- 01734-
Email ID:- [email protected] 256634/256734/256834
Gurgaon - Sec 10 Tel. No.:- 0184-226
Tel. No.:- 01733-256391 Email ID:- [email protected] 8955/56/57/58, 2268956 Palam Vihar
Bhunslan Tel. No.:- 0124-4307153 Email ID:- [email protected]
Kundli Tel. No.:- 0124-4268648
Email ID:- [email protected] Gurgaon - Sec 15 OJ Complex Email ID:- [email protected]
Chamun (Chammu Kalan) Email ID:- [email protected] Tel. No.:- 0130-2370050 Palms Spring Plaza
Lakhan Majra Tel. No.:- 0124-4268648
Tel. No.:- 7027199742 Gurgaon - Sec 31 Email ID:- [email protected]
Chhachhrauli Email ID:- [email protected] Tel. No.:- 01257-265059 Panchgaon (Pachgaon)
Email ID:- [email protected] Tel. No.:- 0124- Email ID:- [email protected]
Tel. No.:- 01735-276101/276102 4113993/928/926/ 920, 0124- Lali Tel. No.:- 0124-2164757
Cybercity Digital Gurgaon Tel. No.:- 01697-278400/427 Panchkula
Email ID:- [email protected] Gurgaon - Sec 57 Email ID:- [email protected]
Tel. No.:- 0124- Email ID:- [email protected] Machhroli Tel. No.:- 0172-5024380/4389,
2560001/03/09/10 Tel. No.:- 0124-4309262 Email ID:- [email protected] 502 4386
Daryapur Gurgaon - Sector 14 Majra Mutsal Bhalaki Panchkula - Sector 9
Tel. No.:- 0166-7259111 Tel. No.:- 0124-4947600 Tel. No.:- 7027199743 Tel. No.:- 0172-5033751-60
258
Panipat Sector 56, Gurgaon Jharkhand Ratu Road, Ranchi
Tel. No.:- 0180 -4093900 Tel. No.:- 0124-2389230/ Barhi Tel. No.:- 0651-2284665/
231/232/233 Email ID:- [email protected] 673/669/664/663
Pehowa Tel. No.:- 06543-267352
Email ID:- [email protected] Sector 66, Gurgaon Sakchi
Tel. No.:- 01741-320802 Email ID:- [email protected] Bokaro Email ID:- [email protected]
(Direct)/220252/220190/220053 Email ID:- [email protected] Tel. No.:- 0657-2222270/72/73/,
Sirsa Tel. No.:- 06542-233418/20, 2222269
Pipli Majra Email ID:- [email protected] 231383/233419
Email ID:- [email protected] Tel. No.:- 01666- Tilaiya-Jhumri Tilaiya (SP)
Tel. No.:- 01744-230212 235276/77/78/79 Chaibasa Tel. No.:- 06534-227395
Raipur Rani Sirsa (SP) Tel. No.:- 06582-255352/255353 Karnataka
Tel. No.:- 01794 -2569634 Dhanbad Bagalkot (SP)
Sohna Road
Email ID:- [email protected] Email ID:-
Rewari Email ID:- [email protected] Tel. No.:- 0326-2305700/ Tel. No.:- 08354-221179
Email ID:- [email protected] Tel. No.:- 0124-4948100 2309888/2309801, 2309802
Tel. No.:- 01274-221115 Bangalore
Sonipat (SP)
Dumka (SP) Email ID:- [email protected]
Rohtak Tel. No.:- 0130-2232238
Tel. No.:- 06434-227377 Tel. No.:- 080-30287000 – 7014,
Email ID:- [email protected] Yamunanagar 2559 2309
Tel. No.:- 01262- Email ID:- [email protected] Giridih (SP)
645715/645669/327890, 255944 Tel. No.:- 06532-221268 Basavanagudi (Jayanagar)
Tel. No.:- 01732-220006/7/8/10
Ror Chappar Gobindpur Tel. No.:- 080-30082620/21/
Himachal Pradesh Email ID:- [email protected]
Email ID:- [email protected] 22/24/25/15/17/19, 26610258
Tel. No.:- 01732-282052 Baddi Tel. No.:- 06540-262149
Email ID:- [email protected] /157/159, 262160 Bellary (SP)
Sangar Sarista Tel. No.:- 01795-244813 Tel. No.:- 08392-256796
Email ID:- [email protected] Hazaribagh
Tel. No.:- -7027199754 Kangra Email ID:- [email protected] Bidadi
Email ID:- [email protected] Tel. No.:- 06546- Email ID:- [email protected]
Sec 15 Phase II, Gurgaon Tel. No.:- 01892-260026 224920/922/923, 224921 Tel. No.:- 080-27282369
Shimla Jamshedpur Bijapur (SP)
Tel. No.:- 0124-4268637
Sector - 17 Tel. No.:- 0177- Tel. No.:- 0657- Bommasandra
Email ID:- [email protected] 2654187/2652217, 2651251 3294929/2756115/116,2425761 Email ID:- [email protected]
Tel. No.:- 0124-2340443
Solan Tel. No.:- 080-27836556,
Kharsawan
Sector 20 Panchkula Email ID:- [email protected] 27836557
Email ID:- [email protected] Tel. No.:- 01792-221495/ Tel. No.:- 06583-254804, 254805 Chikmagalur
Tel. No.:- 0172-4623425 516/ 518 Email ID:- [email protected]
Kodarma
Sector 21, Faridabad Tel. No.:- 08262-
Jammu & Kashmir Email ID:- [email protected]
Email ID:- [email protected] 229140/41/42/43
Tel. No.:- 06534-252915/16/17
Tel. No.:- 0129-2436620 Burzulla
Davangere (SP)
Email ID:- [email protected] Lalpur Chowk, Ranchi
Sector 23 Gurgaon Tel. No.:- 08192-233496
Tel. No.:- 01942 -440261 Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0651- Devanahalli
Tel. No.:- 0124- Jammu 2560861/2560892/2560864, Email ID:- [email protected]
4276790/91/92/93/94 Email ID:- [email protected] 2560810 Tel. No.:- 080-30275386/
Tel. No.:- 0191-2470248 89/90/91/92/93
Sector 4 Gurgaon Pakaur
Email ID:- [email protected] Residency Road, Jammu Email ID:- [email protected] Gulbarga (SP)
Tel. No.:- 0124-2250246 Email ID:- [email protected] Tel. No.:- 06435-221293 Tel. No.:- 08472-227436
Sector 45, Gurgaon Srinagar Ranchi HBR Layout - Bangalore
Tel. No.:- 0124-2580560/ Tel. No.:- 0194-2480755/ Tel. No.:- 0651-2330137/ Tel. No.:- 080-30251900-908,
2380559/ 2380566/2380561 2480772, 2459490 2330147/2330134, 2331377 30251909
259
Hubli Thippasandra Kazhakuttom Thiruvananthapuram
Tel. No.:- 0836-2358263/64/65, Tel. No.:- 080 -32022266/ Tel. No.:- 0471-2527 550/1/2, Tel. No.:- 0471-4100800/
4254660 32022233/32022223, 25207084 2527553 4100888, 4100839
J P Nagar 6th Phase - Udyavara Kesavadaspuram Thrippunithara
Bangalore Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0820 -2533777/ Tel. No.:- 0471-2446099/ Tel. No.:- 0484-2780824/25
Tel. No.:- 080-26653440/41, 707/737 7099/8099
26653443 Thrissur
Whitefield Kochi
Jakkasandra Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0484-2360888 Tel. No.:- 0487-2323178/378/
Tel. No.:- 080-28531711 2322762, 2320210
Tel. No.:- 080-25539970-75 (4 lines) / 442 2288/ 236 0720 /
Kerala 0775, 2382222
Jayanagar 5th Block Madhya Pradesh
Email ID:- [email protected] Adoor Kodungallur
Tel. No.:- 080-30254492 Email ID:- [email protected] Ahir Khedi
Tel. No.:- 0480-2809210/20/40 Email ID:- [email protected]
Kolar (SP) Tel. No.:- 0473-422 3960/
Tel. No.:- 08152-222924 3961/3962 Kollam Annapurna Road, Indore
Malleshwaram Alappuzha
Tel. No.:- 0474-2766985/86/87, Tel. No.:- 0731-2794521
Tel. No.:- 0477-2230888/ 2763339
Tel. No.:- 080-30080051-56, Ashta
30080060 0997/8442, 2230998 Kottayam Email ID:- [email protected]
Mangalore Email ID:- [email protected] Tel. No.:- 07560-246924-25-26
Aluva
