0% found this document useful (0 votes)
269 views115 pages

Pruim 2011 Computational Statistics Using R and R Studio

Computational Statistics Using r and r Studio

Uploaded by

Puthpura Puth
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
269 views115 pages

Pruim 2011 Computational Statistics Using R and R Studio

Computational Statistics Using r and r Studio

Uploaded by

Puthpura Puth
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 115

Computational Statistics Using R and R Studio

An Introduction for Scientists

Randall Pruim

SC 11 Education Program (November, 2011)


Contents

1 An Introduction to R 8

1.1 Welcome to R and RStudio . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8

1.2 Using R as a Calculator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9

1.3 R Packages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10

1.4 Getting Help . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12

1.5 Data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13

1.6 Summarizing Data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

1.7 Additional Notes on R Syntax . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30

1.8 Installing R . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31

1.9 R Examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33

1.10 Exercises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34

2 Getting Interactive with manipulate 37

2.1 Simple Things . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37

3 A Crash Course in Statistics for Biologists (and Their Friends) 40

3.1 Why Use R? . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40

3.2 Computational Statistics: Where Are All The Formulas? . . . . . . . . . . . . . . . . . 41

3.3 Three Illustrative Examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42

3.4 The Multi-World Metaphor for Hypothesis Testing . . . . . . . . . . . . . . . . . . . . 53

3.5 Taking Randomness Seriously . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65

2
3

3.6 Exercises, Problems, and Activities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70

4 Some Biology Specific Applications of R 71

4.1 Working With Sequence Data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71

4.2 Obtaining Sequence Data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75

4.3 Sequence Alignment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79

5 Taking Advantage of the Internet 85

5.1 Sharing With and Among Your Students . . . . . . . . . . . . . . . . . . . . . . . . . . 85

5.2 Data Mining Activities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90

A More About R 94

A.1 Installing and Using Packages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94

A.2 Some Workflow Suggestions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

A.3 Working with Data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96

A.4 Primary R Data Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99

A.5 More About Vectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102

A.6 Manipulating Data Frames . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106

A.7 Functions in R . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


About These Notes

These materials were prepared for the SC 11 Education Program held in Seattle in November 2011.
Much of the material is recycled from two workshops:

Teaching Statistics Using R, a workshop conducted prior to the May 2011 United States Con-
ference on Teaching Statistics.
You can find out more about this workshop at http://mosaic-web.org/uscots2011/.
Computational Science for Biology Educators, an SC11 workshop held at Calvin College in June
2011.
You can find out more about this workshop at http://www.calvin.edu/isri/sc11/

The activities and examples in these notes are intended to highlight a modern approach to statistics and
statistics education that focuses on modeling, resampling based inference, and multivariate graphical
techniques.

These notes contain far more than will be covered in the workshop, so they can serve as a reference
for those who want to learn more. For still more reference material, see the above mentioned notes at
http://mosaic-web.org/uscots2011/.

R and R Packages

R can be obtained from http://cran.r-project.org/. Download and installation are pretty straight-
forward for Mac, PC, or linux machines.

In addition to R, we will make use of several packages that need to be installed and loaded separately.
The mosaic package (and its dependencies) will be assumed throughout. Other packages may appear
from time to time, including

fastR: companion to Foundations and Applications of Statistics by R. Pruim


abd: companion to Analysis of Biological Data by Whitlock and Schluter
vcd: visualizing categorical data

We also make use of the lattice graphics package which is installed with R but must be loaded before
use.

4
5

RStudio

RStudio is an alternative interface to R. RStudio can be installed as a desktop (laptop) application or


as a server application that is accessible to others via the Internet. RStudio is available from
http://www.rstudio.org/

Calvin has provided accounts for Education Program participants on an RStudio server at
http://dahl.calvin.edu:8787

There are some things in these notes (in particular those using manipulate()) that require the RStudio
interface to R. Most things should work in any flavor of R.

Marginal Notes
Digging Deeper
Many marginal
Marginal notes appear here and there. Sometimes these are side comments that we wanted to say, notes will look like
but didnt want to interrupt the flow to mention. These may describe more advanced features of the this one.
language or make suggestions about how to implement things in the classroom. Some are warnings
to help you avoid common pitfalls. Still others contain requests for feedback.
Caution!
But warnings are set
differently to make
sure they catch your
Document Creation attention.

Suggestion Box
This document was created November 13, 2011, using Sweave and R version 2.13.1 (2011-07-08). So, do you like hav-
Sweave is Rs system for reproducible research and allows text, graphics, and R code to be intermixed ing marginal notes
and produced by a single document. in these notes?

Digging Deeper
If you know LATEX
as well as R, then
Sweave provides a
nice solution for
mixing the two.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


Project MOSAIC

The USCOTS11 workshop was developed by Project MOSAIC. Project MOSAIC is a community
of educators working to develop new ways to introduce mathematics, statistics, computation, and
modeling to students in colleges and universities.

The purpose of the MOSAIC project is to help us share ideas and resources to improve teaching, and
to develop a curricular and assessment infrastructure to support the dissemination and evaluation of
these ideas. Our goal is to provide a broader approach to quantitative studies that provides better
support for work in science and technology. The focus of the project is to tie together better diverse
aspects of quantitative work that students in science, technology, and engineering will need in their
professional lives, but which are today usually taught in isolation, if at all.

In particular, we focus on:

Modeling The ability to create, manipulate and investigate useful and informative mathematical
representations of a real-world situations.

Statistics The analysis of variability that draws on our ability to quantify uncertainty and to draw
logical inferences from observations and experiment.

Computation The capacity to think algorithmically, to manage data on large scales, to visualize
and interact with models, and to automate tasks for efficiency, accuracy, and reproducibility.

Calculus The traditional mathematical entry point for college and university students and a subject
that still has the potential to provide important insights to todays students.

Drawing on support from the US National Science Foundation (NSF DUE-0920350), Project MOSAIC
supports a number of initiatives to help achieve these goals, including:

Faculty development and training opportunities, such as the USCOTS 2011 workshop and our
2010 gathering at the Institute for Mathematics and its Applications.

M-casts, a series of regularly scheduled seminars, delivered via the Internet, that provide a forum for
instructors to share their insights and innovations and to develop collaborations to refine and
develop them. A schedule of future M-casts and recordings of past M-casts are available at the
Project MOSAIC web site, http://mosaic-web.org.

6
7

The development of a concept inventory to support teaching modeling. It is somewhat


rare in todays curriculum for modeling to be taught. College and university catalogs are filled
with descriptions of courses in statistics, computation, and calculus. There are many textbooks
in these areas and the most new faculty teaching statistics, computation, and calculus have a
solid idea of what should be included. But modeling is different. Its generally recognized as
important, but few if instructors have a clear view of the essential concepts.

The construction of syllabi and materials for courses that teach the MOSAIC topics in a better
integrated way. Such courses and materials might be wholly new constructions, or they might
be incremental modifications of existing resources that draw on the connections between the
MOSAIC topics.

We welcome and encourage your participation in all of these initiatives.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


8 An Introduction to R

An Introduction to R
1
This is a lightly modified version of a handout RJP used with his Intro Stats students
Spring 2011. Aside from the occasional comment to instructors, this chapter could be used
essentially as is with students.

1.1 Welcome to R and RStudio

R is a system for statistical computation and graphics. We use R for several reasons:

1. R is open-source and freely available for Mac, PC, and Linux machines. This means that there
is no restriction on having to license a particular software program, or have students work in a
specific lab that has been outfitted with the technology of choice.
2. R is user-extensible and user extensions can easily be made available to others.
3. R is commercial quality. It is the package of choice for many statisticians and those who use
statistics frequently.
4. R is becoming very popular with statisticians and scientists, especially in certain sub-disciplines,
like genetics. Articles in research journals such as Science often include links to the R code used
for the analysis and graphics presented.
5. R is very powerful. Furthermore, it is gaining new features every day. New statistical methods
are often available first in R.

RStudio provides access to R in a web browser. This has some additional advantages: no installation is
required, the interface has some additional user-friendly components, and work begun on one machine
can be picked up seamlessly later on somewhere else.

The URL for the RStudio server on Calvins supercomputer is

http://dahl.calvin.edu:8787

It is also possible to download RStudio server and set up your own server or RStudio desktop for
stand-alone processing.

Once you have logged in to an RStudio server, you will see something like Figure 1.1.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 9

Figure 1.1: Welcome to RStudio.

Notice that RStudio divides its world into four panels. Several of the panels are further subdivided
into multiple tabs. RStudio offers the user some control over which panels are located where and which
tabs are in which panels, so you initial configuration might not be exactly like the one illustrated here.
The console panel is where we type commands that R will execute.

1.2 Using R as a Calculator

R can be used as a calculator. Try typing the following commands in the console panel.
> 5 + 3
[1] 8
> 15.3 * 23.4
[1] 358 Teaching Tip
Its probably best
> sqrt(16) to settle on using
[1] 4 one or the other
of the right-to-left
assignment oper-
You can save values to named variables for later reuse. ators rather than
> product = 15.3 * 23.4 # save result to switch back
> product # show the result and forth. In this
document, we will
[1] 358 primarily use the
> product <- 15.3 * 23.4 # <- is assignment operator, same as = arrow operator.
> product
[1] 358
> 15.3 * 23.4 -> newproduct # -> assigns to the right
> newproduct
[1] 358

Once variables are defined, they can be referenced with other operators and functions.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


10 An Introduction to R

> .5 * product # half of the product


[1] 179
> log(product) # (natural) log of the product
[1] 5.881
> log10(product) # base 10 log of the product
[1] 2.554
> log(product, base=2) # base 2 log of the product
[1] 8.484

The semi-colon can be used to place multiple commands on one line. One frequent use of this is to
save and print a value all in one go:
> 15.3 * 23.4 -> product; product # save result and show it
[1] 358

Four Things to Know About R

1. R is case-sensitive
Teaching Tip If you mis-capitalize something in R it wont do what you want.
To help students get
the hang of func-
tion arguments, ask 2. Functions in R use the following syntax:
them What informa-
tion does the com-
> functionname( argument1, argument2, ... )
puter need to com- The arguments are always surrounded by (round) parentheses and separated by commas.
pute this?
Some functions (like data()) have no required arguments, but you still need the parenthe-
ses.
If you type a function name without the parentheses, you will see the code for that function
(this probably isnt what you want at this point).

3. TAB completion and arrows can improve typing speed and accuracy.
If you begin a command and hit the TAB key, RStudio will show you a list of possible ways
to complete the command. If you hit TAB after the opening parenthesis of a function, it will
Caution! show you the list of arguments it expects. The up and down arrows can be used to retrieve past
Your students will
sometimes find
commands.
themselves in a
syntactic hole from 4. If you see a + prompt, it means R is waiting for more input.
which they cannot
dig out. Teach them Often this means that you have forgotten a closing parenthesis or made some other syntax error.
about the ESC key If you have messed up and just want to get back to the normal plot, hit the escape key and start
early.
the command fresh.

1.3 R Packages

In addition to its core features, R provides many more features through a (large) number of packages.
To use a package, it must be installed (one time), and loaded (each session). A number of packages are
already available in RStudio. The Packages tab in RStudio will show you the list of installed packages
and indicate which of these are loaded.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 11

Here are some packages we will use frequently:


Caution!
fastR (a package with some nice utilities; available on CRAN) You should load
these packages when
working through
lattice (for graphics; this will always be installed in R) these notes or you
may get different
mosaic (for teaching statistics; this will need to be installed in R from CRAN, see section 1.8.3) behavior. If you are
using the RStudio
Hmisc (a package with some nice utilities; available on CRAN) server via the web,
your session will
persist even if you
Since fastR requires the others in this list, it suffices to load that one package and others will load logout or switch
automatically. You can do this by checking the appropriate box in the packages tab or at the command browsers, so you
wont have to do
line using this each time you
> library(fastR) come back. If you
run a stand alone
version of R you
or may.
> require(fastR)

There are other packages that we use from time to time as well.

You should install Hmisc and mosaic the first time you use R. Once a package is installed, it is available
to be loaded in the current or any future session. You can install these packages by clicking on the
Install Package button in RStudio and following the directions or by using the following command:
> install.packages('Hmisc') # note the quotation marks
> install.packages('mosaic') # note the quotation marks

Once these are installed, you can load them by checking the box in the Packages tab or by using
require() (or library())
> require(lattice) # could also use library(lattice)
> require(Hmisc) # do this one before mosaic
> require(mosaic) # do this one after Hmisc

To speed things up,

All the packages used here have been pre-installed on dahl and pre-loaded on the loaner laptops.
(But we recommend that you give the web-based version of RStudio a try rather than using the
local version on the laptops.)

If you want to install these packages on your own machine, you can get them all in one go using
the command
> source("http://www.calvin.edu/~rpruim/talks/SC11/SC11-packages.R")

This may take a few minutes to complete.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


12 An Introduction to R

1.4 Getting Help

If something doesnt go quite right, or if you cant remember something, its good to know where to
turn for help. In addition to asking your friends and neighbors, you can use the R help system.

1.4.1 ?

To get help on a specific function or data set, simply precede its name with a ?:
> ?col.whitebg()

1.4.2 apropos()

If you dont know the exact name of a function, you can give part of the name and R will find all
functions that match. Quotation marks are mandatory here.
> apropos('hist') # must include quotes. single or double.
[1] "event.history" "hist"
[3] "hist.data.frame" "hist.default"
[5] "hist.FD" "hist.scott"
[7] "histbackback" "histochart"
[9] "histogram" "histogram"
[11] "history" "histSpike"
[13] "ldahist" "loadhistory"
[15] "panel.histogram" "panel.xhistogram"
[17] "pmfhistogram" "prepanel.default.histogram"
[19] "savehistory" "truehist"
[21] "xhistogram" "xhistogram"

1.4.3 ?? and help.search()

If that fails, you can do a broader search using ?? or help.search(), which will find matches not
only in the names of functions and data sets, but also in the documentation for them.
> ??histogram # any of these will work
> ??"histogram"
> ??'histogram'
> help.search('histogram')

1.4.4 Examples and Demos

Many functions and data sets in R include example code demonstrating typical uses. For example,
> example(histogram)
Not all package
authors are equally
skilled at creating will generate a number of example plots (and provide you with the commands used to create them).
examples. Some Examples such as this are intended to help you learn how specific R functions work. These examples
of the examples also appear at the end of the documentation for functions and data sets.
are next to useless,
others are excellent. The mosaic package (and some other packages as well) also includes demos. Demos are bits of R code
that can be executed using the demo() command with the name of the demo.

To see how demos work, give this a try:

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 13

> demo(histogram)

Demos are intended to illustrate a concept, a method, or some such thing, and are independent of any
particular function or data set.

You can get a list of available demos using


> demo() # all demos
> demo(package='mosaic') # just demos from mosaic package

1.5 Data

1.5.1 Data in Packages

Many packages contain data sets. You can see a list of all data sets in all loaded packages using
> data()

Typically (provided the author of the package allowed for lazy loading of data) you can use data sets
by simply typing their names. But if you have already used that name for something or need to refresh
the data after making some changes you no longer want, you can explicitly load the data using the
data() function with the name of the data set you want.
> data(iris)

1.5.2 Data Frames

Data sets are usually stored in a special structure called a data frame.

Data frames have a 2-dimensional structure.


Rows correspond to observational units (people, animals, plants, or other objects we
are collecting data about).
Columns correspond to variables (measurements collected on each observational unit).

Well talk later about how to get your own data into R. For now well use some data that comes with
R and is all ready for you to use. The iris data frame contains 5 variables measured for each of
150 iris plants (the observational units). The iris data set is included with the default R installation.
(Technically, it is located in a package called datasets which is always available.)

There are several ways we can get some idea about what is in the iris data frame.
> str(iris)
'data.frame': 150 obs. of 5 variables:
$ Sepal.Length: num 5.1 4.9 4.7 4.6 5 5.4 4.6 5 4.4 4.9 ...
$ Sepal.Width : num 3.5 3 3.2 3.1 3.6 3.9 3.4 3.4 2.9 3.1 ...
$ Petal.Length: num 1.4 1.4 1.3 1.5 1.4 1.7 1.4 1.5 1.4 1.5 ...
$ Petal.Width : num 0.2 0.2 0.2 0.2 0.2 0.4 0.3 0.2 0.2 0.1 ...
$ Species : Factor w/ 3 levels "setosa","versicolor",..: 1 1 1 1 1 1 1 1 1 1 ...

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


14 An Introduction to R

> summary(iris)
Sepal.Length Sepal.Width Petal.Length Petal.Width Species
Min. :4.30 Min. :2.00 Min. :1.00 Min. :0.1 setosa :50
1st Qu.:5.10 1st Qu.:2.80 1st Qu.:1.60 1st Qu.:0.3 versicolor:50
Median :5.80 Median :3.00 Median :4.35 Median :1.3 virginica :50
Mean :5.84 Mean :3.06 Mean :3.76 Mean :1.2
3rd Qu.:6.40 3rd Qu.:3.30 3rd Qu.:5.10 3rd Qu.:1.8
Max. :7.90 Max. :4.40 Max. :6.90 Max. :2.5
> head(iris)
Sepal.Length Sepal.Width Petal.Length Petal.Width Species
1 5.1 3.5 1.4 0.2 setosa
2 4.9 3.0 1.4 0.2 setosa
3 4.7 3.2 1.3 0.2 setosa
4 4.6 3.1 1.5 0.2 setosa
5 5.0 3.6 1.4 0.2 setosa
6 5.4 3.9 1.7 0.4 setosa

In interactive mode, you can also try


> View(iris)

to see the data or


> ?iris

to get the documentation about for the data set.

Access to an individual variable in a data frame uses the $ operator in the following syntax:
> dataframe$variable

or
> with(dataframe, variable)

For example, either of


> iris$Sepal.Length

or
> with(iris, Sepal.Length)

shows the contents of the Sepal.Length variable in the following format.


