The Go Campus/ Vira program of Scholarships

Your Gateway to Universities in North America

EMBRACING NORTH AMERICA. CAMPUS CALLS.

Scholarship Awaits
Want to study in the U.S, but find financing is a hurdle? Vira International has joined hands with one of Americas most
renowned campus scholarship assistance companies, Go Campus is here to offer you scholarship solutions. You have
the opportunity to combine the life changing experience of studying at a US campus and the professional benefits of
having a globally recognized degree. The added bonus is that your talent and opportunity may help you add international
work experience to your CV.

Our selective network of partner colleges and universities allows us to locate suitable university options and scholarship
opportunities for our participants, traditionally limited to North American residents. We screen, select and prepare
international students for admissions into North American colleges and universities.

Expertise and Experience The Go Campus

Academic Promise
Vira International, a Go Campus associate, has offices in India and the U.K and has business interests in Interna-
tional Recruitment, Training, in the Hospitality and Healthcare domain and our clients include some of the best and
biggest names in their industry.

Vira International founded in 1970 in India, is registered with the Ministry of We select university options based on each candidate's personal preference for field of study, geographic region, social
Overseas Indian Affairs. The Companys success in recruitment and consultancy for factors, size, prestige, campus life, career goals, religious affiliation and yearly costs.
over four decades with global majors in health care, hospitality, restaurant and food
chains and construction has given it a leading edge in human resources. We work closely with colleges and universities located across the United States and Canada in the development of their
international student body. North American universities understand the value that a multi-cultural student body adds to the
Vira Internationals office in London, offers specialized recruitment and immigration campus community and classroom experience and are, therefore, willing to offer special scholarships to attract Go Campus
advisory services to the hospitality industry throughout the UK and sources talent candidates.
globally for their international clientele.
We select, screen and secure international students for admissions to North American colleges and universities. Our
Our association with Go Campus will prepare students from India and the U.K scholarship opportunities for international students of varying academic and standards are unmatched in the field.
to face the challenges in an increasingly borderless world. And as greater
numbers of students come out of schools and aspire to be among the SCHOLARSHIPS EVERYTHING WE DO IS DRIVEN BY YOU
best talent in their chosen fields, Vira International is there to hold
their hands and guide them to their goal. We guarantee that every Go Campus student will receive nine (9) scholarships. Because of our partnerships we are able to
secure and negotiate the maximum scholarship available.

We appreciate that the admission process is complex and are committed to providing guidance and support to students to
help you make that crucial decision that will have an impact on your future.

Fluency in English is not essential, but we recommend you to prepare for a test on the use of English as a Second Language
(ESL). If you are familiar with the language you need to take a test of English as a Foreign Language (TOEFL).

We will try our best to offer you a choice of location, but this cannot be guaranteed.

There is absolutely no financial risk to students who apply through us for the Go Campus program. If we cannot provide nine
options, a full refund is provided.

When you apply through Go Campus, we ensure help at every stage of the scholarship application process, saving you
costs and time. We track your application and ensure that you are informed in advance of each development.

THINK SMART THINK U.S. CAMPUS

select, screen and secure
 Campus Life - The Heart of America Our Scholarship Guarantee
Campus life is much more than studies. Theres as much activity outside the classroom as in class. Your learning is For years, studying in the U.S. has been portrayed as expensive and out of reach for many. However, due to our
holistic and colleges encourage you to take active part in sports, social and cultural activities and who knows, you network and association with Go Campus we can GUARANTEE that you will receive at least NINE scholarships or
may even edit a newsletter or lead a theater group. Study is important, so is your personal development. you receive a full refund on our fee. You will also discover that in many cases it will be a lower cost option than
studying in the U.K, Europe, Australia or other countries across the world.
Living on campus in residence halls and apartments exposes students to a mini world of international culture,
cuisine, lifestyles and practices. Student communities in the U.S. are known for their friendliness and eagerness to Only the Best is Good Enough
help new entrants and help them adjust to a strange new world. This builds confidence and creates an atmosphere
that acts as a catalyst for learning and growth. The schools we have previously obtained scholarships have had a total annual cost (before scholarships) ranging
from between USD $16,000 to $45,000 including tuition, housing, and food.
USA - Land of Opportunities
Endless Possibilities
America is a dream for every student wanting high quality education and a student life that fosters academic, profes-
sional and personal development. The country is known to welcome immigrants with open hands and recognizes that You can be a part of a unique, wholly American experience and choose your academic goal, experiment with your
talent, innovation and hard work have been the hallmarks of the country. U.S.A is the preferred study destination for creative and intellectual talent and do what motivates and brings out the best in you. Universities have a diverse,
international students. committed faculty and a stimulating educational environment. Degrees from American universities open windows to
a variety of rewarding and challenging careers.
HIGHER STANDARDS

Global Edge
The U.S.A has more academic institutions of higher education than any other country in the world and that is just one
of its many advantages. American undergraduate and graduate schools encourage and actively practice a culture
that builds character, develops ones personality and prepares students for the professional challenges in their
careers.