Email ID:- [email protected] Asravad Khurd
Tel. No.:- 0824-2425101-104, 2560728/ 2351737, 2303614
Tel. No.:- 0484-6065200-206 Email ID:- [email protected]
2448708 Kozhikode (Calicut)
Changanassery Tel. No.:- 7581810166
Marathalli Email ID:- [email protected]
Email ID:- [email protected] Asrawad Buzurg
Tel. No.:- 0481-2410766/
Tel. No.:- 080-25400190/191/ Kozhikode (Calicut) (SP) Email ID:- [email protected]
2411666/2410666
65358822, 2540192 Tel. No.:- 0495- Tel. No.:- 7581810169
Kadavanthara (Jawahar Road) 2365277/2369277
Mysore Email ID:- [email protected] Badjhiri
Email ID:- [email protected] Malappuram Email ID:- [email protected]
Tel. No.:- 0484-2207414/15/16
Tel. No.:- 0821-4252061/62/ Email ID:- [email protected]
4262899, 4252063 Kakkanad Banedia
Tel. No.:- 0483-2735810/
Email ID:- [email protected] 2735811. BM direct number Email ID:- [email protected]
Nelamangala Tel. No.:- 9977728018
Tel. No.:- 0484- 2735885, 2735810/ 2735811
Tel. No.:- 080-27722006 2413252/3211/3266, 2413251
Palakkad (Chandranagar) Barwani
Kanhangad (SP) Email ID:- [email protected] Email ID:- [email protected]
Rajrajeshwari Nagar,
Bangalore Tel. No.:- 0467-2208515/ Tel. No.:- 0491-2573900 / 01/ Tel. No.:- 07290-222 499, 222
Email ID:- [email protected] 2217288 02 BM’s Direct no. 2571900, 599
Tel. No.:- 080-28606671-75 2573902
Kannur Bheslay
Sadashivnagar - Bangalore Email ID:- [email protected] Palarivattom, Kochi Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0497-2705944 /45/ Email ID:- [email protected] Tel. No.:- 07324-268321
Tel. No.:- 080-23567400/ 3259660/ ,2705525 Tel. No.:- 0484-2341301
23466557, 23567675 Bhopal
Karamana, Trivandrum Perinthalmanna Email ID:- [email protected]
Sahakaranagar, Bangalore Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 0755-4228090 /91/ 92,
Email ID:- [email protected] Tel. No.:- 04933-224600/1/2 4228093
Tel. No.:- 080-23622334/5 Kasargod
Email ID:- [email protected] Tellicherry (Thalassery) (SP)
Bilawali
Sanjay Nagar Tel. No.:- 04994-230906/ Tel. No.:- 0490-2344980/
Email ID:- [email protected] 230907/230000 Tel. No.:- 7581810165
Shimoga Kattapana Thiruvalla
Email ID:- [email protected] Email ID:- [email protected] Bina
Tel. No.:- 08182-227722, Tel. No.:- 04868-252470/71/72, Tel. No.:- 0469-2600243/
220944 3052100 – 105 Tel. No.:- 07580-224016/17/18
252473
260
Chhindwara Kankariya Pal Sendhwa Amravati
Tel. No.:- 07162-245204/ Tel. No.:- 07281-222881 Tel. No.:- 0721-2661605
Khureri
247917/247871
Email ID:- [email protected] Seoni Andheri
Cloth Market Tel. No.:- 7509333364 Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 07692-225223 Tel. No.:- 022-67412500/02/03,
Kolu khedi
Tel. No.:- 0731-2455301/ Email ID:- [email protected] Shahdol 28237574
302/303/304/305/306 Tel. No.:- 7509333365 Email ID:- [email protected] Arjunwada
Deonagar Kurana Shujalpur Email ID:- [email protected]
Tel. No.:- 7509999026 Tel. No.:- 7509333345 Tel. No.:- 07360 -242031-32
Arwade
Dewas Maihar Singrauli (SP) Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 07805-234255 Tel. No.:- 02346-255570
Tel. No.:- 07272-2599005 Tel. No.:- 07674-233100
Sirol Aundh (Pune)
Dhar Mandla Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 8518883217 Tel. No.:- 020-25897770/
Tel. No.:- 07642-252 496-97 25893614/25893664
Dholankhapa Siyaganj, Indore
Nihalpur Mundi Email ID:- [email protected] Aurangabad
Email ID:- nmmp@indusind. Tel. No.:- 0731-2534231/2/3/4/5 Email ID:- [email protected]
Tel. No.:- 07164-290015
com Tel. No.:- 0240-2353760/
Tel. No.:- 7509333382 Sukha
Diwanganj 56/58/59, 2353757
Email ID:- [email protected] Orchha Tel. No.:- 7509333360 Bandra
Tel. No.:- 7509333350 Email ID:- [email protected]
Sutar Khedi Email ID:- [email protected]
Gohad Tel. No.:- 07680-252032/33/34
Email ID:- [email protected] Tel. No.:- 022-26457800/8320,
Email ID:- [email protected] Pandhurna 26458323
Tel. No.:- 07539-230001 Email ID:- [email protected] Talawali Chanda
Email ID:- [email protected] Bandra Kurla Complex (BKC)
Tel. No.:- 07164-220070
Gwalior Tel. No.:- 7509333325 Email ID:- [email protected]
Email ID:- [email protected] Pipariya Tel. No.:- 022-022 33923940/41/
Tel. No.:- 0751-2235564 /65/ Email ID:- [email protected] Ujjain 42/43/44/45,26754144
Tel. No.:- 07576-222335/222337 Email ID:- [email protected]
2235567
Tel. No.:- 0734-2525476/ Baner, Pune
Harnya Khedi Rairu 2525159/ 2525064/ 2525164 Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 020-
Tel. No.:- 7509333362 Umariya
6738600/601/602/603/604
Hoshangabad Email ID:- [email protected]
Email ID:- [email protected] Raisen Tel. No.:- 07324-266302 Basarge Bk
Tel. No.:- 07574-250308 Umri Kheda
Tel. No.:- 07482-222901/903 Tel. No.:- 02327-265265
Indore Email ID:- [email protected]
Ratlam Tel. No.:- 7581810166
Email ID:- [email protected] Belewadi Haveli
Tel. No.:- 0731-2542696/7/8, Vijay Nagar, Indore Email ID:- [email protected]
2539092 Ratlam (SP) Email ID:- [email protected]
Tel. No.:- 07142-400321 Bhandharkar Road
Tel. No.:- 0731-2558792
Indore - Sapna Sangeeta Email ID:- [email protected]
Email ID:- [email protected] Rewa (SP) Y N road Tel. No.:- 020-25651391 – 94 /
Tel. No.:- 0731-2760419-23, Tel. No.:- 07662-408786 Email ID:- [email protected] 25651397/ 25651398/ 25651389
2760424 Sanawadia Tel. No.:- 0731-254273-38 / 25651387 / 25651386
Email ID:- [email protected] /25651396
Jabalpur Maharashtra
Tel. No.:- 7581810170 Bhayander
Ahmadnagar Email ID:- [email protected]
Tel. No.:- 0761-4006180/ Satna (SP)
4010100, 2450003 Tel. No.:- 07672-409737
Tel. No.:- 0241-2340044
Kalod Kartal Sehore Bhokara
Akola
Tel. No.:- 7509999025 Tel. No.:- 7562221182 Tel. No.:- 0712-2612912
Tel. No.:- 0724-2420344
261
Bolwad Dhantoli, Nagpur Jaripatka, Nagpur Kharghar
Tel. No.:- 0233-2258005 Tel. No.:- 0712-2459911/12/13 Tel. No.:- 0712-2647955 / Tel. No.:- 022-66739920
2641944
Boramani Dharangutti Kingsway Sadar, Nagpur
Email ID:- [email protected] Email ID:- [email protected] Juhu Email ID:- [email protected]
Tel. No.:- 0232-2235988 Email ID:- [email protected] Tel. No.:- 0712-2522509/08/07
Borivali (Borivli) Tel. No.:- 022 -26123582
Email ID:- [email protected] Dindnerli Kolhapur
Tel. No.:- 022-30008267/ Email ID:- [email protected] Kalanagar Email ID:- [email protected]