[1] 5.1 4.9 4.7 4.6 5.0 5.4 4.6 5.0 4.4 4.9 5.4 4.8 4.8 4.3 5.8 5.7 5.4 5.1 5.7 5.1
[21] 5.4 5.1 4.6 5.1 4.8 5.0 5.0 5.2 5.2 4.7 4.8 5.4 5.2 5.5 4.9 5.0 5.5 4.9 4.4 5.1
[41] 5.0 4.5 4.4 5.0 5.1 4.8 5.1 4.6 5.3 5.0 7.0 6.4 6.9 5.5 6.5 5.7 6.3 4.9 6.6 5.2
[61] 5.0 5.9 6.0 6.1 5.6 6.7 5.6 5.8 6.2 5.6 5.9 6.1 6.3 6.1 6.4 6.6 6.8 6.7 6.0 5.7
[81] 5.5 5.5 5.8 6.0 5.4 6.0 6.7 6.3 5.6 5.5 5.5 6.1 5.8 5.0 5.6 5.7 5.7 6.2 5.1 5.7
[101] 6.3 5.8 7.1 6.3 6.5 7.6 4.9 7.3 6.7 7.2 6.5 6.4 6.8 5.7 5.8 6.4 6.5 7.7 7.7 6.0
[121] 6.9 5.6 7.7 6.3 6.7 7.2 6.2 6.1 6.4 7.2 7.4 7.9 6.4 6.3 6.1 7.7 6.3 6.4 6.0 6.9
[141] 6.7 6.9 5.8 6.8 6.7 6.7 6.3 6.5 6.2 5.9

But this isnt very useful for a large data set. We would prefer to compute numerical or graphical
summaries. Well do that shortly.

Caution! The attach() function in R can be used to make objects within dataframes accessible in R with
Avoid the use of at- fewer keystrokes, but we strongly discourage its use, as it often leads to name conflicts. The Google
tach(). R Style Guide (http://google-styleguide.googlecode.com/svn/trunk/google-r-style.html)
echoes this advice, stating that The possibilities for creating errors when using attach are numerous.
Avoid it. It is far better to directly access variables using the \$ syntax or to use the with() function.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 15

1.5.3 Using Your Own Data

RStudio will help you import your own data. To do so use the Import Dataset button in the
Workspace tab. You can load data from text files, from the web, or from google spreadsheets.

Using read.csv() and read.table()

If you are not using RStudio, or if you want to automate the loading of data from files, instead of using
the RStudio menus, you can read files using read.csv() or read.table() (for white space delimited
files). The mosaic package includes a function called read.file() that uses slightly different default
load()
settings and infers whether it should use read.csv(), read.table(), or load() based on the file load() is used for
name. opening files that
store R objects in
Each of these functions also accepts a URL in place of a file name, which provides an easy way to native format.
distribute data via the Internet:
> births <- read.table('http://www.calvin.edu/~rpruim/data/births.txt', header=TRUE)
> head(births) # number of live births in the US each day of 1978.
date births datenum dayofyear
1 1/1/78 7701 6575 1
2 1/2/78 7527 6576 2
3 1/3/78 8825 6577 3
4 1/4/78 8859 6578 4
5 1/5/78 9043 6579 5
6 1/6/78 9208 6580 6

The mosaic package provides read.file() which attempts to infer the file type from its extension
and then applies read.csv(), read.table(), or load().
> births <- read.file('http://www.calvin.edu/~rpruim/data/births.txt')

It also sets a number of defaults, including header=TRUE.

Using RStudio Server menus

This is a two step process.

1. Get the file onto the server.


Upload (in the Files tab) your csv file to the server, where you can create folders and store files
in your personal account.

2. Load the data from the server into your R session.


Now import from a text file in the Workspace tab.

In either case, be sure to do the following:

Choose good variables names.

Put your variables names in the first row.

Use each subsequent row for one observational unit.

Give the resulting data frame a good name.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


16 An Introduction to R

From Google

In the beta version of RStudio, this was super easy: Just click, select your spreadsheet, choose a name,
and youre done. Eventually, this functionality will come to the publicly available server version.

For the time being, in the publicly released version, you need to get Google to tell you the URL for
the csv feed of your data (see
http://blog.revolutionanalytics.com/2009/09/how-to-use-a-google-spreadsheet-as-data-in-r.html

for instructions if you dont know how), and then you can read the data using read.csv() using that
URL in place of the filename.

1.6 Summarizing Data

1.6.1 A Few Numerical Summaries

R includes functions that compute a wide range of numerical and graphical summaries. Most of the
numerical summaries already familiar to you have obvious names. Here are a few examples.
> mean(iris$Sepal.Length)
mean
5.843
> with(iris, mean(Sepal.Length))
mean
5.843
> # this syntax is provided by the mosaic package for a few frequently used summaries
> mean(Sepal.Length, data=iris)
[1] 5.843

> with(iris, median(Sepal.Length)) # or median(iris$Sepal.Length)


median
5.8
> with(iris, quantile(Sepal.Length)) # or quantile(iris$Sepal.Length)
0% 25% 50% 75% 100%
4.3 5.1 5.8 6.4 7.9
> with(iris, IQR(Sepal.Length)) # or IQR(iris$Sepal.Length)
[1] 1.3

The favstats() function in the mosaic package computes several numerical summaries all at once.
> require(mosaic) # if you haven't already loaded the mosaic package
> favstats(iris$Sepal.Length)
min Q1 median Q3 max mean sd n missing
4.3 5.1 5.8 6.4 7.9 5.843 0.8281 150 0

Heres something a little fancier.


> require(Hmisc) # this should already be loaded from earlier, right?
> summary(Sepal.Length ~ Species, data=iris, fun=favstats)
Sepal.Length N=150

+-------+----------+---+----+-----+-------+---+----+-----+------+---+--------+
| | |N |min |Q1 |median |Q3 |max |mean |sd |n |missing |

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 17

+-------+----------+---+----+-----+-------+---+----+-----+------+---+--------+
|Species|setosa | 50|4.3 |4.800|5.0 |5.2|5.8 |5.006|0.3525| 50|0 |
| |versicolor| 50|4.9 |5.600|5.9 |6.3|7.0 |5.936|0.5162| 50|0 |
| |virginica | 50|4.9 |6.225|6.5 |6.9|7.9 |6.588|0.6359| 50|0 |
+-------+----------+---+----+-----+-------+---+----+-----+------+---+--------+
|Overall| |150|4.3 |5.100|5.8 |6.4|7.9 |5.843|0.8281|150|0 |
+-------+----------+---+----+-----+-------+---+----+-----+------+---+--------+

The mosaic package also allows the following type of summary for mean, median, standard deviation,
variance, and a few other key numerical summaries.
> mean( Sepal.Length ~ Species, data=iris )
Species S N Missing
1 setosa 5.006 50 0
2 versicolor 5.936 50 0
3 virginica 6.588 50 0
> median( Sepal.Length ~ Species, data=iris )
Species S N Missing
1 setosa 5.0 50 0
2 versicolor 5.9 50 0
3 virginica 6.5 50 0
> sd( Sepal.Length ~ Species, data=iris )
Species S N Missing
1 setosa 0.3525 50 0
2 versicolor 0.5162 50 0
3 virginica 0.6359 50 0

1.6.2 Lattice Graphics

There are several ways to make graphs in R. One approach is a system called lattice graphics. The
first step for using lattice is to load the lattice package using the check box in the Packages tab
or using the following command:
> require(lattice)

lattice plots make use of a formula interface:


> plotname( y ~ x | z, data=dataname, groups=grouping_variable, ...)

Here are the names of several lattice plots:


histogram (for histograms)
bwplot (for boxplots)
xyplot (for scatter plots)
qqmath (for quantile-quantile plots)
x is the name of the variable that is plotted along the horizontal (x) axis.
y is the name of the variable that is plotted along the vertical (y) axis. (For some plots, this
slot is empty because R computes these values from the values of x.)
z is a conditioning variable used to split the plot into multiple subplots called panels.
grouping_variable is used to display different groups differently (different colors or symbols,
for example) within the same panel.
... There are many additional arguments to these functions that let you control just how the
plots look. (But well focus on the basics for now.)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


18 An Introduction to R

1.6.3 Histograms: histogram()

Lets switch to a more interesting data set from the Health Evaluation and Linkage to Primary Care
study. The HELP study was a clinical trial for adult inpatients recruited from a detoxification unit.
Patients with no primary care physician were randomized to receive a multidisciplinary assessment
and a brief motivational intervention or usual care, with the goal of linking them to primary medical
care. You can find out more about this data using Rs help
> ?HELP

Histograms display a distribution using the important idea the

AREA = relative frequency

So where there is more area, there is more data. For a historam, rectangles are used to indicate how
much data are in each of several bins. The result is a picture that shows a rough shape of the
distribution.

The y component of the formula is empty since we let R compute the heights of the bars for us.

> histogram(~ age, data=HELP, n=20) # n= 20 gives approx. 20 bars


Percent of Total

15

10

20 30 40 50 60

age

We can use a conditional variable to give us separate histograms for each sex.

> histogram(~ age | sex, data=HELP, n=20)

20 30 40 50 60

female male
Percent of Total

20
15
10
5
0

20 30 40 50 60

age

In lattice lingo, the two subplots are called panels and the labels at the top are called strips. (Strips
can be placed on the left side if you prefer.)

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 19

We can even condition on two things at once:

> histogram(~ age | substance + sex, data=HELP, n=20)

20 30 40 50 60

male male male


alcohol cocaine heroin
30

20

10
Percent of Total

0
female female female
alcohol cocaine heroin
30

20

10

20 30 40 50 60 20 30 40 50 60

age

1.6.4 Density plots densityplot()

Density plots are smoother versions of histograms.


> densityplot(~ age | substance + sex, data=HELP, n=20)

10 20 30 40 50 60 70

male male male


alcohol cocaine heroin
0.06
0.04
0.02






















































0.00
Density

female female female


alcohol cocaine heroin
0.06
0.04
0.02
0.00

























10 20 30 40 50 60 70 10 20 30 40 50 60 70

age

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


Digging Deeper
There are several op- 20 An Introduction to R
tional arguments to
the densityplot()
function that can be
used to control the
type and degree of
smoothing used in
these plots. The If we want to get really fancy, we can do both at once:
general method is
called kernel density
estimation.
> histogram(~age|substance+sex,data=HELP,n=20, type='density',
panel=function(...){ panel.histogram(...); panel.densityplot(...)}
)

20 30 40 50 60

male male male


alcohol cocaine heroin

0.10

0.05

0.00
Density

female female female


alcohol cocaine heroin

0.10

0.05

0.00

20 30 40 50 60 20 30 40 50 60

age

1.6.5 Boxplots: bwplot()

Boxplots are made pretty much the same way as histograms:

> bwplot(~ age, data=HELP)

20 30 40 50 60

age

We can use conditioning as we did for histograms:

> bwplot(~ age | substance, data=HELP)

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 21

20 30 40 50 60

alcohol cocaine heroin

20 30 40 50 60 20 30 40 50 60

age

But there are better ways to do this.

> bwplot(age ~ substance, data=HELP)

60
50
age

40
30

20
alcohol cocaine heroin

This is improved, but the species names run into each other. We could fix that run-together text by
using abbreviated names or rotating the labels 45 or 90 degrees. Instead of those solutions, we can
also just reverse the roles of the horizontal and vertical axes.

> bwplot(substance ~ age, data=HELP)

heroin
cocaine

alcohol

20 30 40 50 60

age
We can combine this with conditioning if we like:

> bwplot(substance ~ age | sex, data=HELP)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


22 An Introduction to R

20 30 40 50 60

female male
heroin

cocaine

alcohol

20 30 40 50 60

age

1.6.6 Scatterplots: xyplot()

Scatterplots are made with xyplot(). The formula interface is very natural for this. Just remember
that the y variable comes first. (Its label is also farther left on the plot, if that helps you remember.)

> xyplot(Sepal.Length ~ Sepal.Width, data=iris)


Sepal.Length

8



7






6



5






2.0 2.5 3.0 3.5 4.0 4.5

Sepal.Width

Again, we can use conditioning to make a panel for each species.

> xyplot(Sepal.Length ~ Sepal.Width | Species, data=iris)

2.0 2.5 3.0 3.5 4.0 4.5


Sepal.Length

setosa versicolor virginica


8



7




6


















5

2.0 2.5 3.0 3.5 4.0 4.5 2.0 2.5 3.0 3.5 4.0 4.5

Sepal.Width

Even better (for this example), we can use the groups argument to indicate the different species using
different symbols on the same panel.

> xyplot(Sepal.Length ~ Sepal.Width, groups=Species, data=iris)

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 23

Sepal.Length
7

6




5







2.0 2.5 3.0 3.5 4.0 4.5

Sepal.Width

1.6.7 Saving Your Plots

There are several ways to save plots, but the easiest is probably the following:

1. In the Plots tab, click the Export button.


2. Copy the image to the clipboard using right click.
3. Go to your Word document and paste in the image.
4. Resize or reposition your image in Word as needed.

1.6.8 A Few Bells and Whistles

There are lots of arguments that control how these plots look. Here are just a few examples.

auto.key

It would be useful to have a legend for the previous plot. auto.key=TRUE turns on a simple legend.
(There are ways to have more control, if you need it.)

> xyplot(Sepal.Length ~ Sepal.Width, groups=Species, data=iris,


auto.key=TRUE)

setosa
versicolor
virginica

8
Sepal.Length

6





5





2.0 2.5 3.0 3.5 4.0 4.5

Sepal.Width

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


24 An Introduction to R

alpha, cex

Sometimes it is nice to have elements of a plot be partly transparent. When such elements overlap,
they get darker, showing us where data are piling up. Setting the alpha argument to a value between
0 and 1 controls the degree of transparency: 1 is completely opaque, 0 is invisible. The cex argument
controls character expansion and can be used to make the plotting characters larger or smaller by
specifying the scaling ratio.

> xyplot(Sepal.Length ~ Sepal.Width, groups=Species, data=iris,


auto.key=list(columns=3),
alpha=.5,
cex=1.3)

setosa versicolor virginica

8
Sepal.Length

2.0 2.5 3.0 3.5 4.0 4.5

Sepal.Width

main, sub, xlab, ylab

You can add a title or subtitle, or change the default labels of the axes.

> xyplot(Sepal.Length ~ Sepal.Width, groups=Species, data=iris,


main="Some Iris Data",
sub="(R. A. Fisher analysized this data in 1936)",
xlab="sepal width (cm)",
ylab="sepal length (cm)",
alpha=.5,
auto.key=list(columns=3))

Some Iris Data


setosa versicolor virginica

8
sepal length (cm)

2.0 2.5 3.0 3.5 4.0 4.5

sepal width (cm)


(R. A. Fisher analysized this data in 1936)

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 25

trellis.par.set()

Default settings for lattice graphics are set using trellis.par.set(). Dont like the default font
sizes? You can change to a 7 point (base) font using

> trellis.par.set(fontsize=list(text=7)) # base size for text is 7 point

Nearly every feature of a lattice plot can be controlled: fonts, colors, symbols, line thicknesses, colors,
etc. Rather than describe them all here, well mention only that groups of these settings can be
collected into a theme. show.settings() will show you what the theme looks like.

> trellis.par.set(theme=col.whitebg()) # a theme in the lattice package


> show.settings()


superpose.symbol superpose.line strip.background strip.shingle

World



Hello

dot.[symbol, line] box.[dot, rectangle, umbrella] add.[line, text] reference.line








plot.[symbol, line] plot.shingle[plot.polygon] histogram[plot.polygon] barchart[plot.polygon]

superpose.polygon regions

> trellis.par.set(theme=col.abd()) # a theme in the abd package


> show.settings()

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


26 An Introduction to R


superpose.symbol superpose.line strip.background strip.shingle

World



Hello

dot.[symbol, line] box.[dot, rectangle, umbrella] add.[line, text] reference.line








plot.[symbol, line] plot.shingle[plot.polygon] histogram[plot.polygon] barchart[plot.polygon]

superpose.polygon regions

> trellis.par.set(theme=col.mosaic()) # a theme in the mosaic package


> show.settings()


superpose.symbol superpose.line strip.background strip.shingle

World



Hello

dot.[symbol, line] box.[dot, rectangle, umbrella] add.[line, text] reference.line








plot.[symbol, line] plot.shingle[plot.polygon] histogram[plot.polygon] barchart[plot.polygon]

Suggestion Box
Do you have a great superpose.polygon regions
eye for colors? Help
us design other lat-
tice themes. > trellis.par.set(theme=col.mosaic(bw=TRUE)) # black and white version of previous theme
> show.settings()
Digging Deeper
The RColor-
Brewer package SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio
provides several
palettes of colors
that are highly
distinguishable
An Introduction to R 27


superpose.symbol superpose.line strip.background strip.shingle

World



Hello

dot.[symbol, line] box.[dot, rectangle, umbrella] add.[line, text] reference.line








plot.[symbol, line] plot.shingle[plot.polygon] histogram[plot.polygon] barchart[plot.polygon]

superpose.polygon regions

> trellis.par.set(theme=col.mosaic()) # back to the mosaic theme


> trellis.par.set(fontsize=list(text=9)) # and back to a larger font

1.6.9 Tabulating Categorical Data

The Current Population Survey (CPS) is used to supplement census information between census years.
These CPS data frame consist of a random sample of persons from the CPS, with information on wages
and other characteristics of the workers, including sex, number of years of education, years of work
experience, occupational status, region of residence and union membership.
> head(CPS,3)
wage educ race sex hispanic south married exper union age sector
1 9.0 10 W M NH NS Married 27 Not 43 const
2 5.5 12 W M NH NS Married 20 Not 38 sales
3 3.8 12 W F NH NS Single 4 Not 22 sales

Making Frequency and Contingency Tables with xtabs()

Categorical variables are often summarized in a table. R can make a table for a categorical variable
using xtabs().
> xtabs(~ race, CPS)
race
NW W
67 467
> xtabs(~ sector, CPS)
sector
clerical const manag manuf other prof sales service
97 20 55 68 68 105 38 83

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


28 An Introduction to R

Alternatively, we can use table(), proptable(), and perctable() to make tables of counts, propor-
tions, or percentages.
> with(CPS, table(race))
race
NW W
67 467
> with(CPS, proptable(sector))
sector
clerical const manag manuf other prof sales service
0.18165 0.03745 0.10300 0.12734 0.12734 0.19663 0.07116 0.15543
> with(CPS, perctable(sector))
sector
clerical const manag manuf other prof sales service
18.165 3.745 10.300 12.734 12.734 19.663 7.116 15.543

We can make a cross-table (also called a contingency table or a two-way table) summarizing
this data with xtabs(). This is often a more useful view of data with two categorical variables.
> xtabs(~ race + sector, CPS)
sector
race clerical const manag manuf other prof sales service
NW 15 3 6 11 5 7 3 17
W 82 17 49 57 63 98 35 66

Entering Tables by Hand

Because categorical data is so easy to summarize in a table, often the frequency or contingency tables
are given instead. You can enter these tables manually as follows:
> myrace <- c( NW=67, W=467 ) # c for combine or concatenate
> myrace
NW W
67 467

> mycrosstable <- rbind( # bind row-wise


NW = c(clerical=15, const=3, manag=6, manuf=11, other=5, prof=7, sales=3, service=17),
W = c(82,17,49,57,63,98,35,66) # no need to repeat the column names
)
> mycrosstable
clerical const manag manuf other prof sales service
NW 15 3 6 11 5 7 3 17
W 82 17 49 57 63 98 35 66

Replacing rbind() with cbind() will allow you to give the data column-wise instead.