THE U.S. IS READY

WHEN YOU ARE

Tomorrow Beckons
Most students who finish graduation in the U.S. prefer to do a Masters
degree over a PhD, because it offers them flexibility of programs and the
ability to finish the course in a limited time.
You have a wide range of degree programs in several subjects. U.S. universi-
ties offer a balance of academic and practical knowledge, global employment Masters degrees are awarded for professional courses in a variety of
opportunities and unmatched research and technological platforms. subjects and open up new avenues for careers in several occupations.
Masters can be obtained for academic courses like Arts as well as
practical courses, like Performing Arts.
Real Learning
If you're planning to pursue further education in the United States, but are limited by time and/or finances,
Many of the professors at these schools are leaders in their academic fields. a Master's degree may be a great choice for you. There are many programs to choose from and if you require
Add to this a visiting faculty that ranges from Presidents and Prime Ministers to business leaders, scientists and financial help and guidance Go Campus is always there to help with a scholarship guarantee and other
philosophers, gives you an eclectic blend of the best of academic and practical expertise from across the world. You assistance.
will receive excellent support from peers, professors and the rest of the administrative machinery. And all this begins
even before you arrive!
 LET YOUR DREAMS LEAD YOU
Choose from many locations the U.S. and Canada

Go Campus works with colleges and universities throughout the United States and Canada. We are able to
choose the best for you as we understand your preferences and are able to pick schools that are the nearest
match for your personality and career goals.

Most of our partner schools have obtained recognitions and awards from the following organizations: The
Princeton Review: Best Colleges, US News and World Report: Americas Best Colleges, The Templeton Guide:
Colleges That Encourage Character Development, The Barron's 300: Best Buys in College Education, & CLA
Learning Report.

Whether you are in New York or San Francisco or at a university deep in the heart of America, Campus life is
exciting, fun, full of learning and an experience that you will cherish.

The map highlights the locations where

Go Campus students have received scholarships:
Colleges and universities are different only in terms of size and
variety of courses they offer, but the quality of education is
uniformly high. Several colleges can be located in a university
campus enabling students to move within the campus to
pursue their studies.

Athletics
Go Campus takes great pride that it is able to assist keen
Athletes who strive for excellence in the classroom and on the
field, gain scholarships for entry in US universities.

Our Athletic Department's goal is to develop and maintain an athletic program that graduates student upon a
special request, Go Campus provides its partner institutions' athletic departments access to a group of amateur
quality athletes wishing to pursue their undergraduate education while participating on the university varsity
teams.
University leagues and each particular institution have specific rules governing eligibility and participation
in intercollegiate athletics. Go Campus closely works with its partner institutions' athletic departments
to determine and oversee student-athlete eligibility.
Who can apply?
Men and women sports included in the program are:
Soccer,Tennis, Basketball The Go Campus program criteria:

The
Golf, Track and field, Swimming
 5VWFGPVUOWUVDGDGVYGGPCPF[GCTUQNF
 5VWFGPVUUJQWNFJCXGEQORNGVGFQTKPVJGHKPCN[GCTQH#.GXGN*KIJ5EJQQN
 )Q%CORWUCNUQCEEGRVUUVWFGPVUYJQJCXGGPTQNNGFQTEQORNGVGFVJGKTDCEJGNQTUFGITGG

Campus
We do not insist that students have a brilliant academic performance, but we will need a
detailed CV outlining your strengths and achievements in academic and extra curricular
fields.

dream American universities accept applications for admissions for

semester beginning in August (Fall) or January (Summer).

remains unchanged!
 WIN WIN
Compare Costs
There are considerable costs involved in completing a degree. However, Go Campus scholar-

The Application Process

ships can make the cost of studying in the USA much more affordable. When we provide you
with a scholarship report the cost you will receive will include all of the following, which helps
when budgeting:

 6WKVKQP
NGUUQPUVGCEJKPICFOKPKUVTCVKXGUWRRQTVWUGQHRTGOKUGUHCEKNKVKGU 
A Step-by-Step guide 
materials and infrastructures);
*QWUKPI
IGPGTCNN[QPECORWU
 (QQF
COGCNRNCP
Student completes basic application: [$600. If for any reason a full
scholarship report cannot be provided or we will not be able to accept you
The Go Campus Academic Program commits to generate a minimum of Nine (9) scholarship
on the program, this will be refunded.]
offers including:
 2GTUQPCNKPVGTXKGYCPFEQWPUGNNKPI
 /KPKOWOQHQPG
UEJQNCTUJKRYKVJ[GCTN[EQUVHQTVJGUVWFGPVDGKPIDGNQY 
$12,000 (inc. tuition, housing and meals).
 %TGCVKPICEWUVQOK\GFRTQHKNGCHVGT[QWJCXGCEEGRVGFVJGVGTOU6QJGNR
 /KPKOWOQHVYQ
UEJQNCTUJKRUYKVJ[GCTN[EQUVVQVJGUVWFGPVDGKPIDGNQY 
you gain the best possible scholarships.
$16,000 (inc. tuition, housing and meals).
 /KPKOWOQHVYQ
UEJQNCTUJKRUEQXGTKPIQTOQTGQHVJGVQVCNEQUVU
 5GPFKPI[QWTCECFGOKEHKNGVQUGNGEVWPKXGTUKVKGU
including tuition, housing, and meals.
 +PVTQFWEKPI[QWTRTQHKNGCPFGPCDNKPIEQPVCEVYKVJVJGWPKXGTUKVKGU 
Costs not included in scholarship: transportation, health insurance and books.
admission departments by Go Campus College Relations Department in
the U.S.
)Q%CORWU(GG
 'CEJWPKXGTUKV[GXCNWCVGUVJGCRRNKECPVCPFFGVGTOKPGUVJGSWCPVWOQH
scholarship.
Go Campus levies a one-time fee for enrolment in the Guaranteed Scholarship program. You
could save considerable sums of money depending on your college, option of scholarship and
 +PHQTOKPIVJGRCTVKEKRCPVCDQWVRGTUQPCNUEJQNCTUJKRQHHGTKPIU 
financial goals. You will be in the trusted care of Go Campus. Unlike many educational consul-
(Scholarship Report).
tants or agencies, we never receive commission for student placement and all the financial
benefits are sent directly to you.
 &GEKUKQPD[VJGUVWFGPV
Graduate Level MBA Programs
 $GIKPPKPIVJGWPKXGTUKV[CFOKUUKQPRTQEGUU
Students looking to complete an MBA program in North America will be evaluated on a case-
 #UUKUVCPEGKPQDVCKPKPIVJG+FQEWOGPVCPFIWKFCPEGKPQDVCKPKPIVJG
by-case basis. Our participants receive an average of three scholarship offers from three differ-
 UVWFGPVUXKUC
ent institutions. Annual costs, after the scholarships, are sometimes as low as $17,000 per
academic year including housing, meals, and studies. Some scholarships cover significant
 &GRCTVWTGVQVJG75
percentages of the costs of studies and are maintained for the duration of the academic career,
unless there are disciplinary problems or poor academic performance.
REALITY CHECK
+VU6QWIJDWV)Q%CORWUOCMGUKV'CU[
If American universities are so difficult to get into and so expensive, why and how do half a million
students enroll every year in the U.S. and Canadian colleges every year. Thats because they offer high
quality education, enriching campus and life experiences and because Go Campus (and their associ-
ates Vira International) make it affordable.

Go Campus will make your dream come true as we guarantee scholarship that will make your study fit
into your budget. Our scholarships include tuition fees, room accommodation and board. We make sure
the amount of credit hours included in the package allows undergraduate students to graduate in four
years, and graduate applicants to graduate in two years.

If you have the inclination, the skills and the opportunity, working on campus is a real possibility. While
we do not guarantee a job position, a number of positions for work do come.

(QT2CTGPVUI safety and cohesive environment

We understand your anxieties about your son/daughters ability to adjust to an entirely new academic
and cultural experience. Teenagers will learn and imbibe through peer support and gain in confidence
emotionally and physically. Independence and separation fosters an entirely different attitude and
responsibility that comes with growing up.

You can choose from the following main field of studies offered by American Universities. You can

CAMPUS
study any of these as a Go Campus student and can also request that your list includes schol-
arship offers for more specific subjects such as those found in this attachment. ( Please
visit our website or request further information from your counsellor!)

CALLING
Are you interested
in completing a semester, year or a full bachelors
or masters degree program in the USA?
Contact us to begin the experience of a lifetime.

UK Office

Vira International Ltd.

Vyman House
104 College Road
Harrow
Middx HA1 1BQ
United Kingdom

T: 0870 9909007
E: [email protected]

Vira International
VJ(NQQT6YKP#TECFG%
Military Road Marol, Andheri E
Mumbai 400 059
India

6 
.KPGU
E: [email protected]