30008274 Tel. No.:- 0231-2396122 Email ID:- [email protected] Tel. No.:- 0231-6512007/9
Tel. No.:- 022-42209400
Byramji Town, Nagpur Dindoshi, Goregaon Kondhavekhurd
Email ID:- [email protected] Kalbadevi, Mumbai Email ID:- [email protected]
Tel. No.:- 022- -28406015/ Email ID:- [email protected] Tel. No.:- 020-26838941-45/
Tel. No.:- 0712 - 2581100
16/17/18 Tel. No.:- 022 -22417532, 26832355
CA Road, Nagpur 22417536
Dombivali Koparkahirane
Email ID:- [email protected] Kalvade Email ID:- [email protected]
Tel. No.:- 0712-2762305 – 8 Tel. No.:- 0251-2860512/13 Tel. No.:- 022-27555012
CBD Belapur-Navi Mumbai Fatima Nagar, Pune Kothrud
Kalyan
Tel. No.:- 022-27571243 Tel. No.:- 020-26862100/ 101 Tel. No.:- 020-41494602
Tel. No.:- 0251-2310262 /
Chakan, Pune /111 /112 2310328 / 2310141 Latur (SP)
Email ID:- [email protected] Fort Tel. No.:- 02382-225381
Kalyani Nagar
Tel. No.:- 02135-399427 Email ID:- [email protected] Email ID:- [email protected] Lokhandwala
Tel. No.:- 022-66366580 - 83, Tel. No.:- 020-26650200
Chandrapur Email ID:- [email protected]
66366590 / 87
Email ID:- [email protected] Tel. No.:- 022-40339700 &
Kandalgaon
Tel. No.:- 07172-272321-25 Friends Colony Nagpur 26731574, 2673 1575
Charegaon Tel. No.:- 0231-2638200 Lower Parel
Tel. No.:- 0712-2572226/27/28
Kandivali
Ghatkopar Tel. No.:- 022-24950353
Chembur Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 022-28022079/80, Madha
Tel. No.:- 022-21020284/
Tel. No.:- 022-25260882/83/84 28022083 Email ID:- [email protected]
88,21020286
Tel. No.:-
Chokak Kandivali East, Mumbai
Ghatnandre -02183235100/01/02/03/04
Tel. No.:- 022-28705526/ Mahim
Tel. No.:- 0230-2485122 Tel. No.:- 02341-241022
1139/4993 Email ID:- [email protected]
Crawford Market, Mumbai Ghodbunder Road, Thane Tel. No.:- 022-24455301/
Email ID:- [email protected] Kanjurmarg, Mumbai 24455563, 24455091
Tel. No.:- 022-22632126/7/8/ Malad
Tel. No.:- 022-67584165
22632125/ 22632124 Ghogaon Email ID:- [email protected]
Email ID:- [email protected] Karad Tel. No.:- 022-28880408,
Dadar
Tel. No.:- 02346-278188 Email ID:- [email protected] 28880409
Tel. No.:- 02164-224941
Tel. No.:- 022-24099160, Gijavane Male
24167930 Email ID:- [email protected] Karmoli Email ID:- [email protected]
Tel. No.:- 02327-222755 Email ID:- [email protected] Tel. No.:- 02328-241477
Dahiwadi Tel. No.:- -7798903888
Email ID:- [email protected] Hinjawadi Masjid Bunder Mumbai
Tel. No.:- 02346-249199 Email ID:- [email protected] Kerle Email ID:- [email protected]
Tel. No.:- 020-22933788-93 Email ID:- [email protected] Tel. No.:- 022-23402002/ 003/
Dargan Halli Tel. No.:- 0231-2458450 004/ 009/ 010, 23402011
Email ID:- [email protected] Hotgi
Email ID:- [email protected] Khar Medical Square Nagpur
Daroda Email ID:- bokh@indusind. Email ID:- [email protected]
Email ID:- [email protected] Jalgaon (SP) comTel. No.:- 022-61271975/ Tel. No.:- 0712-2755545/
Tel. No.:- 7153203344 Tel. No.:- 0257-2270620 77/79, 6127 1985 46/47/48/49
262
Mehboob Studio Bandra Panvel Sonali Tura
Tel. No.:- 022-26405463/ Tel. No.:- 022-2748 3252, Tel. No.:- 02325-250150 Tel. No.:- 03651-220095/96/25,
26405684/ 26405691, 26405475 27483026 220108
Thane
Mira Road Parbhani (SP) Email ID:- [email protected]
Mizoram
Email ID:- [email protected] Tel. No.:- 0245-2224792 Tel. No.:- 022-25306851/52,
Tel. No.:- 022-28122515/17-19 25390376 Aizawl
Peddar Road, Mumbai Email ID:- [email protected]
Mulund Email ID:- [email protected] Ulhasnagar
Tel. No.:- 0389-230 5515/18,
Email ID:- [email protected] Tel. No.:- 022-23542073/74/75, Email ID:- [email protected]
230 5355
Tel. No.:- 022-2592 23542076 Tel. No.:- 0251-2710201
7080/6808/6833, 2592 6837 Pimpri Chinchwad Vasai Nagaland
Email ID:- [email protected] Email ID:- [email protected] Dimapur
Nagpur
Tel. No.:- 020-274 Tel. No.:- 0250-2330009/5/ Email ID:- [email protected]
40622/23/24/25/26, 27440627 21/123/124, 2330100
Tel. No.:- 0712-6641800-18 , Tel. No.:- 03862-234021
2547457 Powai, Mumbai Vasant Vihar, Thane, Mumbai
Kohima
Nagpur (SP) Email ID:- [email protected]
Tel. No.:- 022- -25704824/34 Tel. No.:- 022-21715064/
Tel. No.:- 0712-2527618 Tel. No.:- 0370-2290241/
65/66/67
Prabhadevi 2290190/ 2290131/ 2290197
Nanded (SP) Email ID:- [email protected] Vashi
Tel. No.:- 0246-2238082 Tel. No.:- 022-24315857, Email ID:- [email protected] Odisha
Nariman Point 24304498 Tel. No.:- 022-27830026/
Angul
Pune Email ID:- [email protected]
Tel. No.:- 022-22022404/ Email ID:- [email protected] Vashi - Sec 17 Tel. No.:- 06764-230084/85,
407/415/419, 22022387 Tel. No.:- 020-30461600/ Email ID:- [email protected] 230074
30461601/30461602/30461603 Tel. No.:- 022-27668458/
Nasik Badkalimati
/30461607/04/09, 26343241 62/63/64
Tel. No.:- 0253-6695401/02/03 Ramapur Vile Parle (East) Tel. No.:- -9437483103 /
Email ID:- [email protected] Email ID:- [email protected] 9437483105/9437483095
Nerul (Navi Mumbai) Tel. No.:- 02347-227614 Tel. No.:- 022-26126177
Email ID:- [email protected] Balasore
Tel. No.:- 022-22217081 / 091; Ratnagiri Viman Nagar, Pune Email ID:- [email protected]
27707031 / 041 Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 06782-240274 / 6/
Tel. No.:- 02352-224095/ Tel. No.:- 020-41494545 268293, 240265
Nigdi 96/97/98/99
Email ID:- [email protected] Wardha Road, Nagpur Barbil
Tel. No.:- 020-27650250 Rethare Khurd Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0712-2295061-64, Tel. No.:- 06767-276821, 277473
Niphad 2295065
Sandgewadi Bargarh
Email ID:- [email protected] Wasumbe Email ID:- [email protected]
Tel. No.:- 02550-242455/
Tel. No.:- 02346-226225 Email ID:- [email protected] Tel. No.:- 06646 -246701/
241955/241855
Tel. No.:- 02346-250049 702/670, 246704
Sangli
Opera House Bhubaneshwar
Email ID:- [email protected] Yerla
Tel. No.:- 0233-2327622
Tel. No.:- 022-43457500, 2385 Tel. No.:- 0712-2667526 Tel. No.:- 0674-2536124/ 6125,
9913 Satara 2535191
Email ID:- [email protected] Manipur
Padavalwadi Tel. No.:- 02162-233119/21/27 Chandikhol
Email ID:- [email protected] Imphal Email ID:- [email protected]
Tel. No.:- 02342-263063 Shikrapur Email ID:- [email protected] Tel. No.:- 06725-226291/
Email ID:- [email protected] Tel. No.:- 0385-2448042 226293, 226292
Pakani Tel. No.:- 02137-286136