1.6.10 Graphing Categorical Data

The lattice function barchart() can display these tables as barcharts.

> barchart(xtabs(~ sector, CPS))

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 29

service
sales
prof
other
manuf
manag
const
clerical

0 20 40 60 80 100

Freq

> barchart(xtabs(~ sector, CPS), horizontal=FALSE) # vertical bars

100
80
Freq

60
40
20
0
clerical const manag manuf other prof sales service

Just as bar charts are used to display the distribution of one categorical variable, mosaic plots can do
the same for cross tables. mosaic() (from the vcd package) is not a lattice plot, but it does use a
similar formula interface.

> require(vcd) # load the visualizing categorical data package


> mosaic(~ sex + union, CPS)

union
Not Union
F
sex
M

Caution!
The mosaic() func-
tion has nothing to
do with the mosaic
package, they just
Alternatively, we can send mosaic() the output of xtabs(): happen to share the
same name.

> mosaic(xtabs(~ sex + union, CPS)) # non-whites are more likely to be unionized

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


30 An Introduction to R
Neither mosaic()
nor the similar
mosaicplot() are as
clever as one could
hope. In particular, Or we can send our own hand-made table (although the output isnt quite as nice without some extra
without some extra effort we wont discuss just now):
customization, both
tend to look bad
if the levels of the
variables have long > mosaic(mycrosstable)
names. mosaic()
plots also always
stay square. Barcharts can also be used to display two-way tables. First we convert the cross-table to a data frame.
Then we can use this data frame for plotting.
> cps <- as.data.frame(xtabs(~ sector + race, data=CPS)); cps
sector race Freq
1 clerical NW 15
2 const NW 3
3 manag NW 6
4 manuf NW 11
5 other NW 5
6 prof NW 7
7 sales NW 3
8 service NW 17
9 clerical W 82
10 const W 17
11 manag W 49
12 manuf W 57
13 other W 63
14 prof W 98
15 sales W 35
16 service W 66

> barchart(Freq ~ sector, groups=race, data=cps)

100

80

60
Freq

40

20

0
clerical const manag manuf other prof sales service

1.7 Additional Notes on R Syntax

1.7.1 Text and Quotation Marks

For the most part, text in R must be enclosed in either single or double quotations. It usually doesnt
matter which you use, unless you want one or the other type of quotation mark inside your text. Then
you should use the other type of quotation mark to mark the beginning and the end.
> text1 <- "Mary didn't come" # apostrophe inside requires double quotes around text
> text2 <- 'Do you use "scare quotes"?' # this time we flip things around

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 31

If you omit quotes, you will often see error messages telling you that R cant find an object because R
will look for a function, data set or other object with that name instead of treating your text as text.

> text3 <- blah


Error: object 'blah' not found

1.7.2 Functions

Functions in R use the following syntax:


> functionname( argument1, argument2, ... )
The arguments are always surrounded by (round) parentheses and separated by commas.
Some functions (like col.whitebg()) have no arguments, but you still need the parentheses.
Most arguments have names, but you dont need to use the names if you give the arguments in
the correct order.
If you use names, you can give the arguments out of order. The following do the same thing,
> xyplot(Sepal.Length ~ Sepal.Width, data=iris, groups=Species)
> xyplot(Sepal.Length ~ Sepal.Width, iris, groups=Species)
> xyplot(Sepal.Length ~ Sepal.Width, groups=Species, iris)
But these do not work
> xyplot(Sepal.Length ~ Sepal.Width, Species, iris)
> xyplot(Sepal.Length ~ Sepal.Width, iris, Species)
The first fails because the second argument is data, so iris needs to be in the second position
if it is not named. The second fails because groups is not the third argument. (There are
many other arguments between data and groups .) The documentation for functions shows the
correct order of arguments.
Typically, we will not use names for the first argument or two (these tend to be very important
arguments that have to be there) but will use names for the rest (these are often optional
arguments that can be present or not, depending on whether we want the default behavior or
something special).

1.8 Installing R

1.8.1 RStudio in the cloud

Our primary version of R will be the online version of RStudio. You should have an RStudio account
at http://beta.rstudio.org/ using your Gmail address. RStudio is a brand new (and quite nice)
interface to R that runs in a web browser. This has the advantage that you dont have to install or
configure anything. Just login and you are good to go. Futhermore, RStudio will remember what
you were doing so that each time you login (even on a different machine) you can pick up right where
you left off. This is R in the cloud and works a bit like GoogleDocs for R.

If you find bugs or have suggestions for RStudio, let us know. It is in rapid development at the moment,
and we can pass along your feedback to the developers.

This should be all you need for this course. But if you prefer to have a stand-alone version (because
you study somewhere without an internet connection, or have data that cant be loaded into the cloud,
for example), read on.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


32 An Introduction to R

1.8.2 RStudio on Your Desktop/Laptop

There is also a stand-alone version of the RStudio environment that you can install on your desktop
or laptop machine. This can be downloaded from http://www.rstudio.org/. This assumes that
you have a version of R installed on your computer (see below for instructions to download this from
CRAN).

1.8.3 Getting R from CRAN

CRAN is the Comprehensive R Archive Network (http://cran.r-project.org/). You can download


free versions of R for PC, Mac, and Linux from CRAN. (If you use the RStudio stand-alone version,
you also need to install R this way first.) All the instructions for downloading and installing are on
CRAN. Just follow the appropriate instructions for your platform.

1.8.4 RStudio in the cloud on your own server

At present, we are using a beta version of RStudio running on their servers. It is also possible to
install this on servers at your institution. This will almost certainly require a discussion with your
administrators, but may be worthwhile to facilitate student use in this manner.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 33

1.9 R Examples
The commands below are illustrated with the data sets iris and CPS. To apply these in other situa-
tions, you will need to substitute the name of your data frame and the variables in it.

answer <- 42 Store the value 42 in a variable named answer.

log(123); log10(123); sqrt(123) Take natural logarithm, base 10 logarithm, or square


root of 123.

x <- c(1,2,3) Make a variable containing values 1, 2, and 3 (in that


order).

data(iris) (Re)load the data set iris.

summary(iris$Sepal.Length) Summarize the distribution of the Sepal.Length vari-


able in the iris data frame.

summary(iris) Summarize each variable in the iris data frame.

str(iris) A different way to summarize the iris data frame.

head(iris) First few rows of the data frame iris.

require(Hmisc) Load packages. (This can also be done by checking


require(abd) boxes in the Packages tab.)

summary(Sepal.Length~Species,data=iris,fun=favstats)
Compute favorite statistics of Sepal.Length for each
Species. [requires Hmisc]

histogram(~Sepal.Length|Species, iris)
Histogram of Sepal.Length conditioned on Species.

bwplot(Sepal.Length~Species, iris) Boxplot of Sepal.Length conditioned on Species.

xyplot(Sepal.Length~Sepal.Width|Species, iris)
Scatterplot of Sepal.Length by Sepal.Width with sep-
arate panels for each Species.

xtabs(~sector, CPS) Frequency table of the variable sector.

barchart(xtabs(~sector, CPS))
Make a barchart from the table.

xtabs(~sector + race, CPS)


Cross tabulation of sector and race.

mosaic(~sector + race, CPS)


Make a mosaic plot.

xtData <- as.data.frame( xtabs(~sector + race, Trematodes) )


Save cross table information as xtData.

barchart(Freq~sector, data=xtData, groups=race)


Use xtData to make a segmented bar chart.

sum(x); mean(x); median(x); Sum, mean, median, variance, standard deviation,


var(x); sd(x); quantile(x) quantiles of x.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


34 An Introduction to R

1.10 Exercises

1.1 Calculate the natural logarithm (log base e) and base 10 logarithm of 12,345.
What happens if you leave the comma in this number?
> log(12,345)
[1] 0.4252

1.2 Install and load the mosaic package. Make sure lattice is also loaded (no need to install it, it
is already installed).

Here are some other packages you may like to install as well.

Hmisc (Frank Harrells miscellaneous utilities),

vcd (visualizing categorical data),

fastR (Foundations and Applications of Statistics), and

abd (Analysis of Biological Data).

1.3 Enter the following small data set in an Excel or Google spreadsheet and import the data into
RStudio.

You can import directly from Google. From Excel, save the file as a csv and import that (as a text
file) into RStudio. Name the data frame JunkData.

1.4 What is the average (mean) width of the sepals in the iris data set?

1.5 Determine the average (mean) sepal width for each of the three species in the iris data set.

1.6 The Jordan8687 data set (in the fastR package) contains the number of points Michael Jordan
scored in each game of the 198687 season.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


An Introduction to R 35

a) Make a histogram of this data. Add an appropriate title.

b) How would you describe the shape of the distribution?

c) In approximately what percentage of his games, did Michael Jordan score less than 20 points?
More than 50? (You may want to add breaks=seq(0,70,by=5) to your command to neaten up
the bins.)

1.7 Cuckoos lay their eggs in the nests of other birds. Is the size of cuckoo eggs different in different
host species nests? The cuckoo data set (in fastR) contains data from a study attempting to answer
this question.

a) When were these data collected? (Use ?cuckoo to get information about the data set.)

b) What are the units on the length measurements?

c) Make side-by-side boxplots of the length of the eggs by species.

d) Calculate the mean length of the eggs for each host species.

e) What do you think? Does it look like the size is differs among the different host species? Refer
to your R output as you answer this question. (Well learn formal methods to investigate this
later in the semester.)

1.8 The Utilities2 data set in the mosaic package contains a number of variables about the utilities
bills at a residence in Minnesota over a number of years. Since the number of days in a billing cycle
varies from month to month, variables like gasbillpday (elecbillpday, etc.) contain the gas bill
(electric bill, etc.) divided by the number of days in the billing cycle.

a) Make a scatter plot of gasbillpday vs. monthsSinceY2K using the command


> xyplot(gasbillpday ~ monthsSinceY2K, data=Utilities2, type='l') # the letter l

What pattern(s) do you see?

b) What does type='l' do? Make your plot with and without it. Which is easier to read in this
situation?

c) What happens if we replace type='l' with type='b'?

d) Make a scatter plot of gasbillpday by month. What do you notice?

e) Make side-by-side boxplots of gasbillpday by month using the Utilities2 data frame. What
do you notice?
Your first try probably wont give you what you expect. The reason is that month is coded
using numbers, so R treats it as numerical data. We want to treat it as categorical data. To do
this in R use factor(month) in place of month. R calls categorical data a factor.

f ) Make any other plot you like using this data. Include both a copy of your plot and a discussion
of what you can learn from it.

1.9 The table below is from a study of nighttime lighting in infancy and eyesight (later in life).

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


36 An Introduction to R

no myopia myopia high myopia


darkness 155 15 2
nightlight 153 72 7
full light 34 36 3

a) Recreate the table in RStudio.


b) What percent of the subjects slept with a nightlight as infants?
There are several ways to do this. You could use R as a calculator to do the arithmetic. You can
save some typing if you use the function prop.table(). See ?prop.table for documentation.
If you just want row and column totals added to the table, see mar_table() in the vcd package.
c) Make a mosaic plot for this data. What does this plot reveal?

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Getting Interactive with manipulate 37

Getting Interactive with manipulate


2
One very attractive feature of RStudio is the manipulate() function, which can allow the creation
of a set of controls (such as slider(), picker() or checkbox()) that can be used to dynamically
change values within the expression. When a value is changed using these controls, the expression is
automatically re-executed and redrawn. This can be used to quickly prototype a number of activities
and demos as part of a statistics lecture.

2.1 Simple Things

2.1.1 Sliders

> if(require(manipulate)) {
manipulate(
histogram( ~ eruptions, data=faithful, n=n),
n = slider(5,40)
)
}

This generates a plot along with a slider ranging from 5 bins to 40.

When the slider is changed, we see a clearer view of the eruptions of Old Faithful.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


38 Getting Interactive with manipulate

2.1.2 Check Boxes


> if(require(manipulate)) {
manipulate(
xhistogram( ~ age, data=HELP, n=n, density=density),
n = slider(5,40),
density = checkbox()
)
}

2.1.3 Drop-down Menus


> if(require(manipulate)) {
manipulate(
xhistogram( ~ age, data=HELP, n=n, fit=distribution, dlwd=4),
n = slider(5,40),
distribution =
picker('normal', 'gamma', 'exponential', 'lognormal',
label="distribution")
)
}

A slightly fancier version of this is provided as mhistogram() in the mosaic package.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Getting Interactive with manipulate 39

2.1.4 Visualizing Normal Distributions


> if(require(manipulate)) {
manipulate( xpnorm( x, 500, 100 ), x = slider(200,800) )
}

Exercises

2.1 The following code makes a scatterplot with separate symbols for each sex.
> xyplot(cesd ~ age, data=HELP, groups=sex)

Build a manipulate example that allows you to turn the grouping on and off with a checkbox.

2.2 Build a manipulate example that uses a picker to select from a number of variables to make a
plot for. Heres an example with a histogram:

2.3 Design your own interactive demonstration idea and implement it using RStudio manipulate
tools.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


40 A Crash Course in Statistics for Biologists (and Their Friends)

A Crash Course in Statistics for Biologists (and Their Friends)


3
3.1 Why Use R?

Modern statistics is done with statistical computing tools. There are many possibilities.1 R offers the
following set of advantages:

1. R is free and available on any platform (Mac, PC, Linux, etc.) and also, via RStudio, in a web
browser.
This means students have access to R whenever and wherever they need it.

2. R is powerful you wont outgrow it.


If one goal is to prepare students for future research, R will grow with them.

3. R produces excellent quality graphics.


R produces publication quality graphics. Via the lattice package, a wide range of useful plots
are easy to produce. For those willing to learn a bit more, plots can be customized to your
hearts contents.
1 Excel is not among them. Consider this description of Excel 2007 from [MH08]: Excel 2007, like its predecessors,

fails a standard set of intermediate-level accuracy tests in three areas: statistical distributions, random number gen-
eration, and estimation. Additional errors in specific Excel procedures are discussed. Microsofts continuing inability
to correctly fix errors is discussed. No statistical procedure in Excel should be used until Microsoft documents that
the procedure is correct; it is not safe to assume that Microsoft Excels statistical procedures give the correct answer.
Persons who wish to conduct statistical analyses should use some other package.
Most statisticians will find it challenging to take your science seriously if you did your analysis in Excel.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 41

4. R helps you think about data in ways that are useful for statistical analysis.
As with most true statistical packages, R prefers data arranged with variables in columns and
observational units in rows. Being able to identify each of these is a crucial pre-requisite to
understanding statistical procedures.

5. R promotes reproducible research.


R commands provide an exact record of how an analysis was done. Commands can be edited,
rerun, commented, shared, etc.

6. R is up-to-date.
Many new analysis methods appear first in R.

7. There are many packages available that automate particular tasks.


The CRAN (Comprehensive R Archive Network) repository contains more than 3000 packages
that provide a wide range of additional capabilities (including many with biological applications.)
The Bioconductor repository (http://www.bioconductor.org/) contains nearly 500 additional
packages that focus on biological and bioinformatics applications.

8. R can be combined with other tools.


R can be used within programming languages (like Python) or in scripting environments to
automate data analysis pipelines.

9. R is popular including among biologists.


R is becoming increasingly popular among biologists, especially among those doing work in
genetics and genomics. R is very widely used in graduate programs and academic research, and
is gaining market share in industry as well.

10. R provides a gentle introduction to general computation.


Although R can be used one command at a time (thats the way we will be using it here, for
the most part), R is a full featured programming language.

11. The best is yet to come.


A number of projects are underway that promise to further improve on R, including

RStudio and its manipulate features


Chris Wilds new graphical interface (only videos available at this point)
mosaic (beta) and mosaicManip (coming soon) packages from Project Mosaic

3.2 Computational Statistics: Where Are All The Formulas?

You perhaps remember an introduction to statistics that focussed on memorizing a list of formulas and
figuring out some way to remember which one to use in which situation. Here we present a different
approach based on some key ideas.

1. Randomization
Randomization lies at the heart of statistics no matter how it is done: random samples, random
assignment to treatment groups, etc.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


42 A Crash Course in Statistics for Biologists (and Their Friends)

2. Simulation
With the availability of modern computational tools, we can study randomization by simulation.
This has the advantage of emphasizing the core logic behind statistical inference and avoids (or
at least reduces) the need to learn many formulas. Furthermore, for many modern statistical
procedures, this is the only way they can be done.
The familiar, traditional statistical methods are usually approximations to randomization meth-
ods.2

3. Tabulation and Visualization


Tabulation and Visualization are in some sense two sides of the same coin. Randomness means
things do not turn out the same way every time. Instead there is a distribution of outcomes.
Inferences are drawn by considering these distributions, which can be tabulated and visualized.