Email ID:- [email protected] Chandrashekharpur -
Shirwal, Satara Meghalaya
Bhubaneshwar
Pandharpur Email ID:- [email protected] Shillong Email ID:- [email protected]
Solapur Tel. No.:- 0674-2743962/
Tel. No.:- 02186-224417/18/19/ Tel. No.:- 0364-2501479/
20/21 2501405
Tel. No.:- 0217-2621001
263
Cuttack Sambalpur Begowal Jagraon
Tel. No.:- 0671-232 1341/42/43, Tel. No.:- 0663-2541366 Tel. No.:- 01822-248815 Tel. No.:- 01624-220226/
2321344 27/28/29
Sonapur Bhatinda
Dhamra Email ID:- [email protected] Email ID:- [email protected] Jalandhar
Email ID:- [email protected] Tel. No.:- 06654-220134 / 35 Tel. No.:- 0164-2213466- 68/222 Email ID:- [email protected]
Tel. No.:- 06786-9238157107/ 4284, 5004187 Tel. No.:- 0181-5010348/ 347/
Sundergarh
9238157105 345/ 341/ 5003480/ 5003580,
Bhulpur
Guali Tel. No.:- 0662-2273434/ 5010345
Tel. No.:- 01886-237189 Jalandhar (Opp Gymkhana
Tel. No.:- 06767-244190 / Talcher Email ID:- [email protected]
244191 Email ID:- [email protected] Chak Mai Das
Tel. No.:- 0181-5051585/
Tel. No.:- 06760-240065, 240098 Email ID:- [email protected]
IRC Village, Bhubaneshwar 588/ 589
Email ID:- [email protected] Chaurha
Pondicherry Jalandhar (SP)
Tel. No.:- 0674-2550341/ Email ID:- [email protected]
Tel. No.:- 0181-2239146
342/343/344, 2550345 Pondicherry Tel. No.:- 01884-280149/187
Jajpur Road Email ID:- [email protected] Jand
Tel. No.:- 0413-4210600/ Chhaudriwala Email ID:- [email protected]
Tel. No.:- 06726-223056/57/58 4210601/ 2222191/ 2222192, Tel. No.:- 0188-3285132
4210602 Tel. No.:- 01852-502410
Jeypur (SP) Jatpura
Dangian Email ID:- [email protected]
Tel. No.:- 06854-231031 Punjab
Jharsuguda Abohar (SP) Tel. No.:- 01624-231455
Email ID:- [email protected] Tel. No.:- 01634-229357 Jhingran
Daon (Mohali) Email ID:- [email protected]
Tel. No.:- 06645-273415/25/35 Amloh Email ID:- [email protected] Tel. No.:- 01823-243918
Joda Email ID:- [email protected] Tel. No.:- 0172-3017480/
Email ID:- [email protected] Tel. No.:- 01765-20288-89-90 3017481/ 3017475 Kakkarwal
Tel. No.:- 06767-272816/ Amritsar Email ID:- [email protected]
272841/273780, 272558 Fattuwala
Email ID:- [email protected] Kaler
Keonjhar (Kendujhar) Tel. No.:- 0183-5066708/808,
Email ID:- [email protected] 2221055 Fazilka
Tel. No.:- 06766-255832 / 858 Andlu Email ID:- [email protected] Kapur Pind
Nimapada G T Road, Amritsar Tel. No.:- 0181-2700072
Tel. No.:- 01624-262064/
2264/2664
Tel. No.:- 06758-252851/3, Tel. No.:- 0183-5020220 Kapurthala
252852 Apra Email ID:- [email protected]
Email ID:- [email protected] Ghalori Tel. No.:- 0181 -236551
Panposh Tel. No.:- 01826-250533/ Email ID:- [email protected] /237551/238551/239551
Email ID:- [email protected] 251533, 252533
Tel. No.:- 0661-2401583/84/85, Gobindgarh Kariha
2401590 Baghana Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 01765-251094/ Tel. No.:- 0182-3278593
Patrapara Tel. No.:- 01824-503061 250094/252091
Email ID:- [email protected] Khamanon
Tel. No.:- 0674-2470913 Bakarpur Gora wahi Email ID:- [email protected]
/2470914, 2384915 Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0160- 2251773/ Tel. No.:- 01628-503440/
Tel. No.:- 0181-2725963 42/43/44, 503441
Pipili 2251774
Email ID:- [email protected] Gujjarpura Khanna
Balad Kalan
Tel. No.:- 06758-240095/75, Email ID:- [email protected] Email ID:- [email protected]
240055 Tel. No.:- 01574-232853/ Tel. No.:- 01628-503638,
Banga 232852/232851
Rayagada (SP) 503537
Tel. No.:- 06856-224080 Tel. No.:- 01823-263739/ Hoshiarpur Kheowali
Rourkela (SP) 264513/501011/501012, Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0661-2400220 263739 Tel. No.:- 01882-502700 Tel. No.:- -01637240018/19/20
264
Lal Bai New NAG Sharakpur Balotra
Tel. No.:- 01637-238411/12/13 Tel. No.:- 01574-232853/ Tel. No.:- 01821-220285/220287 Tel. No.:- 02988-221111
232852/232851
Lalian Khurd Sohan Kalan Bani Park, Jaipur
Email ID:- [email protected] Patiala Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0181-2792835/0181- Email ID:- [email protected] Tel. No.:- 0141-2207896/97/98
2792838 Tel. No.:- 0175-5009600 Sunder Nagar, Ludhiana
Email ID:- [email protected] Banswara
Landran
Phagwara Tel. No.:- 0161-3028653/ Email ID:- [email protected]
Email ID:- [email protected] 3028654 Tel. No.:- 02962-241166, 240767
Tel. No.:- 0160-2250200/
Tel. No.:- 01824-503060 to
2250300, 2250100 Talwandi Kalan Bapu Nagar, Jaipur
503068, 223421
Ludhiana Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Phase 11 Mohali Tel. No.:- 0141-2704564/ 565/
Email ID:- [email protected] Tanda, Jalandhar
Tel. No.:- 0161-504 3800 – 11, Email ID:- [email protected] 566/ 567
2771810 Tel. No.:- 0172-5058208/
5058208 Tel. No.:- 0181 -2490600/ Barmer
Madhopur 2291900
Email ID:- [email protected] Rahon
Tarkheri Kalan Tel. No.:- 02982-221105, 221006
258152/ 258153 Basni (SP)
501799 Tharike Tel. No.:- 02912-741147
Majith Mandi, Amritsar
Email ID:- [email protected] Raj Gomal Email ID:- [email protected]
Behror
Tel. No.:- 0173-5015020 Email ID:- [email protected] Tel. No.:- 0161-5001590/93/
Tel. No.:- 01826-270143/ 5001595-99, 5021313
Manauli Tel. No.:- 01494-222012/13
Email ID:- [email protected] 270146/ 270147 Urban Focul Point
Bhilwara
Tel. No.:- 0160-2251355/56 Rajpura Email ID:- [email protected]
Mansa Email ID:- [email protected] Tel. No.:- 01482-233200 - 201,
3373/4373, 2678500
Email ID:- [email protected] 233 202
Rampur Khalyan
Tel. No.:- 01652 -500026 - 28, Warring
Email ID:- [email protected] Bhinmal (SP)
Tel. No.:- 01824-243284 Tel. No.:- 02969-220032
Mardanpur Tel. No.:- 01633-275036
Email ID:- [email protected] Sadiq Bhiwadi
Email ID:- [email protected] Zirakhpur Mohali
Millerganj, Ludhiana Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Sangrur Tel. No.:- 01762-532462 Tel. No.:- 01493-204087,
Tel. No.:- 0161-5048250/ Email ID:- [email protected] 230083
5048251/5048252/5048255 Tel. No.:- 01672-500201 Rajasthan
Bijoliya
Miran Kot Khurd Saprore 32 RB (Fakirwali) Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 01489-236236 /
Moga Tel. No.:- 01824-240118 Ajmer 236400/236240, 236237
Email ID:- [email protected] Sector 54 Mohali Email ID:- [email protected] Bikaner
Tel. No.:- 01636-234240 Email ID:- [email protected] Tel. No.:- 0145-2631999/ Email ID:- [email protected]