In one sense this approach is not new. It is the approach that motivated people like Fisher in the early
part of the last century. But because modern computational tools were not available at that time,
explicit formulas (usually approximations) were needed in order to perform statistical calculations
efficiently.

3.3 Three Illustrative Examples

3.3.1 The Lady Tasting Tea

This section is a slightly modified version of a handout R. Pruim has given Intro Biostats
students on Day 1 after going through the activity as a class discussion.

There is a famous story about a lady who claimed that tea with milk tasted different depending on
whether the milk was added to the tea or the tea added to the milk. The story is famous because
of the setting in which she made this claim. She was attending a party in Cambridge, England, in
the 1920s. Also in attendance were a number of university dons and their wives. The scientists in
attendance scoffed at the woman and her claim. What, after all, could be the difference?

All the scientists but one, that is. Rather than simply dismiss the womans claim, he proposed that
they decide how one should test the claim. The tenor of the conversation changed at this suggestion,
and the scientists began to discuss how the claim should be tested. Within a few minutes cups of tea
with milk had been prepared and presented to the woman for tasting.

At this point, you may be wondering who the innovative scientist was and what the results of the
experiment were. The scientist was R. A. Fisher, who first described this situation as a pedagogical
example in his 1925 book on statistical methodology [Fis25]. Fisher developed statistical methods
that are among the most important and widely used methods to this day, and most of his applications
were biological.

You might also be curious about how the experiment came out. How many cups of tea were prepared?
How many did the woman correctly identify? What was the conclusion?

Fisher never says. In his book he is interested in the method, not the particular results. But lets
suppose we decide to test the lady with ten cups of tea. Well flip a coin to decide which way to
prepare the cups. If we flip a head, we will pour the milk in first; if tails, we put the tea in first. Then
we present the ten cups to the lady and have her state which ones she thinks were prepared each way.
2 There are some limits to the simulation approach (some simulations still require too much computational power to

be used in practice), so there are still advantages to direct analytical methods.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 43

It is easy to give her a score (9 out of 10, or 7 out of 10, or whatever it happens to be). It is trickier
to figure out what to do with her score. Even if she is just guessing and has no idea, she could get
lucky and get quite a few correct maybe even all 10. But how likely is that?

Lets try an experiment. Ill flip 10 coins. You guess which are heads and which are tails, and well
see how you do.
..
.

Comparing with your classmates, we will undoubtedly see that some of you did better and others
worse.

Now lets suppose the lady gets 9 out of 10 correct. Thats not perfect, but it is better than we would
expect for someone who was just guessing. On the other hand, it is not impossible to get 9 out of
10 just by guessing. So here is Fishers great idea: Lets figure out how hard it is to get 9 out of 10
by guessing. If its not so hard to do, then perhaps thats just what happened, so we wont be too
impressed with the ladys tea tasting ability. On the other hand, if it is really unusual to get 9 out of
10 correct by guessing, then we will have some evidence that she must be able to tell something.

But how do we figure out how unusual it is to get 9 out of 10 just by guessing? There are other
methods (and you may already know of one), but for now, lets just flip a bunch of coins and keep
track. If the lady is just guessing, she might as well be flipping a coin.

So heres the plan. Well flip 10 coins. Well call the heads correct guesses and the tails incorrect
guesses. Then well flip 10 more coins, and 10 more, and 10 more, and . . . . That would get pretty
tedious. Fortunately, computers are good at tedious things, so well let the computer do the flipping
for us. The mosaic package
must be installed be-
The rflip() function can flip one coin fore it can be used.
It is available from
> require(mosaic) CRAN.
> rflip()
Flipping 1 coins [ Prob(Heads) = 0.5 ] ...

Result: 0 heads.

or a number of coins
> rflip(10)
Flipping 10 coins [ Prob(Heads) = 0.5 ] ...

H T H H T H H H T H

Result: 7 heads.

Typing rflip(10) a bunch of times is almost as tedious as flipping all those coins. But it is not too
hard to tell R to do() this a bunch of times.
> do(3) * rflip(10)
n heads tails
1 10 8 2
2 10 4 6
3 10 1 9

Lets get R to do() it for us 10,000 times and make a table of the results.
> random.ladies <- do(10000) * rflip(10)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


44 A Crash Course in Statistics for Biologists (and Their Friends)

> table(random.ladies$heads)
0 1 2 3 4 5 6 7 8 9 10
5 102 467 1203 2048 2470 2035 1140 415 108 7
> perctable(random.ladies$heads) # display table using percentages
0 1 2 3 4 5 6 7 8 9 10
0.05 1.02 4.67 12.03 20.48 24.70 20.35 11.40 4.15 1.08 0.07

We can display this table graphically using a plot called a histogram.

> histogram(~ heads, random.ladies,


breaks=-.5 + (0:11)
)

We have control of the histogram display by specifying the breaks from -.5 to 10.5:
> -.5 + (0:11)
[1] -0.5 0.5 1.5 2.5 3.5 4.5 5.5 6.5 7.5 8.5 9.5 10.5

You might be surprised to see that the number of correct guesses is exactly 5 (half of the 10 tries)
only 25% of the time. But most of the results are quite close to 5 correct. 67% of the results are 4, 5,
or 6, for example. And 90% of the results are between 3 and 7 (inclusive). But getting 8 correct is a
bit unusual, and getting 9 or 10 correct is even more unusual.

So what do we conclude? It is possible that the lady could get 9 or 10 correct just by guessing, but it
is not very likely (it only happened in about 1.2% of our simulations). So one of two things must be
true:

The lady got unusually lucky, or

The lady is not just guessing.

Although Fisher did not say how the experiment came out, others have reported that the lady correctly
identified all 10 cups! [Sal01]

A different design

Suppose instead that we prepare five cups each way (and that the woman tasting knows this). We
give her five cards labeled milk first, and she must place them next to the cups that had the milked
poured first. How does this design change things?
> results <- do(10000) * table(sample( c('M','M','M','M','M','T','T','T','T','T'), 5))
> perctable(results$M)
1 2 3 4 5
9.9739 39.8252 39.4536 10.3254 0.4219

3.3.2 Golfballs in the Yard


This example can be used as a first example of hypothesis testing or as an introduction
to chi-squared tests. As an introduction to hypothesis testing it is very useful in helping
students understand what a test statistic is and its role in hypothesis testing.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 45

The Story

Allan Rossman once lived along a golf course. One summer he collected the golf balls that landed in
his yard and tallied how many were labeled with 1s, 2s, 3s, and 4s because he was curious to know
whether these numbers were equally likely.3

Of the first 500 golf balls, 14 had either no number or a number other than 1, 2, 3, or 4. The remaining
486 golf balls form our sample:

1 2 3 4 other
137 138 107 104 14

We can enter this data into R using the c() function.


> golfballs <- c(137, 138, 107, 104)

Coming up with a test statistic

At this point, ask students what they think the data indicates about the hypothesis that the four
numbers are equally likely. Students usually notice right away that there are a lot of 2s. But perhaps
thats just the result of random sampling. We can generate random samples and see how the random
samples compare with the actual data: rgolfballs can
be generated in
> table(rdata(486, 1:4)) # 486 draws from the numbers 1 thru 4 (equally likely) advance if you dont
1 2 3 4 want to distract
111 132 117 126 your students with
thinking about
how do create it.
It is useful to generate some more of these samples to get a better feel for the sampling distribution There is a pre-built
under the null: rgolfballs in the
fastR package.
> do(25) * table(rdata(486, 1:4))

1 2 3 4 9 124 146 113 103 18 133 124 111 118


1 104 144 112 126 10 134 120 125 107 19 133 119 114 120
2 122 128 123 113 11 124 99 132 131 20 122 125 119 120
3 128 106 124 128 12 114 113 141 118 21 119 133 109 125 Tip
4 117 122 140 107 13 122 116 118 130 22 135 118 124 109 Have your students
5 107 138 117 124 14 126 116 127 117 23 118 124 102 142 calculate test statis-
6 124 124 124 114 15 115 118 116 137 24 137 101 131 117 tics mentally from
7 119 128 111 128 16 111 125 129 121 25 103 110 141 132 a small portion of
8 110 148 110 118 17 134 99 117 136 the sampling distri-
bution. Assign each
student a row or
two, then ask for
From this we see that it is not incredibly unlikely to see a count of 138 or more. (See samples 1, 4, 5, a show of hands to
8, 9, 12, 23, 25.) Students are often surprised just how often this occurs. see how many ex-
ceed the test statis-
3 You can have some discussion with your students about what population is of interest here. Given the location
tic calculated from
of the house, the golf balls were primarily struck by golfers of modest ability and significant slice, all playing on one the data.
particular golf course. These results may or may not extend to other larger populations of golfers.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


46 A Crash Course in Statistics for Biologists (and Their Friends)

Once students understand the idea of a test statistic and how it is computed from data, its time to let
the computer automate things. First, we generate a better approximation to the sampling distribution
assuming each number is equally likely.
> rgolfballs <- do(2000) * table(rdata(486, 1:4))

The statTally() function can tabulate and display the sampling distribution and compared to the
test statistic.

> print(statTally(golfballs, rgolfballs, max))


Test Stat function: max

Test Stat applied to sample data = 138

Test Stat applied to random data:

50% 90% 95% 99%


132 141 144 149

Of the random samples


1620 ( 81 % ) had test stats < 138
66 ( 3.3 % ) had test stats = 138
314 ( 15.7 % ) had test stats > 138

0.06
Density

0.04

0.02

0.00

120 130 140 150

stats

More test statistics

One of the goals of this activity is to have the students understand the role of a test statistic. Students
are encouraged to dream up test statistics of their own. The minimum count is often suggested as an
alternative, so we try that one next.
> print(statTally(golfballs, rgolfballs, min)) # output surpressed.

These two test statistics (maximum count and minimum count) feel like they arent making full use
See Section A.7 for of our data. Perhaps we would do better if we looked at the difference between the maximum and
a tutorial on writing minimum counts. This requires writing a simple function.
your own functions.

> mystat1 <- function(x) { diff(range(x)) }


> print(statTally(golfballs, rgolfballs, mystat1, v=mystat1(golfballs))) # add a vertical line

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 47

Test Stat function: mystat1

Test Stat applied to sample data = 34

Test Stat applied to random data:

50% 90% 95% 99%


22 36 40 49

Of the random samples


1715 ( 85.75 % ) had test stats < 34
27 ( 1.35 % ) had test stats = 34
258 ( 12.9 % ) had test stats > 34

0.04
Density

0.03
0.02
0.01
0.00

0 20 40 60

stats

The Worlds Worst Test Statistic

Usually I get lucky and someone will suggest the worlds worst test statistic: The sum of the differences
between the counts and 486/4 = 121.5.

> mystat2 <- function(x) { sum( x - 121.5 ) }


> print(statTally(golfballs, rgolfballs, mystat2))

Test Stat function: mystat2

Test Stat applied to sample data = 0

Test Stat applied to random data:

50% 90% 95% 99%


0 0 0 0

Of the random samples


0 ( 0 % ) had test stats < 0
2000 ( 100 % ) had test stats = 0
0 ( 0 % ) had test stats > 0

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


48 A Crash Course in Statistics for Biologists (and Their Friends)

12
10

Density
8
6
4
2
0

0.4 0.2 0.0 0.2 0.4


Tip
As students come stats
up with test statis-
tics, let them name
them, or name them
after them (S for This test statistic is bad because it doesnt depend on the data, so the distribution of the test statistic
the Smith statistic, is the same whether the null hypothesis is true or false.
etc.) It adds to the
fun of the activity But it is close to a good idea. Lets add in an absolute value. . .
and mirrors how the
statistics they will
learn about got their
names. > sad <- function(x) { sum(abs(x-121.5)) }
> print(statTally(golfballs, rgolfballs, sad, v=sad(golfballs)))
Test Stat function: sad

Test Stat applied to sample data = 64

Test Stat applied to random data:

50% 90% 95% 99%


29.00 49.00 54.00 63.01

Of the random samples


1980 ( 99 % ) had test stats < 64
5 ( 0.25 % ) had test stats = 64
15 ( 0.75 % ) had test stats > 64

0.005
Density

0.004
It is a matter 0.003
0.002
of teaching style 0.001
whether you write 0.000
this function with
the magic number 0 200 400 600
121.5 hard-coded
in or use mean(x) stats
instead. The latter
is preferable for gen-
eralizable method,
of course. But the Squaring those differences (or equivalently using the standard deviation or variance) is also often
former may have suggested.
pedagogical advan-
tages, especially
in the Intro Stats
course. > print(statTally(golfballs, rgolfballs, var, v=var(golfballs)))
Test Stat function: var

Test Stat applied to sample data = 343

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 49

Test Stat applied to random data:

50% 90% 95% 99%


95.0 253.7 317.9 449.7

Of the random samples


1923 ( 96.15 % ) had test stats < 343
3 ( 0.15 % ) had test stats = 343
74 ( 3.7 % ) had test stats > 343

0.005
Density

0.004
0.003
0.002
0.001
0.000

0 200 400 600

stats

This example illustrates some important ideas about hypothesis testing, namely.

1. The test statistic must summarize the evidence we will use to judge the null hypothesis
in a single number computed from our sample.
2. We judge the test statistic computed from our sample by comparing it to test statistics
computed on random samples assuming the Null Hypothesis is true.
3. Some test statistics work better than others.
A good test statistic should look quite different when the null hypothesis is true from
how it looks when the null hypothesis is false. (This is a first hint at the idea of power.)

3.3.3 Not just a trivial example

The test we are developing here is called a goodness of fit test. This is the same sort of test we
might use, for example, to test whether the phenotype ratios in a plant hybridization experiment are
consistent with a certain genetic explanation. Suppose we observed a 20:50:35 ratio in a situation
predicted a 1:2:1 ratio (Mendelian codominance). Are our data consistent with the theory?

Here are a few reasonable test statistics for this situation.


> theory <- c('A', 'B', 'B', 'C')
> table( rdata(105, theory) )
A B C
23 56 26
> sad <- function(observed) { # sum of absolute deviation
n <- sum(observed)
expected <- c(.25, .5, .25) * n
sum ( abs( observed - expected) )
}

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


50 A Crash Course in Statistics for Biologists (and Their Friends)

> mad <- function(observed) { # mean of absolute deviation


n <- sum(observed)
expected <- c(.25, .5, .25) * n
mean ( abs( observed - expected) )
}

> chs <- function(observed) { # Pearson's chi-squared test statistic


n <- sum(observed)
expected <- c(.25, .5, .25) * n
sum ( ( observed - expected )^2 / expected )
}

> mls <- function(observed) { # max likelihood chi-squared test statistic


n <- sum(observed)
expected <- c(.25, .5, .25) * n
2 * sum ( log( observed ) - log( observed / expected ) )
}

> random.data <- do(1000) * table( rdata(105, theory) )


> print( statTally( c(20, 50, 35), random.data, sad) )
Test Stat function: sad

Test Stat applied to sample data = 17.5

Test Stat applied to random data:

50% 90% 95% 99%


10.50 19.05 21.50 26.50

Of the random samples


849 ( 84.9 % ) had test stats < 17.5
13 ( 1.3 % ) had test stats = 17.5
138 ( 13.8 % ) had test stats > 17.5

0.08

0.06
Density

0.04

0.02

0.00

0 10 20 30

stats

> random.data <- do(1000) * table( rdata(105, theory) )


> print( statTally( c(20, 50, 35), random.data, chs) )
Test Stat function: chs

Test Stat applied to sample data = 4.524

Test Stat applied to random data:

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 51

50% 90% 95% 99%


1.400 4.657 5.651 8.943

Of the random samples


897 ( 89.7 % ) had test stats < 4.524
2 ( 0.2 % ) had test stats = 4.524
101 ( 10.1 % ) had test stats > 4.524

0.25
0.20
Density

0.15
0.10
0.05
0.00

0 5 10

stats

The traditional Chi-squared test is an approximation to the test above (which saves us the time
associated with the simulations, and gives a tidy formula). R can, of course, compute that too:
> chisq.test( c(20,50,35), p=c(.25,.5,.25) )
Chi-squared test for given probabilities

data: c(20, 50, 35)


X-squared = 4.524, df = 2, p-value = 0.1042
> xchisq.test( c(20,50,35), p=c(.25,.5,.25) ) # mosaic version is a bit more verbose
Chi-squared test for given probabilities

data: c(20, 50, 35)


X-squared = 4.524, df = 2, p-value = 0.1042

20.00 50.00 35.00


(26.25) (52.50) (26.25)
[1.49] [0.12] [2.92]
<-1.22> <-0.35> < 1.71>

key:
observed
(expected)
[contribution to X-squared]
<residual>

3.3.4 Estimating the Mean Sepal Lengths of Irises via Bootstrap


> data(iris) # loads iris data from datasets package
> summary(iris) # summarize each variable
Sepal.Length Sepal.Width Petal.Length Petal.Width Species
Min. :4.30 Min. :2.00 Min. :1.00 Min. :0.1 setosa :50
1st Qu.:5.10 1st Qu.:2.80 1st Qu.:1.60 1st Qu.:0.3 versicolor:50
Median :5.80 Median :3.00 Median :4.35 Median :1.3 virginica :50
Mean :5.84 Mean :3.06 Mean :3.76 Mean :1.2

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


52 A Crash Course in Statistics for Biologists (and Their Friends)

3rd Qu.:6.40 3rd Qu.:3.30 3rd Qu.:5.10 3rd Qu.:1.8


Max. :7.90 Max. :4.40 Max. :6.90 Max. :2.5
> summary( Sepal.Length ~ Species, data=iris, fun=mean ) # mean for each species
Sepal.Length N=150

+-------+----------+---+-----+
| | |N |mean |
+-------+----------+---+-----+
|Species|setosa | 50|5.006|
| |versicolor| 50|5.936|
| |virginica | 50|6.588|
+-------+----------+---+-----+
|Overall| |150|5.843|
+-------+----------+---+-----+

> setosa <- subset(iris, Species=='setosa')


> mean(setosa$Sepal.Length)
mean
5.006

> with( resample(setosa), mean( Sepal.Length) )


mean
4.938
> with( resample(setosa), mean( Sepal.Length) )
mean
5.024
> with( resample(setosa), mean( Sepal.Length) )
mean
4.938

> res <- do(1000) * with( resample(setosa), mean( Sepal.Length) )

> histogram( ~ mean, res )

25
Percent of Total

20
15
10
5
0

4.9 5.0 5.1

mean

> quantile( res$mean, c(0.025, 0.975) ) # middle 95% of resampled means


2.5% 97.5%
4.916 5.096

Lets see how that compares with the interval produced by a t-test:
> interval(t.test( iris$Sepal.Length ))

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 53

Method: One Sample t-test

mean of x
5.843

95% confidence interval:


5.71 5.977

3.4 The Multi-World Metaphor for Hypothesis Testing


In this section we move toward a more systematic approach to statistical inference with the
goal of providing a flexible tool that works in a wide range of situations.