Tel. No.:- 0172-4604741 2428239/ 2428240, 2428251 Tel. No.:- 0151-2201790 /
Mohali (Sas Nagar)
Email ID:- [email protected] Alwar 2201793, 2201792
Sector 67 Mohali
Tel. No.:- 0172-502 0821-27, Email ID:- [email protected]
Email ID:- [email protected] BMCH & RC
505 3651 Tel. No.:- 0144-2701368
Tel. No.:- 0172-6900140 to 48 Email ID:- [email protected]
Mullanpur Amer Road
Email ID:- [email protected] Sector 70 Mohali Boranada (Boranara)
70/71/72/73. Tel. No.:- 0172-4605463 Arayan (32F) Tel. No.:- 02931-281373,
Nawanshahr Shahkot
Email ID:- [email protected] Email ID:- [email protected] Asind, Bhilwara Chaura Rasta, Jaipur
Tel. No.:- 01823-503150/ Tel. No.:- 01821-509 300/02/03, Email ID:- [email protected] Email ID:- [email protected]
51/52/53 509 301 Tel. No.:- 9351220975 Tel. No.:- 0141-2562005/06/07
265
Chittaurgarh Jhunjhunu Nasirabad Sriganganagar
Tel. No.:- 01472- 243335-36, Tel. No.:- 01592-236319/ Tel. No.:- 01491 -220452/ Tel. No.:- 0154-2470083/
243330 236728, 235018 220456, 220454 84/85/86
Dausa Jodhpur Neem-Ka-Thana Sukher
Tel. No.:- 01427-223194/ Tel. No.:- 0291-264 7739, Tel. No.:- 01574-232853/ Tel. No.:- 0294-2440028/
95/96/97 262 2765 232852/232851 2440079
Dayra Sumerpur
Johri Bazar, Jaipur Neemrana
Tel. No.:- 02933-258127/
DCM Ajmer Road Jaipur Tel. No.:- 0141-2560074/ Tel. No.:- 01494-246037/ 8
128/327/328/ 744, 258743
Paota, Jodhpur Sursagar, Jodhpur
Tel. No.:- 0141-2358157
Kalwar Road, Jaipur Email ID:- [email protected] Email ID:- [email protected]
Deoli Email ID:- [email protected] Tel. No.:- 0291-2545601-2 Tel. No.:- 0291-2780784/
Email ID:- [email protected] Tel. No.:- 0141-6055567/ 2780785, 0291-2781785
Tel. No.:- 01434-232433 / 35, Pilani
6066789
232434 Email ID:- [email protected] Udaipur
Kota Tel. No.:- 01596-243002/ Email ID:- [email protected]
Falna Email ID:- [email protected] 03/06/07 Tel. No.:- 0294-2417294/295
Email ID:- [email protected] Tel. No.:- 0744-2366677 - 80, 2427997/2427998, 2415240
Raja Park, Jaipur
Fatehpur 2366681 Vaishali Nagar, Jaipur
Email ID:- [email protected] Tel. No.:- 0141-2600300/ Email ID:- [email protected]
Kuchaman (SP)
Tel. No.:- 01571 -232024/ 2600477, 2600713 Tel. No.:- 0141-2353753/54/57,
Tel. No.:- 01586-221831
25/26/27 2353755
Lalewala (59 Lnp –Ii) Rajsamand
Gordhanvilas Vallabhnagar
Tel. No.:- 02952-224003/4,
Tel. No.:- 02942-641802-03, Lalsot Tel. No.:- 02957-240007,
224005
641804 Email ID:- [email protected] 240017
Gotan Tel. No.:- 01431 -260111/ Raniwara Vidyadhar Nagar, Jaipur
Email ID:- [email protected] 260113 Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 01591-230059/ 60/ 61, Tel. No.:- 02990-232001 Tel. No.:- 0141-2339092/ 93/
Laxmangarh (Lachhmangarh) /011 /012
230055 94/ 95
Gowari Tel. No.:- 01573-222 061, Relgaon
Sikkim
Email ID:- [email protected] 222 062 Email ID:- [email protected]
Tel. No.:- 02966-255332-33, Gangtok
Mahapura Riddhi Siddhi, Jaipur
Hanumangarh (SP) Tel. No.:- 0141-2259090/84, Tel. No.:- 0141-6065557/ Tel. No.:- 03592-231585/
Tel. No.:- 01552-230999 6065558 232571, 271157
2259086
Jaipur Salumbar Jorethang
Malviya Nagar, Jaipur
Tel. No.:- 0141-4238100-112, Tel. No.:- 2906232023 Tel. No.:- 03595-257701/
Tel. No.:- 0141-2552773/ 257702/257710
4238100
74/75/78 Shahpura
Jaisalmer Email ID:- [email protected] Tamil Nadu
Morpa
Email ID:- [email protected] Tel. No.:- 01422-225388/89/
Email ID:- [email protected] Adyar - Chennai
Tel. No.:- 02992-252012 517231, 225390 Email ID:- [email protected]
Jalore Nagaur Tel. No.:- 044-49061400/
Email ID:- [email protected] Shyam Nagar, Jaipur
Email ID:- jara@indusind. 49061401/ 49061403
comTel. No.:- 02973-223125
247185 , 247168 Tel. No.:- 921420044 Aminijikarai - Chennai
Jawahar Nagar, Jaipur Email ID:- [email protected]
Narsinghpura Sikar (SP)
Email ID:- [email protected] Tel. No.:- 01572-246100 092/0068, 23630089
Tel. No.:- 0141-2654013
266
Annanagar - Chennai Gobichettipalayam Oppanakara Street, T Nagar - Chennai
Email ID:- [email protected] Email ID:- [email protected] Coimbatore Email ID:- [email protected]
Tel. No.:- 044-49060300 / Tel. No.:- 1637238411 Email ID:- [email protected] Tel. No.:- 044-28156937/36
01/02/03/04, 49060312 Tel. No.:- 0422-399655
Guindy-Chennai (SP) Teynampet - Chennai
Aranthangi Tel. No.:- 044-43604551 Perungudi Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 044-24315632 - 35
Hosur Tel. No.:- 044-24962391 to 2395
Tel. No.:- 04371-271 555/271 Email ID:- [email protected] Thiruvallur
302 Tel. No.:- 04344-240301/ R.S. Puram, Coimbatore Email ID:- [email protected]
240401/649599, 240101 Email ID:- [email protected] Tel. No.:- 044-2766 4381/
Ashok Nagar - Chennai
Tel. No.:- 0422-2541409/29, 82/83/84
Email ID:- [email protected] K K Nagar 2545564
Tel. No.:- 044-24851067/ Email ID:- [email protected] Tiruchirapalli
68/69/71/72, 24851070 Rajaji Salai (Parrys) - Chennai Email ID:- [email protected]
Karur Email ID:- [email protected] Tel. No.:- 0431-2412237 /
Avanashi Email ID:- [email protected] Tel. No.:- 044-30063030 2462237, 2412217
Email ID:- [email protected] Tel. No.:- 04324-231402 / 3,
Tel. No.:- 04296-273701 & 04, 231404 Ram Nagar (Coimbatore) Tirupur
273705 Email ID:- [email protected] Email ID:- [email protected]
Kilpauk Tel. No.:- 0422-2233015/ Tel. No.:- 0421-2423875/885,
Chennai Email ID:- [email protected] 2233035/ 2233045/ 2233075, 2422471
Email ID:- [email protected] Tel. No.:- 044-26420409/ 2233025
Tel. No.:- 044-044 4596 0423/0436/0468 Trichy Road
Ramanathapuram, Coimbatore Email ID:- [email protected]
2500/01/02/03, 4596
Madipakkam Email ID:- [email protected]
2510(Operations) ,4596 2520 Tuticorin
(SPOPS) Tel. No.:- 044-22472363 / Email ID:- [email protected]
45962700 Royapettah, Chennai Tel. No.:- 0461-2300702/3/4/6,
Chinmay Nagar, Chennai Email ID:- [email protected] 2300702
Email ID:- [email protected] Madurai Tel. No.:- 044-4952 7609
Tel. No.:- 044 Email ID:- [email protected] Vadavalli
Tel. No.:- 0452-2520421 / Sai Baba Colony Email ID:- [email protected]
Coimbatore Email ID:- [email protected] Tel. No.:- 08816-221608
2522850, 2520393
Email ID:- [email protected] Tel. No.:- 0422-2436540 /
Tel. No.:- 0422-6602000/ Medavakkam 2433540/2435540/ Valasaravakkam