The simpler defini-


Statistical inference is hard to teach.4 Often, instead of teaching the logic of inference, we teach tion is a useful way
methods and techniques for calculating the quantities used in inference: standard errors, t-statistics, to describe this to
p-values, etc. students, but it is
not equivalent to the
Perhaps because students dont understand the logic, they have strong misconceptions about confi- dictionary definition
which includes an
dence intervals and, especially, about p-values. For example, even among professional scientists, the important notion
mainstream (mis)-understanding of p-values is that they reflect the probability that the null hypothesis of the reason for
is correct. hypotheses. A
hypothesis is a
Part of the reason why statistical inference is hard to grasp is that the logic is genuinely hard. It statement that is
posed for the pur-
involves contrapositives, it involves conditional probabilities, it involves hypotheses. And what is a
poses of determining
hypothesis? To a scientist, it is a kind of theory, an idea of how things work, an idea to be proven what would follow if
through lab or field research or the collection of data. But statistics hews not to the scientists but to the statement were
the philosophers or logicians rather abstract notion of a hypothesis: a proposition made as a basis true. This is the
sense of hypothesis
for reasoning, without any assumption of its truth. (Oxford American Dictionaries) Or more simply: of a theorem. It
is also the sense of
the null hypothesis.
A hypothesis is a statement that may be true or false. We assume the
null hypothesis
is true and see
What kind of scientist would frame a hypothesis without some disposition to think it might be true? what follows from
Only a philosopher or a logician. that assumption.
Unfortunately, it
To help connect the philosophy and logic of statistical hypotheses with the sensibilities of scientists, it is not the way this
might be helpful to draw from the theory of kinesthetic learning an active theory, not a philosophical word is often used in
high school science
proposition that learning is enhanced by carrying out a physical activity. Many practitioners of courses.
the reform style of teaching statistics engage in the kinesthetic style; they have students draw M&Ms
Thought of another
from a bag and count the brown ones, they have students walk randomly to see how far they get after way, the scientists
n steps [Kap09], or they toss a globe around the classroom to see how often a students index finger have conflated the
lands in the ocean [GN02]. words hypothesis
and conjecture.
To teach hypothesis testing in a kinesthetic way, you need a physical representation of the various
hypotheses found in statistical inference. One way to do this involves not the actual physical activity
of truly kinesthetic learning, but concrete stories of making different sorts of trips to different sorts of
worlds. A hypothesis may be true on some worlds and false on others. On some planets we will know
whether a hypothesis is true or false, on others, the truth of a hypothesis is an open question.

Of course, the planet that we care about, the place about which we want to be able to draw conclusions.
Its Planet Earth:
4 Here we are considering only the frequentist version of inference. The Bayesian approach is different and has

different features that make it hard to teach and understand. In these notes, we will be agnostic about frequentist vs
Bayesian, except to acknowledge that, for good or bad, the frequentist approach is vastly dominant in introductory
statistics courses.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


54 A Crash Course in Statistics for Biologists (and Their Friends)

We want to know which hypotheses are true on Earth and which are false. But Earth is a big place
and complicated, and its hard to know exactly whats going on. So, to deal with the limits of our
abilities to collect data and to understand complexity, statistical inference involves a different set of
planets. These planets resemble Planet Earth in some ways and not in others. But they are simple
enough that we know exactly whats happening on them, so we know which hypotheses are true and
which are false on these planets.

These planets are:

Planet Sample Planet Null Planet Alt

Planet Sample is populated entirely with the cases we have collected on Planet Earth. As such, it
somewhat resembles Earth, but many of the details are missing, perhaps even whole countries or
continents or seas. And of course, it is much smaller than Planet Earth.

Planet Null is a boring planet. Nothing is happening there. Express it how you will: All groups all
have the same mean values. The model coefficients are zero. Different variables are unrelated to one
another. Dullsville. But even if its dull, its not a polished billiard ball that looks the same from every
perspective. Its the clay from which Adam was created, the ashes and dust to which man returns.
But it varies from place to place, and that variation is not informative. Its just random.

Finally, there is Planet Alt. This is a cartoon planet, a caricature, a simplified representation of our
idea of what is (or might be) going on, our theory of how the world might be working. Its not going
to be exactly the same as Planet Earth. For one thing, our theory might be wrong. But also, no
theory is going to capture all the detail and complexity of the real world.

In teaching statistical inference in a pseudo-kinesthetic way, we use the computer to let students
construct each of the planets. Then, working on that planet, the student can carry out simulations of
familiar statistical operations. Those simulations tell the student what they are likely to see if they
were on that planet. Our goal is to figure out whether Earth looks more like Planet Null or more like
Planet Alt.

For the professional statisticians, the planet metaphor is unnecessary. The professional has learned
to keep straight the various roles of the null and alternative hypothesis, and why one uses a sample
standard error to estimate the standard deviation of the sampling distribution from the population.
But most students find the array of concepts confusing and make basic categorical errors. The concrete
nature of the planets simplifies the task of keeping the concepts in order. For instance, Type I errors
only occur on Planet Null. You have to be on Planet Alt to make a Type II error. And, of course,

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 55

no matter how many (re)samples we make on Planet Sample, its never going to look more like Earth
than the sample itself.

3.4.1 The Sampling Distribution

Section 3.5 shows some examples of drawing random samples repeatedly from a set of data. To discuss
the sampling distribution, its helpful to make clear that the sampling distribution refers to results
from the population. In the planet metaphor, this means that the samples are drawn from Planet
Earth:

It can be a challenge to find a compelling example where you have the population, rather than a
sample, in hand. Sports statistics provide one plausible setting, where you have, for example, the
names and attributes of every professional player. The ability to sample from Earth mapping software
provides another compelling setting. (See Section 5.2.1.)

For our example, we will take the complete list of results from a running race held in Washington,
D.C. in April 2005 the Cherry Blossom Ten-Mile Run. The data set gives the sex, age, and net
running time (start line to finish line) for each of the 8636 runners who participated: the population
of runners in that race.
> population <- TenMileRace
> nrow(population)
[1] 8636

If you have the population on the computer, theres little point in taking a random sample. But the
point here is to illustrate the consequences of taking a sample. So, imagine that in fact it was difficult
or expensive or dangerous or destructive to collect the data on a runner, so you want to examine just
a small subset of the population.

Lets collect a sample of 100 runners:


> planet.sample <- sample(population, 100)

With that sample, we can calculate whatever statistics are of interest to us, for instance:
> with(planet.sample, mean(age))
mean
36.72
> with(planet.sample, sd(age))
sd
10.58
> with(planet.sample, mean(sex=="F"))
mean
0.46
> lm(net ~ age + sex, data=planet.sample)
...
(Intercept) age sexM
5372.0 18.9 -865.2

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


56 A Crash Course in Statistics for Biologists (and Their Friends)

These various numbers are informative in their own way about the sample, but its important to know
how they might relate to the population. For example, how precise are these numbers? That is, if
someone had collected a different random sample, how different would their results likely be?

Given that we have the population in hand, that were on Planet Earth, we can go back and collect
such samples many more times and study how much they vary one to the other. Well do this by
replacing planet.sample with a command to sample anew from the population.
> with(sample(population,100), mean(age))
mean
36.72
> with(sample(population,100), sd(age))
sd
9.455
> with(sample(population,100), mean(sex=="F"))
mean
0.5
> lm(net ~ age + sex, data=sample(population,100))
...
(Intercept) age sexM
5995.05 -2.15 -767.17

Slightly different results! To quantify this, repeat the sampling process many times and look at the
distribution: the sampling distribution.
> sample.means <- do(500) * with(sample(population,100), mean(age))
> sample.sds <- do(500) * with(sample(population,100), sd(age))
> sample.props <- do(500) * with(sample(population,100), mean(sex=="F"))
> sample.regressions <- do(500) * lm(net ~ age + sex, data=sample(population,100))

You can display the sampling distribution in several ways: histograms, box-and-whisker plots, density
plots. This is worth doing with the class. Make sure to point out that the distribution depends on the
statistic being calculated: in the above examples, the mean age, the standard deviation of ages, the
fraction of runners who are female, the relationship between running time and sex and age. (Well
get to the dependence on sample size in a little bit.)

Insofar as we want to be able to characterize the repeatability of the results of the sampling process, its
worth describing it in terms of the spread of the distribution: for instance, the standard deviation. Of
course, when talking about a sampling distribution, we give another name to the standard deviation:
the standard error. Actually calculating the standard error may perhaps solidify in the students mind
that it is a standard deviation.
> sd(sample.means) # standard error for mean age
mean
1.113
> sd(sample.sds) # standard error for sd of age
sd
0.7214
> sd(sample.props) # standard error for fraction female
mean
0.05243
> sd(sample.regressions) # standard errors for regression statistics
Intercept age sexM sigma r-squared
321.06953 9.09629 191.47578 76.14492 0.06383

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 57

Example 3.1. This is an activity to carry out in class, with each student or pair of students at a
computer.

1. Make sure you can replicate the calculations for the standard error of one of the statistics in the
TenMileRace example with a sample of size n = 100. Your reproduction wont be exact, but it
should be reasonably close.

2. Now repeat the calculations, but use sample sizes that are larger. From n = 100, increase to
n = 400, then n = 1600, then n = 6400. How does the standard error depend on n? Does larger
n lead to a bigger or smaller standard error? Which of these formulas most closely matches the
pattern you see:

(a) The standard error increases with n.



(b) The standard error increases with n.

(c) The standard error gets smaller with increasing n with the pattern 1/ n.
(d) The standard error gets smaller with increasing n with the pattern 1/n.

3. Use the pattern you observed to predict what will be the standard error for a sample of size
n = 1000. Then carry out the actual simulation of repeated sampling using that sample size
and compare your prediction to the result you actually got.

4. In the above, you used do(500) replications of random sampling. Suppose you use do(100)
or do(2000) replications instead? Do your results depend systematically on the number of
replications?

3.4.2 The Re-Sampling Distribution

The sampling distribution is a lovely theoretical thing. But if it were easy to replicate taking a sample
over and over again, wouldnt you just take a larger sample in the first place? The practical problem
you face is that the sample you took was collected with difficulty and expense. Theres no way you
are going to go back and repeat the process that was so difficult in the first place. Remember, real
samples from the real population (on planet Earth) cant be obtained by simply asking a computer
to sample for us.

This is where Planet Sample comes in.

In our example we
have access to the
entire population,
but this is not
Although Planet Earth is very large and we have only incomplete information about it, all the data typically the case.
for Planet Sample is in our computer. So

Although sampling from Planet Earth is difficult, sampling from Planet Sample is easy.

To illustrate, heres a sample from the running population:


> planet.sample = sample(population, 100) # one sample from the population

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


58 A Crash Course in Statistics for Biologists (and Their Friends)

In reality, of course, you wouldnt run a command to create the sample. You would go out and do the
hard work of randomly selecting cases from your population, measuring their relevant attributes, and
recording that data. So lets pretend thats what we did. Pretend that planet.sample is the result
of laborious data collection.

Now you can go through the exact calculations you did to construct the sampling distribution (on
Planet Earth), but instead sample from Planet Sample:
> with(sample(planet.sample,100), mean(age))
mean
35.58
> with(sample(planet.sample,100), mean(age))
mean
35.58
> with(sample(planet.sample,100), mean(age))
mean
35.58

Wait, something went wrong. We are getting the same mean every time. The reason is that Planet
Sample is small. It only has 100 inhabitants and we are sampling all 100 each time. We could take
smaller samples, but we want to learn about samples of the same size as our actual sample, so thats
not a good option.

Our solution to this problem is to sample with replacement. That is, we will select an inhabitant of
Planet Sample, record the appropriate data, and then put them back on the planet possibly selecting
Caution! that same inhabitant again later in our sample. Well call sampling with replacement from Planet
Remember to use Sample resampling for short. The resample() function in the mosaic package can do this as easily
resample() rather
than sample() to
as sampling without replacement.
compute a resam- > with(resample(planet.sample,100), mean(age))
pling distribution.
mean
36.44
> with(resample(planet.sample,100), mean(age))
mean
35.24
> with(resample(planet.sample,100), mean(age))
mean
35.78

Ah, that looks better. Now lets resample a bunch of times.5


> resample.means <- do(500) * with(resample(planet.sample,100), mean(age))
> resample.sds <- do(500) * with(resample(planet.sample,100), sd(age))
> resample.props <- do(500) * with(resample(planet.sample,100), mean(sex=="F"))
> resample.regressions <- do(500) * lm(net ~ age + sex, data=sample(planet.sample,100))

And, then, summarize the resulting distributions:


> sd(resample.means) # standard deviation of mean ages
mean
1.091
> sd(resample.sds) # standard deviation of sd of age
sd
1.079
5 By default, resample() will draw a sample as large as the population of Planet Sample, so we can drop the sample

size if we like.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 59

> sd(resample.props) # standard deviation of fraction female


mean
0.05169
> sd(resample.regressions) # standard deviation of resampled regression statistics
Intercept age sexM sigma r-squared
1.574e-12 1.648e-14 4.724e-13 1.571e-13 6.073e-17

> histogram( ~ mean, resample.means )

25
Percent of Total

20
15
10
5
0

34 36 38

mean

Sampling like this on Planet Sample, isnt quite the same as constructing the sampling distribution.
This is for the simple reason that it is being done on Planet Sample rather than Planet Earth.
To emphasize the distinction, its helpful to refer to the resulting distribution as the resampling
distribution in contrast to the sampling distribution.

Example 3.2. Have your students compare the results they get from resampling of a fixed sample of
size n, to repeated draws from the population with the same sample size n.

Emphasize that the resampling process is good for estimating the width of the sampling distribution,
but not so good for estimating the center. That is, the results on Planet Sample will generally compare
quite well to Planet Earth for the standard error, but the means of the sampling distributions and
the resampling distributions can be quite different.

In a more advanced class, you might ask how big a sample is needed to get a reasonable estimate of
the standard error. 
The question naturally arises, is the standard error estimated from the resampling distribution good
enough to use in place of the standard deviation of the actual sampling distribution. Answering this
question requires some solid sense of what you are using the standard error for. In general, we use
standard errors to get an idea of whether the point estimate is precise enough for the purpose at
hand. Such questions can be productively addressed on Planet Alt, where we will journey after a
short detour to that most boring of all places, Planet Null.

3.4.3 The Sampling Distribution Under the Null Hypothesis

The Null Hypothesis is often introduced in terms of the values of population parameters, e.g., The
population mean is 98.6, or The difference between the two group means is zero, or The population
proportion is 50%.

Perhaps this is fine if all you want to talk about is means or proportions or differences between means,
as is so often the focus of an introductory statistics course. But instructors would like to think that

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


60 A Crash Course in Statistics for Biologists (and Their Friends)

their students are going to go farther, and that the introductory course is meant to set them up for
doing so.

In the multi-planet metaphor, the Null Hypothesis is about a place where variables are unrelated
to one another. Any measured relationship, as indicated by a difference in sample means, a sample
correlation coefficient different from zero, non-zero model coefficients, etc., is, on Planet Null, just the
result of random sampling fluctuations.
Planet Null is, This formulation is very general and is not hard for students to understand. Ironically, it doesnt work
however, easy to
describe in the case
so well for the very simplest null hypotheses that are about single-group means or proportions, so it
of hypotheses about turns out to be easier to introduce the null hypothesis with the supposedly more complicated cases,
a single proportion. e.g., differences in means or proportions, regression coefficients, etc.
In fact, that is what
our Lady Tasting
Tea example did
(Section 3.3.1).

Like Planet Sample, Planet Null is a place that you construct. You construct it in a way that makes
the Null Hypothesis true, destroying relationships between variables. Youve already seen the process
in Section ??: randomization with shuffle. The basic idea is to treat relationships as a mapping
from the values of explanatory variables in each case to a response variable. By randomizing the
explanatory variables relative to the response, you generate the world in which the Null Hypothesis
holds true: Planet Null.

Examples

Lets look as some examples.

Example 3.3. The Whickham data set contains data from a 1970s sample of 1314 residents of
Whickham, a mixed urban and rural district near Newcastle upon Tyne, in the UK. Did more than
half of the adult residents of Whickham smoke at that time?

We could use the same approach that worked for the Lady Tasting Tea, but well do things a little
differently this time. First, lets take a quick look at some of the data.
> n <- nrow(Whickham); n
[1] 1314
> head(Whickham,3)
outcome smoker age
1 Alive Yes 23
2 Alive Yes 18
3 Dead Yes 71

Well answer our question by comparing the smoking rate on Planet Sample
> with(Whickham, proptable(smoker)) # less than 50% of sample smoke
smoker
No Yes
0.5571 0.4429

to the sampling distribution on Planet Null.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 61

> planet.null <- data.frame( smoker=c('Yes','No') ) # equal mix of Yes and No on Planet Null
> null.dist <- do(2000) * with( resample(planet.null, n), proptable(smoker) )
> head(null.dist,3)
No Yes
1 0.4985 0.5015
2 0.4909 0.5091
3 0.4939 0.5061
> table(with(null.dist, Yes < .4429))
FALSE
2000

2000 of our 2000 samples from Planet Null had a proportion of smokers smaller than the proportion
on Planet Sample. It does not appear that our sample came from Planet Null.

> histogram( ~ Yes, null.dist, main='Sampling distribution of smoking proportion')

Sampling distribution of smoking proportion


Percent of Total

25
20
15
10
5
0

0.44 0.46 0.48 0.50 0.52 0.54

Yes


Example 3.4. Do the foot widths differ between boys and girls, judging from the KidsFeet data?
> data(KidsFeet) Conceptually, this
> lm( width ~ sex, data=KidsFeet ) # our sample example can be done
without the use of
...
lm(), but the syntax
(Intercept) sexG is trickier. lm()
9.190 -0.406 takes care of com-
puting the means
Looks like girls feet are a little bit narrower. But is this the sort of thing we might equally well see of the two groups
on Planet Null, where there is no systematic difference between boys and girls feet? and the difference
in those means. See
> do(1) * lm( width ~ shuffle(sex), data=KidsFeet ) # planet null Section ??.
Intercept sexG sigma r-squared
1 8.92 0.1484 0.5108 0.02175

For this particular sample from Planet Null, the girls feet are a little wider than the boys. By
generating a sampling distribution on Planet Null, we can see the size of the relationship to be
expected just due to sampling fluctuations in a world where there is no relationship.
> # (approximate) distribution on planet null
> planet.null <- do(500) * lm( width ~ shuffle(sex), data=KidsFeet )
> head(planet.null,2)
Intercept sexG sigma r-squared
1 8.815 0.3639 0.4815 0.13079
2 8.940 0.1074 0.5135 0.01138

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


62 A Crash Course in Statistics for Biologists (and Their Friends)

> with( planet.null, mean(abs(sexG) > abs(-0.4058)) ) # a p-value


mean
0.012

The value of 0.4058 observed in our sample is not very likely on Planet Null. This suggests that our
sample was not collected from Planet Null: we can reject the Null Hypothesis.


Example 3.5. Is the survival rate for smokers different from that for non-smokers?
> do(1) * lm( outcome=="Alive" ~ smoker, data=Whickham ) # from our sample
Intercept smokerYes sigma r-squared
1 0.6858 0.07538 0.4482 0.006941
> do(1) * lm( outcome=="Alive" ~ shuffle(smoker), data=Whickham ) # planet null
Intercept smokerYes sigma r-squared
1 0.7145 0.01061 0.4497 0.0001374
> # distribution on planet null
> null.distribution = do(500) * lm( outcome=="Alive" ~ shuffle(smoker), data=Whickham )
> with(null.distribution, mean( abs(smokerYes) > abs(0.07538) ) ) # a p-value
mean
0

If youre shocked to see that smoking is associated with greater likelihood of being alive (7.5 percentage
points greater!) and that the data indicate that this is statistically significant, you should be. But
the problem isnt with the calculation, which is the same one you will get from the textbook formulas.
The problem is with the failure to take into account covariates. Whats shocking is that we teach
students about p-values without teaching them about covariates and how to adjust for them.

The big covariate here is age. It happens that in the Whickham data, younger people are more likely
to smoke. To see this you :
> do(1) * lm( smoker=="Yes" ~ age, data=Whickham ) # our sample
Intercept age sigma r-squared
1 0.5961 -0.003264 0.4938 0.01311
> do(1) * lm( smoker=="Yes" ~ shuffle(age), data=Whickham ) # under the null
Intercept age sigma r-squared
1 0.4694 -0.0005652 0.497 0.0003931
> # distribution on planet null
> null.distribution <- do(500) * lm(smoker=="Yes" ~ shuffle(age), data=Whickham )
> with(null.distribution, mean(abs(age) > abs(-0.00326)) ) # approx. p-value
mean
0

So, greater age is associated with lower smoker status. And, of course, older people are more likely to
die. Taking both factors together, it turns out that smokers are less likely to die, but thats because
they are young. 
Example 3.6. Lets make up for the deficiency in the above smoking example. One way to do this
is to adjust for age when considering the effect of smoker status. Well consider this more in Chapter
??, but for now, well just build the model.
> # our sample on planet Earth
> do(1) * glm( outcome=="Alive" ~ smoker + age, data=Whickham, family="binomial" )
Intercept smokerYes age
1 7.599 -0.2047 -0.1237

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 63

> # o sample on planet null


> do(1) * glm( outcome=="Alive" ~ shuffle(smoker) + age, data=Whickham, family="binomial" )
Intercept smokerYes age
1 7.393 0.02131 -0.1219
> # distribution on planet null
> null.distribution <- do(500) * glm( outcome=="Alive" ~ shuffle(smoker) + age,
data=Whickham, family="binomial" )
> with(null.distribution, mean(abs(smokerYes) > abs(-0.205)) ) # approx. p-value
mean
0.222

You can see that the coefficient on smokerYes is negative, and that the p-value indicates significance.
So, smoking in these data are associated with a lower probability of survival, but only when adjusting
for age.

You might have noticed that the model built here was a logistic model. Theres good reason to do that,
since we are modeling probabilities the value of which must always be between 0 and 1. But notice
also that the logic of hypothesis testing remains the same: construct a Planet Null by randomizing
an explanatory variable with respect to a response variable. 
As this is being written, the US Space Shuttle is carrying out its last couple of missions before being
retired. For a few years, at least, your students will know what you mean by Space Shuttle. You
can help them remember the way to create Planet Null if, at the cost of some self-dignity, you tell
them, Take the Space Shuffle to Planet Null.

3.4.4 The Sampling Distribution Under the Alternative Hypothesis

Planet Alt is the place where we implement our theories of how the world works. This will seem like
an odd statement to those who are familiar with the standard introductory textbook formulation of
the alternative hypothesis in its anything but the Null form, e.g., Ha : 1 6= 2 . Move away from
that formulation, whose only point seems to be to inform whether to do a one-tailed or a two-tailed
test.

Instead head off to Planet Alt.

How do you get there? You build a simulation of the world as you think it might be.

Example 3.7. To illustrate, imagine that you are interested in researching the potential relationship
between vitamin D deficiency and high blood pressure. Your eventual plan is to do a study, perhaps
one where you draw blood samples to measure vitamin D levels, and correlate this with high blood
pressure. From your previous experience, you know that high blood pressure is particularly a problem
in men aged 50 and older, and that black men seem to be more susceptible than whites.

You scour the literature, looking for data on vitaminD and blood pressure. What you find are some
papers describing vitamin D levels in blacks and whites, and that, on average, blacks seem to have
substantially lower vitamin D levels than whites. Theres also data on high blood pressure, but no
good study relating vitamin D to blood pressure. Thats a problem, but its also the source of your
research opportunity.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


64 A Crash Course in Statistics for Biologists (and Their Friends)

You form your alternative hypothesis based on your idea of a world in which the relationship between
vitamin D and blood pressure is large enough to be interesting at a clinical level, but small enough to
The instructor have been missed by past research. You decide a substantial but typical deficiency in vitamin D will,
would provide this
on average lead to a 5mmHg increase in systolic blood pressure.
function to the
students.
Now, to construct Planet Alt:
> planet.alt = function(n=10,effect.size=1) {
race = resample( c("B","B","W","W","W"), n)
D = pmax(0, rnorm(n,mean=(37.7+(71.8-37.7)*(race=="W")),
sd=(10+(20-10)*(race=="W"))))
systolic = pmax(80, rnorm(n,mean=130,sd=8) +
rexp(n,rate=.15) +
effect.size*(30-D)/2 )
return( data.frame(race=race,
D=D,
systolic=round(systolic)) )
}

The internals of such a function is not for the faint of heart. Youll see that it creates people that are
randomly of race B or W, and in a proportion that you might choose if you were sampling with the
intent of examining seriously the role that race plays. The vitamin D level is set, according to your
findings in the literature, to have a mean of 37.7 for blacks and 71.8 for whites. The standard deviations
also differ between blacks and whites. Finally, the systolic blood is set to produce a population that
is a mixture of a normal distribution around 130 mmHg with an exponential tail toward high blood
pressure. A drop of vitaminD levels of 10 units leads to an increase in blood pressure of 5 mmHg.
Theres a parameter, effect.size that will allow you to change this without re-programming.

You might not agree with this specific alternative hypothesis. Thats fine. You can make your own
Planet Alt. There are plenty to go around!

In contrast to the complexity of writing the simulation, using it is simple. Heres a quick study of size
n = 5:
> planet.alt(5)
race D systolic
1 W 54.28 118
2 B 45.09 126
3 B 23.74 136
4 B 48.27 139
5 B 34.91 137


Example 3.8. In this example we construct Planet Alt for a comparison of two means.
> alt.2.groups <- function(n=10, effect.size=1, sd=1, baseline=0){
n <- rep(n, length.out=2)
sd <- rep(sd, length.out=2)
data.frame(
y = c( rnorm(n[1], baseline, sd[1]), rnorm(n[2], baseline+effect.size, sd[2])),
group = rep(c('A','B'), n)
)
}

> alt.2.groups(3)
y group
1 -0.5794 A
2 -0.5298 A
3 0.6280 A

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 65

4 -0.3159 B
5 -0.5045 B
6 0.1617 B


Well discuss how to use such simulations to compute power in Section ??.

3.5 Taking Randomness Seriously

Its tempting to think that random means that anything goes. This is, after all, the everyday
meaning of the word. In statistics, though, the point of randomness is to get a representative sample,
or to assign experimental treatments in some fairly even way. Using randomness properly means
taking care and being formal about where the randomness comes from. When you finally submit
the research paper you have written after your long years of labor, you dont want it to be rejected
because the reviewer isnt convinced that what you called random was really so.

First, to demonstrate that the sort of computer-generated random sampling produces reasonable
results. Perhaps its a little too early in the course to talk about sampling distributions, but you
certainly can have your class generate random samples of a reasonable size and show that sample
statistics are reasonably close to the population parameter. For instance, have each student in your
class do this:
> with(SAT, mean(ratio))
mean
16.86
> with(sample(SAT,25), mean(ratio))
mean
16.44
To Do
Well have more
Or, each student can do this several times: to say about do()
> do(5) * with(sample(SAT,25), mean(ratio)) shortly.

mean
1 17.04
2 16.60
3 17.15
4 17.01
5 17.17

This raises the question, naturally enough, of what reasonably close means, and what it means
to measure how close. Eventually, that might lead you into consideration of differences, mean
differences, mean square differences, and root mean square differences: the standard deviation and
variance. But even before encountering this formality the students should be able to see that there
is nothing systematically wrong with the answers they get from their random samples. Some are too
high compared to the population parameter, some are too low, but as a group they are pretty well
centered.

For some applications it is useful to have an alternative vocabulary. If you are fond of examples
involving cards, you can use deal() and shuffle() instead of sample().
> # These are equivalent
> sample(cards, 5)
[1] "6D" "10S" "9H" "JD" "KH"
> deal(cards, 5)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


66 A Crash Course in Statistics for Biologists (and Their Friends)

[1] "3C" "JS" "JH" "AC" "QS"

> # These are equivalent


> sample(cards)
[1] "2C" "3H" "QD" "KC" "8C" "6S" "9D" "3D" "7C" "8H" "10C" "7H" "AS"
[14] "9S" "8D" "10S" "2S" "4C" "QC" "7D" "5S" "4H" "6H" "7S" "9C" "KH"
[27] "6C" "JD" "3C" "KS" "AD" "5D" "2H" "4S" "AH" "QH" "2D" "AC" "4D"
[40] "JC" "9H" "JS" "KD" "JH" "5H" "6D" "10H" "QS" "10D" "8S" "5C" "3S"
> shuffle(cards)
[1] "9S" "6S" "JS" "7C" "4H" "KH" "QH" "6C" "9C" "JC" "8C" "5H" "2S"
[14] "5C" "KD" "10H" "3S" "8D" "9H" "8S" "9D" "2C" "AC" "2D" "4C" "7D"
[27] "5S" "3C" "10D" "8H" "2H" "6D" "JD" "4S" "KC" "AH" "QD" "QC" "3D"
[40] "AS" "10C" "KS" "10S" "QS" "7S" "6H" "AD" "3H" "4D" "7H" "JH" "5D"

And for sampling with replacement, we offer resample():


> # These are equivalent
> sample(1:10, 5, replace=TRUE)
[1] 8 8 8 7 4
> resample(1:10, 5)
[1] 2 4 6 4 4

3.5.1 Illuminating Sampling Mistakes

Its helpful at this point to have some examples where an informal or careless approach to randomness
leads to misleading results.

Here are some that can be visually compelling:

1. Select books off a library shelf and count how many pages are in each book. When students
pick books haphazardly, they get a systematic over-estimate of the page length.
A random sample of 25 is sufficient to see this for the large majority of students in the class.
Going up to 50, though tedious, makes the result even more compelling.

2. A simulation of a real-world study of Alzheimers disease. The sampling process was to go


to nursing homes on a given day and randomly pick out patients who were diagnosed with
Alzheimers. Their files were flagged and, after a few years, the data were examined to find the
mean survival time, from when they entered the nursing home to when they died.

3. Sample people and find out how many siblings are in their family (including themselves). Use
this data to estimate family size. Since larger families have more children, we will over-sample
larger families and over-estimate family size. Section 3.5.4 demonstrates how to fake a data
set for this activity. But for the present, we can use the Galton dataset and pretend to take a
sample of, say, size 300 kids from the whole group of children that Galton had assembled.
> data(Galton)
> with(sample(Galton,300), mean(nkids))
mean
6.163
> with(sample(Galton,300), mean(nkids))
mean
6.153
> do(5) * with(sample(Galton,300), mean(nkids))

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 67

mean
1 6.093
2 6.100
3 6.180
4 6.093
5 6.127
The samples all give about the same answer: about 6 kids in a family. But this is misleading!
The case in the Galton data is a child, and families with more children have their family size
represented proportionally more.
There are several ways to convert the Galton to a new data set where the case is a family. The
key information is contained in the family variable, which has a unique value for each family.
The duplicated function identifies levels that are repeats of earlier ones and so the following
will do the job (although is not necessarily something that you want to push onto students):
> families = subset(Galton, !duplicated(family))
Of course, you will want to show that this has done the right job. Compare
> nrow(families)
[1] 197
to
> length(with(Galton, unique(family)))
[1] 197
Now check out the average family size when the average is across families, not across kids in
families:
> with( families, mean(nkids) )
mean
4.563
(Note: In a higher-level course, you could ask students to determine a method to correct for this
bias.)
4. Using googleMap() (see Section 5.2.1) we can compare uniform sampling of longitude and
latitude with correct sampling that takes into account that the earth is a sphere, not a cylinder.

In each of these cases, follow up the haphazard or systematically biased sample with a formally
generated sample (which is faster to do, in any event) and show that the formally generated sample
gives results that are more representative of the population than the haphazardly sampled data.

3.5.2 Sampling from Distributions

Later in the course, if you cover modeling with distributions, you can sample from these distributions
instead of from data sets (treated like populations). R includes set of functions beginning with the
letter r followed by the (abbreviated) name of a family of distributions (see Table ?? in section ??
for a list of probability distributions available within base R). These functions all generate a random
sample from the distribution given a sample size and any necessary parameters for the distribution.
> rnorm(20, mean=500, sd=100) # fake SAT scores
[1] 398.7 411.2 610.9 560.6 574.2 493.1 521.4 394.1 641.6 417.4 622.5 480.6 462.1
[14] 416.1 524.6 461.1 479.3 609.1 320.0 534.4
> rexp(20, rate=1/5) # fake lifetime data
[1] 2.5392 23.7481 6.6444 4.9789 7.4664 0.6798 3.8735 1.4669 3.7953 2.9426
[11] 5.8247 0.0562 0.3942 3.3576 6.6171 8.6953 1.9079 1.3481 3.8390 5.5996

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


68 A Crash Course in Statistics for Biologists (and Their Friends)

> rbinom(20, 10, .5) # how many heads in 10 coin tosses?


[1] 5 8 5 3 4 8 6 6 3 5 6 4 3 7 6 7 6 6 7 4
> rgeom(20, .1) # how long until Freddy misses his next free throw?
[1] 0 5 9 19 39 0 10 9 1 6 5 20 6 11 0 16 0 17 40 11

The mosaic package offers rdata() as an alternative to resample() with syntax that mirrors these
functions for sampling from a distribution.
> rdata(20, 1:4) # samples with replacement
[1] 4 2 4 2 4 3 2 2 4 1 4 4 1 1 1 4 1 4 4 1
> set.seed(123)
> # these are equivalent; note the order of the arguments.
> resample(HELP, 2)
age anysubstatus anysub cesd d1 daysanysub dayslink drugrisk e2b female sex g1b
131 49 1 yes 22 5 1 126 0 4 0 male yes
358 36 1 yes 36 3 3 362 0 NA 0 male no
homeless i1 i2 id indtot linkstatus link mcs pcs pss_fr racegrp satreat
131 homeless 64 179 144 42 1 yes 45.49 38.14 5 black no
358 housed 25 42 430 37 0 no 45.86 14.07 8 white no
sexrisk substance treat
131 6 alcohol yes
358 4 alcohol no
> rdata(2, HELP)
age anysubstatus anysub cesd d1 daysanysub dayslink drugrisk e2b female sex
186 43 NA <NA> 36 1 NA 18 0 NA 1 female
401 29 NA <NA> 28 2 NA 118 2 1 0 male
g1b homeless i1 i2 id indtot linkstatus link mcs pcs pss_fr racegrp satreat
186 yes housed 58 58 219 40 1 yes 36.10 37.04 11 black yes
401 no homeless 43 54 161 43 1 yes 28.48 45.82 7 white no
sexrisk substance treat orig.ids
186 2 alcohol yes 186
401 6 alcohol yes 401
> set.seed(123)
> # these are equivalent; sampling without replacement now.
> sample(HELP, 2)
age anysubstatus anysub cesd d1 daysanysub dayslink drugrisk e2b female sex g1b
131 49 1 yes 22 5 1 126 0 4 0 male yes
357 26 1 yes 23 4 106 410 0 NA 0 male no
homeless i1 i2 id indtot linkstatus link mcs pcs pss_fr racegrp satreat
131 homeless 64 179 144 42 1 yes 45.49 38.14 5 black no
357 housed 6 6 428 15 0 no 38.28 36.49 5 black no
sexrisk substance treat orig.row
131 6 alcohol yes 131
357 3 heroin no 357
> rdata(2, HELP, replace=FALSE)
age anysubstatus anysub cesd d1 daysanysub dayslink drugrisk e2b female sex
186 43 NA <NA> 36 1 NA 18 0 NA 1 female
400 31 NA <NA> 45 5 NA 365 5 NA 0 male
g1b homeless i1 i2 id indtot linkstatus link mcs pcs pss_fr racegrp satreat
186 yes housed 58 58 219 40 1 yes 36.1 37.04 11 black yes
400 yes housed 26 26 159 33 0 no 15.6 47.66 4 hispanic yes
sexrisk substance treat orig.ids
186 2 alcohol yes 186
400 2 heroin yes 400

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


A Crash Course in Statistics for Biologists (and Their Friends) 69

3.5.3 do()

The heart of a simulation is doing something over and over. The do() function simplifies the syntax
for this and improves the output format (usually returning a data frame). Heres a silly example.
> do(3) * "hello"
result
1 hello
2 hello
3 hello

Thats a silly example, because we did the same thing each time. If we add randomness, then each
replication is (potentially) different:
> do(3) * rflip(10) # 3 times we flip 10 coins
n heads tails
1 10 6 4
2 10 8 2
3 10 1 9

What makes do() clever is that is knows about several types of things we might like to repeat and
it tries to keep track of the most important summary statistics for us. If we fit a linear model, for
example, do() keeps track of the regression coefficients, , and r2 . That makes it useful even if we
just want to summarize our data.
> do(1) * lm( age ~ sex, HELP) # using the data as is
Intercept sexmale sigma r-squared
1 36.25 -0.7841 7.712 0.00187

But it really shines when we start looking at sampling distributions.