6602003/ 6602004/ 6002007/ Email ID:- [email protected] 2445540/2444540 Email ID:- [email protected]
6602008, 2221770 Tel. No.:- 044-22770972 Tel. No.:- 044-24869171 – 75
Salem
Mowlivakkam Email ID:- [email protected] Velachery, Chennai
Coonoor
Email ID:- [email protected] Tel. No.:- 0427-2446096, Email ID:- [email protected]
Tel. No.:- 044-32006664/ 2330505 Tel. No.:- 984671702
Tel. No.:- 0423-2232010/
2232020, 2232120 32006665/32006667/32006668, Vellore
Sankari
Dharmapuri Email ID:- [email protected]
Tel. No.:- 04283 -241600, Tel. No.:- 0416-222 2263/43,
Email ID:- [email protected] Namakkal
241001 2222243
269611, 267809 Tel. No.:- 04286-231722/ West Anna Nagar
Sirkali
0064/0086, 225906 Email ID:- [email protected]
Dindigul Tel. No.:- 044-49528133
Namakkal (SP) Tel. No.:- 04364-270866/
Email ID:- [email protected] 271866/ 272866/ 273866/
Email ID:-
Tel. No.:- 0451-2432120/ Telangana
Tel. No.:- 04286-201026 274866
130/140 A.S.Rao Nagar, Hyderabad
Nelson Manickam Road, Sivakasi
East Mogappair, Chennai Email ID:- [email protected]
Chennai Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 04562-276736, 276734
Tel. No.:- 044-26568485- 488 26/27/28
Tel. No.:- 044-23741317 Sriperumbudur
Banjara Hills
Erode Omalur Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 044-27163880/
Tel. No.:- 040-23553081/2355
Tel. No.:- 0424-2259073/75/76, Tel. No.:- 04290-222581/ 27163882/ 27163877/
3085 / 2355 3086 & 23553087,
2257061 582/583, 222584 27163887, 27163889
2354 5274
267
Chotuppal Miyapur Udaipur North East (SP) Azamgarh
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 03821-225959 Email ID:- [email protected]
Tel. No.:- 08694-273055 Tel. No.:- 040-23041632/ Tel. No.:- 05462-247400/
23041691/ 23041634, 23141693 Uttar Pradesh 246042/ 246043/ 246043
Gachibowli, Hyderabad
Email ID:- [email protected] Nizamabad (SP) Agra Bareilly
Tel. No.:- 040-23281807/1808 Tel. No.:- 08462-234968/69 Email ID:- [email protected] Email ID:- [email protected]
/1809/1810 Tel. No.:- 0562-3018380 / Tel. No.:- 0581-2572112 / 2113,
Nizampet 3018390 / 3018420, 3018420
Gaddiannaram 2471912
Email ID:- [email protected] Tel. No.:- 040-30479447/08/09, Ahimanpur Bhadohi
Tel. No.:- 040-24064411/12, 30479446 Email ID:- [email protected] Email ID:- [email protected]
24064413 Tel. No.:- 05414 -243033 Tel. No.:- 05414-224301-224302,
S R Nagar
Hyderabad (Thirumalghery) Ajitpur 224301
(SP) Tel. No.:- 040-040-23711512/ Email ID:- [email protected] Bhaisamau
Tel. No.:- 040-27740340/41/50 Tel. No.:- 0595-2330167/
513/514/526 Email ID:- [email protected]
Kaarkhana - Secunderabad 2330168/ 2330169 Tel. No.:- 8795839012
Sadasivpet
Email ID:- [email protected] Akbarpur, Ambedkar Nagar
Email ID:- [email protected] Chhapraula
Tel. No.:- 040-27742025/26 Email ID:- [email protected]
Tel. No.:- 08455-251663 / Email ID:- [email protected]
Karimnagar (SP) 252663 Tel. No.:- 05271-260009 Tel. No.:- 0120-2673036
Tel. No.:- 08782-277666
Secunderabad Alambagh, Lucknow Chhinhat, Lucknow
Kodad Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 040-46595200 Tel. No.:- 0522-2453245/ Tel. No.:- 9235400524
Tel. No.:- 08683-256044, 2452245
256043 Somajiguda - Hyderabad Chitaura
Email ID:- [email protected] Aliganj, Lucknow Email ID:- [email protected]
Kompally Tel. No.:- 040-23312980 / 82, Email ID:- [email protected] Tel. No.:- 08650921112/
Email ID:- [email protected] 23312981 Tel. No.:- 0522-2329826/7 08795839006, Abhishek
Tel. No.:- 08418-233312 / 14,
Tarnaka, Hyderabad Aligarh (SP) Gupta(B.M) —9720110014.
233313
Email ID:- [email protected] Chopan (OBRA) (SP)
Kothagudem (SP) Tel. No.:- 040- 27001544/
Allahabad Tel. No.:- 05445-263165
Tel. No.:- 08744-244557 27001644/ 27001744/ 27001844
Email ID:- [email protected] Chowk, Lucknow
Kukatpally, Hyderabad Towlichowki, Hyderabad Tel. No.:- 0532-2260354/
Email ID:- [email protected] 2260353/2260355 Tel. No.:- 0522-4939666
Tel. No.:- 040 -65080172 Tel. No.:- 040-23566700 /
23561700, 23567900 Alpha Greater Noida Civil Lines
L B Nagar
Email ID:- [email protected] Vicrabad Tel. No.:- 0120-23/95/147
Tel. No.:- 040-24036196/ Dhanwa (Dhawa)
7196/8196/9196 Aminabad
Tel. No.:- 084165-252541/61, Email ID:- [email protected]
252581 Email ID:- [email protected] Tel. No.:- 8795839008
Madhapur
Email ID:- [email protected] Tel. No.:- 0522-2638989,
Warangal 2625994 Fatehpur (SP)
Tel. No.:- 040-40888104/
40888105/40888106/ Anora (Anaura) Kala
40888107/40888108 Tel. No.:- 0870-2433555,
2428999 Email ID:- [email protected] Ghaziabad
Mancherial (SP) Tel. No.:- 8795839011 Email ID:- [email protected]
Tel. No.:- 08736-255277 Tripura Tel. No.:- 0120-4041560
Anpara
Medak Agartala Email ID:- [email protected] Gomti Nagar, Lucknow
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 05446-272 747/74/ Email ID:- [email protected]
Tel. No.:- 0845-2220033 Tel. No.:- 0381-2320040/ 272 448 Tel. No.:- 0522-2304125/
2320061, 2327997 2304126
Miryalguda Ashiyana
Email ID:- [email protected] Dharmanagar Email ID:- [email protected] Gopiganj
Tel. No.:- 08689-243050, Email ID:- [email protected] Tel. No.:- 0522-2424912/ Email ID:- [email protected]
243150 Tel. No.:- 03822-235181/235189 13/14/15 Tel. No.:- 05414-232056
268
Gorakhpur Kakarmatta Noida (Sec 63) Sector 12 Noida
Tel. No.:- 0551-6457144 Tel. No.:- 0542-2270041/2 Tel. No.:- 0120-4782101-122 Tel. No.:- 0120-
2548493/492/491/490
Govind Nagar, Kanpur Kannauj Obaree
Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected] Sector 48, Noida
Tel. No.:- 0512-2650170/ Tel. No.:- 05694-234307/8/9/10 Tel. No.:- 05248-225822/226822 Email ID:- [email protected]
171/186/187 Tel. No.:- 0120-2571773
Kanpur Omega, Noida
-2571776, 2571778
Hapur Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0512-2554057-60, Tel. No.:- 0120-2395146 Sector 50 Noida
Tel. No.:- 0122-2306085/86, 2554056 Email ID:- [email protected]
P Road, Kanpur
2306087 Tel. No.:- 0120-2502820/
Karachikhana, Kanpur Email ID:- [email protected]
21/22/23
Harduaganj Email ID:- [email protected] Tel. No.:- 0512-3365123
Email ID:- [email protected] Tel. No.:- 0512-3082866- Sector 58 Bishanpura Noida
Paikaramau
3082885- (20 Lines) Email ID:- [email protected]
Indira Nagar, Lucknow Email ID:- [email protected]