> do(3) * lm( age ~ shuffle(sex), HELP) # simulation under a null hypothesis
Intercept sexmale sigma r-squared
1 36.28 -0.8208 7.711 0.0020493
2 34.64 1.3205 7.698 0.0053031
3 35.83 -0.2335 7.718 0.0001658

3.5.4 Generating Fake Data For Sampling Activities

If you dont have actual data at your disposal, you can sometimes simulate data to illustrate your
point.

Example 3.9. (Fake Families) Well simulate 5000 families using a Poisson distribution with
a mean of 3 to generate family size. (You can make up whatever elaborate story you like for the This example is in-
tended for instruc-
population you are considering.)
tors, not for stu-
> families <- data.frame(familyid=1:5000, children=rpois(5000,3)) dents.

Now we generate the people in these families


> people <- data.frame(
familyid = with(families, rep( familyid, children)),
sibs = with(families, rep( children, children))
)

Computing the mean family size two different ways reveals the bias of measuring family size by
sampling from children rather than from families.
> with(families, mean(children))

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


70 A Crash Course in Statistics for Biologists (and Their Friends)

mean
2.993
> with(people, mean(sibs))
mean
3.979

If the result seems mysterious, the following tables might shed some light.
> with(families, table(children))
children
0 1 2 3 4 5 6 7 8 9 10 12
253 725 1141 1120 848 510 247 95 45 11 4 1
> with(people, table(sibs))
sibs
1 2 3 4 5 6 7 8 9 10 12
725 2282 3360 3392 2550 1482 665 360 99 40 12


Once built, you can provide these data frames to your students for a sampling exercise. (See Sec-
tion 5.1.)

Now that we have discussed various methods for generating random data, its time to put those skills
to good use computing p-values.

3.6 Exercises, Problems, and Activities

3.1

a) Write an alternative-hypothesis simulation where there are two groups: A and B. In your alter-
native hypothesis, the population mean of A is 90 and the population mean of B is 110. Let the
standard deviation be 30 for group A and 35 for group B.
b) Youve got two different suppliers of electronic components, C and D. You hypothesize that
one of them, D, is somewhat defective. Their components have a lifetime thats distributed
exponentially with a mean lifetime of 1000. Supplier C is better, you think, and meets the
specified mean lifetime of 2000.
Write an alternative hypothesis simulation of the two suppliers.

3.2 Whats the distribution of p-values under the Null Hypothesis?


Many students seem to think that if the Null is true, the p-value will be large. It can help to show
whats really going on.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 71

Some Biology Specific Applications of R


4
Several of the examples in this chapter are modifications of things found in the online
book A Little Book of R for Bioinformatics available via
http://readthedocs.org/docs/a-little-book-of-r-for-bioinformatics/
Data used in this chapter are available at
http://www.calvin.edu/~rpruim/talks/SC11/Seattle/Data/
and in the Data folder inside the SC11materials folder in the RStudio server on dahl.

In this chapter we will make use of several specialty package. Check that they are installed and loaded,
and install or load them as necessary before continuing.
> library(seqinr)
> library(ape)
> library(phangorn)
> source("http://bioconductor.org/biocLite.R")
> biocLite() # install core of Bioconductor (could take a while)
> biocLite('Biostrings') # install Biostrings package from Bioconductor
> library(Biostrings) # don't forget to load it after installation

4.1 Working With Sequence Data

4.1.1 Reading from FASTA files

FASTA file format is one common way that sequence data is stored. Here is a toy example that shows
a simple FASTA file with 8 sequences:

>1
GTTAGAG
>2
GTTAGCG
>3
ATCATTA
>4
ATCAATA
>5

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


72 Some Biology Specific Applications of R

GATCGAC
>6
GATCGAG
>7
AATCAAG
>8
AATCAAA

Suppose you have a FASTA file and you want to manipulate the data it contains in R. The seqinr
package includes a function for reading in such data.
> read.fasta('http://www.calvin.edu/~rpruim/talks/SC11/Data/8planets.fasta') -> planets

The variable planets now contains the eight planet sequences in a list.
> class(planets)
[1] "list"
> length(planets)
[1] 8

We can access individual elements of a list in R using the double-square-bracket operator. Each
element includes the nucleotide sequence as well as some additional information.
> planets[[1]] -> mercury; mercury
[1] "g" "t" "t" "a" "g" "a" "g"
attr(,"name")
[1] "1"
attr(,"Annot")
[1] ">1 "
attr(,"class")
[1] "SeqFastadna"
> class(mercury)
[1] "SeqFastadna"
> length(mercury)
[1] 7
> table(mercury)
Digging Deeper mercury
This is part of a g t
the object ori- 2 3 2
ented nature of R.
When an object is
printed, R looks for
Each sequence is stored in a SeqFastadna object, but the default display of these objects is pretty ugly.
a function called If we like, we can change what displays when an object of class SeqFastadna is printed by writing a
print.class(), function.
where class is
the class of the > print.SeqFastadna <- function(x,...) {
object. If it find cat( paste( attr(x,'name'),' [', attr(x,'Annot'), "]: ", sep="" ) );
this function, thats if ( length(x) <= 10 ) {
what it uses. If cat( x )
not, then it uses
} else {
print.default().
cat( paste( x[1: 10] ) )
cat('...')
}
cat('\n')
}
> mercury
1 [>1 ]: g t t a g a g

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 73

Alternatively, we can use the c2s() function to convert the main sequence data from a sequence of
characters to a single string.
> c2s(mercury)
[1] "gttagag"

A s2c() function exists for going in the other direction as well.


> s2c('aaccggtt')
[1] "a" "a" "c" "c" "g" "g" "t" "t"

Here is a more interesting example, this time using amino acid sequences:
> read.fasta('http://www.calvin.edu/~rpruim/talks/SC11/Data/toxins.fasta') -> toxins
> length(toxins)
[1] 60
> toxins[[1]] # uses our newly defined print() method
KA125_LYCMC [>KA125_LYCMC]: m n k l p i l i f m... Digging Deeper
sapply() applies a
> table(toxins[[1]]) function to each el-
ement of a list or
- a c d e f g h i k l m n p q r s t v y vector and returns
6 1 8 2 1 2 4 2 4 4 4 4 2 2 1 3 8 3 2 3 a vector of values.
lapply() is similar
> sapply(toxins, length) but returns a list.
KA125_LYCMC KA127_LYCMC KA121_TITSE KA122_TITTR KA124_TITST KA123_TITCO KA159_LYCMC apply() can apply a
function to rows or
66 66 66 66 66 66 66
columns of a matrix.
KAX_BUTOS KA162_MESMA KA163_MESMA KA3B_BUTEU KAX17_LEIQH KA161_MESTA KAX11_LEIQH
66 66 66 66 66 66 66
KAX1C_LEIQH KAX1D_LEIQH KAX12_LEIQH KAX16_MESMA KAX15_MESMA KAX14_CENLM KAX1B_CENNO
66 66 66 66 66 66 66
KAX13_MESTA KAX1A_PARTR KAX41_TITSE KAX46_TITST KAX45_TITCO KAX44_TITCA KAX43_TITDI
66 66 66 66 66 66 66
KAX19_CENLM KAX28_CENEL KAX29_CENEL KAX21_CENNO KAX2B_CENEL KAX2C_CENEL KAX22_CENMA
66 66 66 66 66 66 66
KAX25_CENLM KAX23_CENLL KAX2A_CENEL KAX2D_CENSU KAX32_LEIQH KAX33_LEIQH KAX34_LEIQH
66 66 66 66 66 66 66
KAX31_ANDMA KAX37_ORTSC KAX24_CENNO KAX64_PANIM KAX6D_HETSP KAX69_OPICA KAX62_SCOMA
66 66 66 66 66 66 66
KAX6A_OPICA KAX6F_HEMLE KAX72_PANIM KAX66_OPICA KAX67_OPICA KAX68_OPICA KAX63_HETSP
66 66 66 66 66 66 66
KAX6E_HADGE KAX6C_ANUPH KAX6B_OPIMA KAX52_ANDMA
66 66 66 66

This output shows us the names and lengths of the 60 toxin sequences.

4.1.2 GC content

For DNA sequences, it is easy to compute GC content either by hand:


> proptable( planets[[1]] %in% c('g','c') )
FALSE TRUE
0.5714 0.4286

or using the GC() function.


> GC( planets[[1]] )
[1] 0.4286

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


74 Some Biology Specific Applications of R

The GC() function is not only simpler, but it knows more. It can also handle amino acid sequences
and can make an estimate even when there is missing or ambiguous data.
Digging Deeper
GC1(), GC2(), and
> GC(toxins[[1]])
GC3() can be used [1] 0.75
to get GC content in
positions 1, 2, or 3 of
codons.
Now lets calculate the GC content for each toxin and display the results in a histogram.

> sapply(toxins, GC) -> toxinGC; toxinGC


KA125_LYCMC KA127_LYCMC KA121_TITSE KA122_TITTR KA124_TITST KA123_TITCO KA159_LYCMC
0.7500 0.5000 0.6471 0.6471 0.6471 0.6875 0.6667
KAX_BUTOS KA162_MESMA KA163_MESMA KA3B_BUTEU KAX17_LEIQH KA161_MESTA KAX11_LEIQH
0.6667 0.6316 0.6471 0.7143 0.7500 0.8000 0.6000
KAX1C_LEIQH KAX1D_LEIQH KAX12_LEIQH KAX16_MESMA KAX15_MESMA KAX14_CENLM KAX1B_CENNO
0.6000 0.6364 0.6429 0.6250 0.7500 0.6923 0.6429
KAX13_MESTA KAX1A_PARTR KAX41_TITSE KAX46_TITST KAX45_TITCO KAX44_TITCA KAX43_TITDI
0.9000 0.8000 0.7143 0.7143 0.7857 0.6667 0.5882
KAX19_CENLM KAX28_CENEL KAX29_CENEL KAX21_CENNO KAX2B_CENEL KAX2C_CENEL KAX22_CENMA
0.5333 0.6923 0.6923 0.6923 0.6923 0.6923 0.6429
KAX25_CENLM KAX23_CENLL KAX2A_CENEL KAX2D_CENSU KAX32_LEIQH KAX33_LEIQH KAX34_LEIQH
0.6429 0.7692 0.9091 0.7692 0.7692 0.7692 0.7857
KAX31_ANDMA KAX37_ORTSC KAX24_CENNO KAX64_PANIM KAX6D_HETSP KAX69_OPICA KAX62_SCOMA
0.8333 0.8333 0.6429 0.7500 0.8462 0.5000 0.7333
KAX6A_OPICA KAX6F_HEMLE KAX72_PANIM KAX66_OPICA KAX67_OPICA KAX68_OPICA KAX63_HETSP
0.6667 0.7692 0.6667 0.5652 0.5455 0.5000 0.7143
KAX6E_HADGE KAX6C_ANUPH KAX6B_OPIMA KAX52_ANDMA
0.7333 0.7692 0.5294 0.9000
> histogram( ~ toxinGC)
Percent of Total

25
20
15
10
5
0

0.5 0.6 0.7 0.8 0.9

toxinGC

4.1.3 Sliding Windows of GC Content

For a longer sequence, it can be interesting to see how the GC content changes across the length of
the sequence. A sliding windows approach helps us do this.
> dengue <- read.fasta('http://www.calvin.edu/~rpruim/talks/SC11/Data/DengueFever.fasta')
> dengueseq <- dengue[[1]]

> windowGC <- function(x, windowSize=round(length(x)/100) ){


positions <- (windowSize+1):(length(x) - windowSize)
data.frame(
GC=sapply( positions, function(n) {GC(x[(n-windowSize):(n+windowSize)])}),
pos = positions

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 75

)
}

> xyplot( GC ~ pos, data=windowGC(dengueseq) , cex=.05, type='l')

0.60

0.55
GC

0.50

0.45

0.40

0 2000 4000 6000 8000 10000

pos

4.1.4 Counting k-words

A k-word is a subsequence of k consecutive letters (bases or codons).


> alphabet = sort(unique(toxins[[5]]))
> count(toxins[[5]], 1, alphabet=alphabet) -> c1; c1[c1>0]

- a c d e f g h k l m n p r s t w y
26 4 8 2 1 2 3 1 3 2 1 2 1 3 2 2 1 2

> count(toxins[[5]], 2, alphabet=alphabet) -> c2; c2[c2>0]

-- -c -k -w a- af ah as cf cg cl cm cr cs cy dl dp ec fg fk g- ga gr hg ka kc la ld
22 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1
mn nk nn pc ra rc re sr st t- tc wc yd yt
1 1 1 1 1 1 1 1 1 1 1 1 1 1

> count(toxins[[5]], 3, alphabet=alphabet) -> c3; c3[c3>0]

--- --c --w -cg -kc -wc a-- afg ahg asr cfk cga cld cmn crc cst cyd cyt dla dpc ecy
19 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1
fgr fka g-k gas gra hg- kaf kcm kcr la- ldl mnn nkc nnk pcf rah rcy rec sre stc t--
1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1
tcl wcs ydp yt-
1 1 1 1

4.2 Obtaining Sequence Data

4.2.1 Via Your Browser

You can get sequence data for your favorite organisms at http://www.ncbi.nlm.nih.gov.

Enter your search criterion and click on Search.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


76 Some Biology Specific Applications of R

Then choose Nucleotide (or protein) on the next page, and then select the particular sequence or
sequences you want here:

Finally, click on FASTA here

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 77

and use copy and paste to save the file.

4.2.2 Searching Sequence Databases from Within R


Caution!
We have already seen that you can work with any sequences you can find in fasta format, so all of the While the func-
web utilities you know and love that can export in fasta format are now sources for data you can use tionality provided
by seqinr is very
in R. seqinr also provides some facilities for searching databases from inside R.
useful, some of the
design choices made
The seqinr package was written by the group that created the ACNUC database in Lyon, France by the authors could
(http://pbil.univ-lyon1.fr/databases/acnuc/acnuc.html). The ACNUC database is a database have been better.
that contains most of the data from the NCBI Sequence Database, as well as data from other sequence
databases such as UniProt and Ensembl. Here is a list of available databases.
> choosebank()
[1] "genbank" "embl" "emblwgs" "swissprot" "ensembl"
[6] "hogenom" "hogenomdna" "hovergendna" "hovergen" "hogenom4"
[11] "hogenom4dna" "homolens" "homolensdna" "hobacnucl" "hobacprot"
[16] "phever2" "phever2dna" "refseq" "nrsub" "greviews"
[21] "bacterial" "protozoan" "ensbacteria" "ensprotists" "ensfungi"
[26] "ensmetazoa" "ensplants" "mito" "polymorphix" "emglib"
[31] "taxobacgen" "refseqViruses"

Alas, the ACNUC sub-databases do not have a one-to-one correspondence with the NCBI sub-
databases (the NCBI Protein database, NCBI EST database, NCBI Genome database, etc.)!

Three of the most important sub-databases in ACNUC which can be searched from R are:

genbank: this contains DNA and RNA sequences from the NCBI Sequence Database, except for
certain classes of sequences (eg. draft genome sequence data from genome sequencing projects)

refseq: this contains DNA and RNA sequences from Refseq, the curated part of the NCBI
Sequence Database

refseqViruses: this contains DNA, RNA and proteins sequences from viruses from RefSeq

You can find more information about what each of these ACNUC databases contains by looking at
the ACNUC website.

Searching for sequences is done by

1. choosing a databse with choosebank()

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


78 Some Biology Specific Applications of R

> choosebank('refseq')

2. forming a query and using query() to get the results.


The query language allows us to search by accession, author, keyword, journal, journal reference
(journal, volume, page), etc. See the documentation for query() to get a full description of the
queries that are possible. This examples would (if we ran it) find all the human sequences in
refSeq.
> choosebank('refseq')
> query('queryResults', "SP=Homo sapiens")
Caution! > queryResults
Please dont all run
this query simulta- 45345 SQ for SP=Homo sapiens
neously. Thanks,
the Management.
A more modest (and responsive) query uses a narrower search:
> choosebank("swissprot")
> query("twoProteins", "AC=Q9CD83 or AC=A0PQ23")

3. looking through the results of the search to identify the sequence(s) of interest.
In this case we are interested in both.
> twoProteins
2 SQ for AC=Q9CD83 or AC=A0PQ23
These objects contain information about the results of our query. For example, we can find out
a bit about each sequence that was located.
> twoProteins$req
[[1]]
name length frame ncbicg
"A0PQ23_MYCUA" "212" "0" "1"

[[2]]
name length frame ncbicg
"PHBS_MYCLE" "210" "0" "1"

4. retrieving the sequence(s) from the database.