Email ID:- [email protected] Kasya, Khushinagar Tel. No.:- 8795839009 Sector 62, Noida
Palia Kalan
Tel. No.:- 011-204304632
Indirapuram - Ghaziabad Kharamau Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 05871-233021 Sikri Hissa iv
Tel. No.:- 0120-4299450 Tel. No.:- 7388310005 Email ID:- [email protected]
Pratapgarh
Kopaganj Email ID:- [email protected] Tel. No.:- 7830102444
Jagdishpur
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- -05342220024/ Sirsa Etawah
Tel. No.:- 05361-265221/ Tel. No.:- 9792100461/ 25/27/28 Email ID:- [email protected]
265222/ 265219 9792100462
Rae Bareli Tanda Sadat
Jajmau Kundol Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 0535- Tel. No.:- 05825-220475 &
Tel. No.:- 0512-2400016/ Tel. No.:- 8795839002 2210148/150/151 7055518800
20/2400173 / 2400390 Lucknow Robertsganj Vaishali
Jamalpur Email ID:- [email protected] Email ID:- [email protected] Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0522-4935600/ Tel. No.:- 05444-222852/851 Tel. No.:- 0120-4329427/
Tel. No.:- 8795839003 4935663 403/471
Saharanpur
Janakipuram, Lucknow Meerut Email ID:- [email protected] Varanasi
Email ID:- [email protected] Email ID:- [email protected] Tel. No.:- 0132-2729751-54 Email ID:- [email protected]
Tel. No.:- 0522-2731510 Tel. No.:- 0121-2604771 Tel. No.:- 0542-2222
Saharanpur (SP)
Moradabad Tel. No.:- 0132-2730920 147/148/149, 2222 153
Janakpuri Bareilly
Saifai Vasundhara Ghaziabad
Tel. No.:- 0581-2300035/ 036/ Tel. No.:- 0591-2410823
/24/25/27,2410827
037/ 039 Tel. No.:- 05688-276115 / Tel. No.:- 0120- 4210120/
Munshi Palia, Lucknow 276114 4209754
Jaunpur (SP)
Tel. No.:- 05452-262001 Salempur Vidhansabha Marg
Tel. No.:- 0522-2719016
Jhansi (SP)
Narepar Uparwar Tel. No.:- 05271-260009
Tel. No.:- 0510-2448832 Vikas Nagar, Lucknow
Sec-77 Noida Email ID:- [email protected]
Kaimganj Tel. No.:- 0522-2738510
Noida Email ID:- [email protected]
Tel. No.:- 05590-230171/ 172/ Sector 110, Noida Vrindavan Yojana, Lucknow
Tel. No.:- 0120-418 7450,
173/ 174 Email ID:- [email protected] Email ID:- [email protected]
418 7451
Tel. No.:- 0120-4571270 Tel. No.:- 0522-2668915
Kakadeo, Kanpur
Noida (Sec 51)
Email ID:- [email protected] Sector 119 Noida Vrindavan, Mathura
Tel. No.:- 0512 -3356000- Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 0120-2485566/
3356015 (16 Lines) Tel. No.:- 0120-6900373 Tel. No.:- 0565-2540123
2480099
269
Uttaranchal Burdwan (SP) Jaigaon (Jaygaon) R N Mukherjee Road, Kolkata
Dehradun Tel. No.:- 03566-265705/ Tel. No.:- 033-22624731/
Email ID:- [email protected] Burra Bazar, Kolkata 265706/265704 33/34/35/36, 22624738
2740522 , 2740433 Tel. No.:- 033-22690171/ 033- Kalimpong Raghunathpur
22690172, 22690161 Email ID:- [email protected] Email ID:- [email protected]
Haldwani
Tel. No.:- 03552-256513/ Tel. No.:- 033-26630313/ 14,
Email ID:- [email protected] Contai
14/15/16 26630311
Tel. No.:- 7579427894 /27536 Email ID:- [email protected]
Tel. No.:- 03220-258970/ Kankurgachi, Kolkata Salt Lake Sec 1 - Kolkata
Haridwar
971/972/973/974 Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 033-23203665-70, Tel. No.:- 033 -23342267/
Tel. No.:- 01334-222311 Dankuni (SP)
23203666 70/71/72/73
Roorkee Tel. No.:- 033-26590039/59
Email ID:- [email protected] Kasba, Kolkata Salt Lake Sec V - Kolkata
Dhupgiri
Tel. No.:- 0133-270073/74 Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 033-24426313/14, Tel. No.:- 033 -40075603/
Rudrapur Tel. No.:- 03563-250086/250032
244263145 604/605/606, 40075607
Email ID:- [email protected] Diamond Harbour
Tel. No.:- 05944-240238/ Katwa Siliguri
39/40/41 Email ID:- [email protected] Email ID:- [email protected]
Tel. No.:- 03174-258584/85,
Tel. No.:- 03453-255554/ Tel. No.:- 0353-2777940/ 41/
258583
West Bengal 53/255625 42/43, 2534474
Alamganj-Burdwan Domjur
Suri
Email ID:- [email protected] Email ID:- [email protected] Kharagpur
Tel. No.:- 0342-2634117/18 Tel. No.:- 033-26705908/09/10 Email ID:- [email protected]
Tel. No.:- 03462-255118/255022
Tel. No.:- 03222-228328/30/31,
Amtala Dunlop, Kolkata 228329 Tamluk
Tel. No.:- 033-24809834/ Tel. No.:- 033-25313372-77 Kolkata
Tel. No.:- 03228-263028
Durgapur Tel. No.:- 033-30212400 / 01 Tarakeshwar
Asansol Email ID:- [email protected] (30 lines) BH - direct Email ID:- [email protected]
Email ID:- [email protected] Tel. No.:- 0343-2545463/ 22896204. Head Ops direct - Tel. No.:- 03212-278220/ 21,
Tel. No.:- 0341-2315665-8, 2545489/ 2545426/ 2545435, 22896205,22896206 278219
2315669 2545425
Kolkata Stock Exchange Offices Abroad
Bagnan G C Avenue
Email ID:- [email protected] Email ID:- [email protected] Abu Dhabi
Tel. No.:- 033-033-2237
Tel. No.:- 03214-266333/34/35. Email: iblabudhabi@
Gariahat 2727/2231 2725
Baishnabghata -Patuli-Kolkata indusindauh.ae, george.babu@
Email ID:- [email protected] Lake Town indusind.com
Tel. No.:- 033-40051578
Tel. No.:- 033-24620132/ 36, Email ID:- [email protected] Tel No: +9712 6660405
/ 40052576 / 40052648/
24620042 Tel. No.:- 033-40056052/ Fax No: +9712 6660406
40052783/ 40051435
55/56/59
Barasat (SP) Ghatal Dubai
Tel. No.:- 033-25840088 Madhyamgram Email: [email protected]
Email ID:- [email protected] and joseph.thomas@indusind.
Barobisha (Bara Bisa) Tel. No.:- 03225-257007/8,
Tel. No.:- 033-2526 7850 /51/53/ com
54, 2526 7852 Tel No.: +971 4 3978803,
Tel. No.:- 03564-263499/03564- Howrah (Haora) +971 4 3978858
263500, 264501 Email ID:- [email protected] Malda Fax No.: +971 4 3978805
Baruipur Tel. No.:- 033-26660028/ Email ID:- [email protected]
Tel. No.:- 03512-265762/ London
Email ID:- [email protected] 47/65/88, 26660016
5769/5887, 265648 Email: sharukh.wadia@
Tel. No.:- 033-24337022
Islampur indusind.com
Bhowanipore, Kolkata Email ID:- [email protected] Prince Anwar Shah, Kolkata Tel. No.:- +442074845586,
Email ID:- [email protected] Tel. No.:- 03526 -255253/ Email ID:- [email protected] +442074845585
Tel. No.:- 033-22870278 254/258/259/261 Tel. No.:- 033-24174796 Fax No.: +442074845100
270
NOTES
271
NOTES
272
To view this Report online, please scan this QR Code
with your camera-enabled smartphone.
If you do not have a QR Code scanner, you may
download the same from your app store.
http://www.indusind.com/content/home/investor/reports-and-presentation/annual-reports.html

22nd Annual Report 2015 16

Uploaded by

Copyright:

Available Formats

22nd Annual Report 2015 16

Uploaded by

Document Information

Original Description:

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

22nd Annual Report 2015 16

Uploaded by

Copyright:

Available Formats

Board of Directors (as at March 31, 2016)

Mr. R. Seshasayee, Chairman

Company Secretary Contents Page No.

Management Discussion & Analysis ......................... 72

Corporate Governance ........................................... 109

Cash Flow Statement .............................................. 144

Schedules ............................................................... 145

Registrar & Share Transfer Agent 6LJQLÀFDQW$FFRXQWLQJ3ROLFLHV............................... 151

5HJLVWHUHG2IÀFH &RUSRUDWH2IÀFH Secretarial & Investor Services

Key Business Highlights

1.81% 1.90% 1.91% 17.48% 18.59% 16.78%

Return on Assets Return on Equity

FY14 FY15 FY16 FY14 FY15 FY16

3.71% 3.65% 3.81% 47.11% 48.09% 47.00%

Net Interest Margin Cost / Income

FY14 FY15 FY16 FY14 FY15 FY16

26.85 33.99 39.68 164.55 189.42 289.40

Earning per Share Book Value per Share

FY14 FY15 FY16 FY14 FY15 FY16

Awards & Accolades

‘Outstanding Achievement in Safety Management’ in the

Romesh Sobti Paul Abraham Suhail Chander Sumant Kathpalia

K. S. Sridhar Arun Khurana S. V. Parthasarathy Ramesh Ganesan

S. V. Zaregaonkar Sanjeev Anand Zubin Mody Sanjay Mallik

Ramaswamy Roopa Satish

The Year That Was

On the social front, the Bank has been very

A Social Banking initiative which offers the

Working towards better

We remained committed to reinforcing the long-term

Brand ‘IndusInd Bank’ Rises

Moving up from the 19th rank to the 13th rank,

Creating History with IndusInd

efforts in Maharashtra. The Bank is devoted to

In 2015, your Bank achieved LEED Gold Rating for

Environment Management was executed on water conservation and its

Solar Energy Financial Inclusion

Water IndusInd Swachh Vidyalaya

Solar Energy Server Power Saving

This year, your Bank supported the following

Operating Profit before Depreciation and Provisions & Contingencies 4,297.94

Performance of Subsidiary and Associate Company

March 31, 2016 March 31, 2015

Employees Stock Option Scheme

Directors’ Responsibility Statement

Particulars of Loans, Guarantees or Investments outstanding

Indian Accounting Standards (IND AS) – IFRS Converged Standards

Corporate Social Responsibility

Related Party Transactions

Management Discussion and Analysis Report

Significant and Material Orders passed by the Regulators or Courts

Awards and Accolades

Policy on Prevention, Prohibition and Redressal of Sexual Harassment of Women at Workplace

For and on behalf of the Board of Directors

Part “A”: Subsidiaries

Part “B”: Associates and Joint Ventures

SECRETARIAL AUDIT REPORT

FOR THE FINANCIAL YEAR ENDED MARCH 31, 2016

For Bhandari & Associates