The command above does not actually fetch the sequence data, only meta-data about the se-
quences. Now lets fetch the sequences of interest.
> lepraeseq <- getSequence(twoProteins$req[[1]])
> ulceransseq <- getSequence(twoProteins$req[[2]])
> bothseq <- getSequence(twoProteins$req)
> class(lepraeseq)
[1] "character"
> class(bothseq)
[1] "list"
And take a little look
> c2s(bothseq[[1]][1:50])
[1] "MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEI"
> c2s(lepraeseq[1:50])
[1] "MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEI"
> c2s(ulceransseq[1:50])
[1] "MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLL"

5. closing the connection to the database

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 79

> closebank()

The resulting sequences can be saved to a file using write.fasta()


> write.fasta( sequences=list(lepraeseq,ulceransseq), names=c('leprae','ulcerans'),
file='TwoProteins.fasta')

Note that write.fasta() expects the sequences as vectors of individual characters (so we dont use
c2s() here) and that to provide more than one sequence, we must put them into a list rather than a
vector because vectors cannot contain vectors.

4.3 Sequence Alignment

4.3.1 Pairwise Alignment

Lets compare the protein sequences of the chorismate lyase protein in two bacteria. Mycobacterium
leprae is the bacterium which causes leprosy, while Mycobacterium ulcerans is a related bacterium
which causes Buruli ulcer, both of which are classified by the WHO as neglected tropical diseases.

We can retrieve these sequences in FASTA format from http://www.uniprot.org/.

If we save the results in FASTA format, we can read them into R as before.
> proteins <- read.fasta('http://www.calvin.edu/~rpruim/talks/SC11/Data/TwoProteins.fasta')
> leprae <- proteins[[1]]
> ulcerans <- proteins[[2]]

A dot plot allows us to visually inspect the alignment.

> dotPlot(leprae, ulcerans)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


80 Some Biology Specific Applications of R

200
150
ulcerans

100
50

50 100 150 200

leprae

It can be helpful for students to look at a very small example of a dot plot to understand how they
work.

> planets[[1]]
1 [>1 ]: g t t a g a g
> planets[[2]]
2 [>2 ]: g t t a g c g
> dotPlot(planets[[1]], planets[[2]])
7
planets[[2]]

5
3
1

1 2 3 4 5 6 7

planets[[1]]

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 81

The pairwiseAlignment() function in the Biostrings package allows us to compute a pairwise global
alignment using the Needleman-Wunsch algorithm. Note that pairwiseAlignment() requires that
the sequence be represented as a single string rather than as a vector of characters.
> pairwiseAlignment(c2s(leprae), c2s(ulcerans))
Global PairwiseAlignedFixedSubject (1 of 1)
pattern: [1] m----------tnrtlsreeirkldrdlrilvatngt...svfqdtpreeldrcqysndidtrsgdrfvlhgrvfkn
subject: [1] mlavlpekremtechlsdeeirklnrdlriliatngt...svfednsreepirhqrsvgtsars-------grsict
score: -76.08

We can tune the algorithm by selecting a substitution matrix, and penalties for opening and extending
gaps. Biostrings contains several substitution matrices that we can use, including BLOSUM50. We
must convert to upper case to use these substitution matrices.
> pairwiseAlignment(
toupper(c2s(leprae)), toupper(c2s(ulcerans)),
substitutionMatrix = 'BLOSUM50', gapOpening = -2, gapExtension = -8 )
Global PairwiseAlignedFixedSubject (1 of 1)
pattern: [1] MT-----NR--T---LSREEIRKLDRDLRILVATNGT...SVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKN
subject: [1] MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATNGT...SVFEDNSREEPIRHQRS--VGT-SA-R---SGRSICT
score: 627

Alternatively, we can do a local alignment using the Smith-Waterman algorithm.


> pairwiseAlignment(
toupper(c2s(leprae)), toupper(c2s(ulcerans)),
substitutionMatrix = 'BLOSUM50', gapOpening = -2, gapExtension = -8, type='local')
Local PairwiseAlignedFixedSubject (1 of 1)
pattern: [1] MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVAN...QPVIITTEYFLRSVFQDTPREELDRCQYSNDIDTRSG
subject: [11] MTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLAN...RPVIIITEYFLRSVFEDNSREEPIRHQRSVGTSARSG
score: 761

To get a sense for how good the alignment is, we can compare the alignment we would get with a
random sequence that has the same allele frequency.
> pairwiseAlignment(
toupper(c2s(leprae)), toupper(c2s(rdata(length(ulcerans),ulcerans))),
substitutionMatrix = 'BLOSUM50', gapOpening = -2, gapExtension = -8, type='local',
scoreOnly=TRUE)
[1] 38
> scores <- do(500) *
pairwiseAlignment(toupper(c2s(leprae)), toupper(c2s(rdata(length(ulcerans),ulcerans))),
substitutionMatrix = 'BLOSUM50', gapOpening = -2, gapExtension = -8,
type='local', scoreOnly=TRUE)
> histogram(~ result, data=scores)
Percent of Total

30

20

10

30 40 50 60 70

result

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


82 Some Biology Specific Applications of R

4.3.2 Multiple Alignment

Multiple alignment is typically done in specialized software tools (e.g., MUSCLE, clustalw) rather
than in R. Alternatively, R can call an alignment program and let it do the heavy lifting. Indeed,
the function seqaln() in the bio3d package provides an interface to MUSCLE that works this way
(provided MUSCLE is also properly installed on the same machine).

We can save the output from clustalw in a FASTA file and read in the alignments using read.alignment():
> # read from web using this
> # read.alignment(file='http://www.calvin.edu/~rpruim/talks/SC11/Data/viruses-aln.fasta',
> # format='fasta') -> virus_aln
> # read from local file using this
> read.alignment(file='Data/viruses-aln.fasta', format='fasta') -> virus_aln
> dm <- dist.alignment(virus_aln) # compute distance matrix
> dm
Q10572 E3M2K8 E1FUV2 A8NSK3 Q9VT99
E3M2K8 0.2249
E1FUV2 0.5176 0.5176
A8NSK3 0.5238 0.5153 0.2032
Q9VT99 0.7181 0.7088 0.6670 0.6579
Q8WS01 0.7319 0.7221 0.7223 0.7223 0.7416

The phangorn package provides several algorithms for constructing phylogenetic trees from sequence
data.

> plot(NJ(dm)) # neighbor joining

Q9VT99
Q8WS01
Q10572
E3M2K8
E1FUV2
A8NSK3

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Some Biology Specific Applications of R 83

> plot(UNJ(dm)) # unweighted neighbor joining

Q9VT99
Q8WS01
Q10572
E3M2K8
E1FUV2
A8NSK3

> plot(upgma(dm)) # Unweighted Pair Group Method with Arithmetic Mean

Q8WS01
Q9VT99
E1FUV2
A8NSK3
Q10572
E3M2K8

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


84 Some Biology Specific Applications of R

> plot(wpgma(dm)) # Weighted Pair Group Method with Arithmetic Mean

Q8WS01
Q9VT99
E1FUV2
A8NSK3
Q10572
E3M2K8

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Taking Advantage of the Internet 85

Taking Advantage of the Internet


5
The Internet provides a wealth of data spanning the world, access to sophisticated statistical com-
puting, and a practical means for you to communicate with your own students. In this chapter, well
illustrate some mundane ways for you to distribute and share data and software with your students,
web-based interfaces for statistical computing, as well as tools for scraping data from the Internet
using application program interfaces (APIs) or through XML (eXtensible Markup Language).

We draw your attention particularly to provocative papers by Gould [Gou10] and Nolan and Temple The wealth of data
Lang [NT10], who highlight the importance of broadening the type of data students encounter in their accessible to stu-
dents on the internet
first courses as well as the role of computing in modern statistics, respectively. continues to increase
at what feels like an
exponential rate.

5.1 Sharing With and Among Your Students

Instructors often have their own data sets to illustrate points of statistical interest or to make a
particular connection with a class. Sometimes you may want your class as a whole to construct a data
set, perhaps by filling in a survey or by contributing their own small bit of data to a class collection.
Students may be working on projects in small groups; its nice to have tools to support such work so
that all members of the group have access to the data and can contribute to a written report.

There are now many technologies for supporting such sharing. For the sake of simplicity, we will em-
phasize three that we have found particularly useful both in teaching statistics and in our professional
collaborative work. These are:

A web site with minimal overhead, such as provided by Dropbox.

The services of Google Docs.

A web-based RStudio server for R.

The first two are already widely used in university environments and are readily accessible simply by
setting up accounts. Setting up an RStudio web server requires some IT support, but is well within
the range of skills found in IT offices and even among some individual faculty.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


86 Taking Advantage of the Internet

Figure 5.1: Dragging a CSV file to a Dropbox Public directory

Figure 5.2: Getting the URL of a file in a Dropbox Public directory

5.1.1 Your Own Web Site

Our discussion of You may already have a web site. We have in mind a place where you can place files and have them
Dropbox is primar- accessed directly from the Internet. For sharing data, its best if this site is public, that is, it does not
ily for those who
do not already know
require a login. That rules out most course support systems such as Moodle or Blackboard.
how to do this other
ways. The Dropbox service for storing files in the cloud provides a very convenient way to distribute files
over the web. (Go to dropbox.com for information and to sign up for a free account.) Dropbox is
routinely used to provide automated backup and coordinated file access on multiple computers. But
the Dropbox service also provides a Public directory. Any files that you place in that directory can
be accessed directly by a URL.

To illustrate, suppose you wish to share some data set with your students. Youve constructed this
data set in a spreadsheet and stored it as a CSV file, lets call it example-A.csv. Move this file
into the Public directory under Dropbox on most computers Dropbox arranges things so that its
directories appear exactly like ordinary directories and youll use the ordinary familiar file management
techniques as in Figure 5.1.

Dropbox also makes it straightforward to construct the web-location identifying URL for any file by
using mouse-based menu commands to place the URL into the clipboard, whence it can be copied to
your course-support software system or any other place for distribution to students. For a CSV file,
reading the contents of the file into R can be done with the read.csv() function, by giving it the
The history feature quoted URL:
in RStudio can be
> a <- read.csv("http://dl.dropbox.com/u/5098197/USCOTS2011/ExampleA.csv")
used to re-run this
command in future
sessions This technique makes it easy to distribute data with little advance preparation. Its fast enough to
do in the middle of a class: the CSV file is available to your students (after a brief lag while Dropbox
synchronizes). It can even be edited by you (but not by your students).

The same technique can be applied to all sorts of files: for example, R workspaces or even R scripts. Of
course, your students need to use the appropriate R command: load() for a workspace or source()
for a script.

Its a good idea to create a file with your course-specific R scripts, adding on to it and modifying it as
the course progresses. This allows you to distribute all sorts of special-purpose functions, letting you

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Taking Advantage of the Internet 87

distribute new R material to your students. For instance, that brilliant new manipulate idea you had
at 2am can be programmed up and put in place for your students to use the next morning in class.
Then as you identify bugs and refine the program, you can make the updated software immediately
available to your students.

For example, in the next section of this book we will discuss reading directly from Google Spreadsheets.
It happens that we wanted to try a new technique but were not sure that it was worth including in
the mosaic package. So, we need another way to distribute it to you. Use this statement:
> source("http://dl.dropbox.com/u/5098197/USCOTS2011/USCOTS2011.R")

Among other things, the operator readGoogleCSV() is defined in the script that gets sourced in by
that command. Again, you can edit the file directly on your computer and have the results instantly
available (subject only to the several second latency of Dropbox) to your students. Of course, they
will have to re-issue the source() command to re-read the script. Caution!
Security through Ob-
If privacy is a concern, for instance if you want the data available only to your students, you can effec- scurity of this sort
tively accomplish this by giving files names known only to your students, e.g., Example-A78r423.csv. will not generally
satisfy institutional
data protection reg-
ulations
5.1.2 GoogleDocs

The Dropbox technique is excellent for broadcasting: taking files you create and distributing them in
a read-only fashion to your students. But when you want two-way or multi-way sharing of files, other
techniques are called for, such as provided by the GoogleDocs service.

GoogleDocs allows students and instructors to create various forms of documents, including reports,
presentations, and spreadsheets. (In addition to creating documents de novo, Google will also convert
existing documents in a variety of formats.)

Once on the GoogleDocs system, the documents can be edited simultaneously by multiple users in
different locations. They can be shared with individuals or groups and published for unrestricted
viewing and even editing.

For teaching, this has a variety of uses:

Students working on group projects can all simultaneously have access to the report as it is
being written and to data that is being assembled by the group.
The entire class can be given access to a data set, both for reading and for writing.
The Google Forms system can be used to construct surveys, the responses to which automatically
populate a spreadsheet that can be read by the survey creators.
Students can hand in reports and data sets by copying a link into a course support system
such as Moodle or Blackboard, or emailing the link.
The instructor can insert comments and/or corrections directly into the document.

An effective technique for organizing student work and ensuring that the instructor (and other graders)
have access to it, is to create a separate Google directory for each student in your class (Dropbox can
also be used in this manner). Set the permission on this directory to share it with the student.
Anything she or he drops into the directory is automatically available to the instructor. The student
can also share with specific other students (e.g., members of a project group).

Example 5.1. One exercise for students starting out in a statistics course is to collect data to find
out whether the close door button on an elevator has any effect. This is an opportunity to introduce
simple ideas of experimental design. But its also a chance to teach about the organization of data.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


88 Taking Advantage of the Internet

Have your students, as individuals or small groups, study a particular elevator, organize their data
into a spreadsheet, and hand in their individual spreadsheet. Then review the spreadsheets in class.
You will likely find that many groups did not understand clearly the distinction between cases and
variables, or coded their data in ambiguous or inconsistent ways.

Work with the class to establish a consistent scheme for the variables and their coding, e.g., a variable
ButtonPress with levels Yes and No, a variable Time with the time in seconds from a fiducial time
(e.g. when the button was pressed or would have been pressed) with time measured in seconds, and
variables ElevatorLocation and GroupName. Create a spreadsheet with these variables and a few
cases filled in. Share it with the class.

Have each of your students add his or her own data to the class data set. Although this is a trivial task,
having to translate their individual data into a common format strongly reinforces the importance of
a consistent measurement and coding system for recording data. 
Once you have a spreadsheet file in GoogleDocs, you will want to open it in R. Of course, its possible
to export it as a CSV file, then open it using the CSV tools in R, such as read.csv(). But there are
easier ways that let you work with the data live.

In the web-server version of RStudio, described below, you can use a menu item to locate and
load your spreadsheet.

If you are using other R interfaces, you must first use the Google facilities for publishing
documents.

1. From within the document, use the Share dropdown menu and choose Publish as a Web
Page.
2. Press the Start Publishing button in the Publish to the web dialog box. (See figure 5.3.)
3. In that dialog box, go to Get a link to the published data. Choose the CSV format and copy
out the link thats provided. You can then publish that link on your web site, or via course-
support software. Only people with the link can see the document, so it remains effectively
private to outsiders.

It turns out that communicating with GoogleDocs requires facilities that are not present in the base
version of R, but are available through the RCurl package. In order to make these readily available to
students, we have created a function that takes a quoted string with the Google-published URL and
reads the corresponding file into a data frame:
> elev <- readGoogleCSV(
"https://spreadsheets.google.com/spreadsheet/pub?hl=en&hl=en&key=0Am13enSalO74dEVzMGJSMU5TbTc2eWlWakppQlpjc
> head(elev)
StudentGroup Elevator CloseButton Time Enroute LagToPress
1 HA Campus Center N 8.230 N 0
2 HA Campus Center N 7.571 N 0
3 HA Campus Center N 7.798 N 0

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Taking Advantage of the Internet 89

Figure 5.3: Publishing a Google Spreadsheet so that it can be read directly into R.

4 HA Campus Center N 8.303 N 0


5 HA Campus Center Y 5.811 N 0
6 HA Campus Center Y 6.601 N 0

Of course, youd never want your students to type that URL by hand; you should provide it in a
copy-able form on a web site or within a course support system.

Note that the readGoogleCSV() function is not part of the mosaic package. As described previously,
we make it available via an R source file that can be read into the current session of R using the
source() command:
> source("http://dl.dropbox.com/u/5098197/USCOTS2011/USCOTS2011.R")

5.1.3 The RStudio Web Server

RStudio is available as a desktop application that provides a considerately designed interface to the
standard R software that you can install on individual computers.

But there is another version of RStudio available, one that takes the form of a web server. There are
some substantial advantages to using the web-server version.

For the user, no installation is required beyond a standard web browser.


Sessions are continued indefinitely; you can come back to your work exactly where you left it.
A session started on one computer can be continued on another computer. So a student can
move seamlessly from the classroom to the dorm to a friends computer.
The web-server system provides facilities for direct access to GoogleDocs.

As RStudio continues to be developed, we anticipate facilities being added that will enhance even more Caution!
These are an-
the ability to teach with R:
ticipated future
features.
The ability to create URLs that launch RStudio and read in a data set all in a single click.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


90 Taking Advantage of the Internet

The ability to share sessions simultaneously, so that more than one person can be giving com-
mands. This will be much like Google Docs, but with the R console as the document. Imagine
being able to start a session, then turn it over to a student in your classroom to give the com-
mands, with you being able to make corrections as needed.

The ability to clone sessions and send them off to others. For instance, you could set up a
problem then pass it along to your students for them to work on.

But even with the present system, the web-based RStudio version allows you to work with students
effectively during office hours. You can keep your own version of RStudio running in your usual browser,
but give your visiting a student a window in a new browser: Firefox, Chrome, Safari, Internet Explorer,
etc. Each new browser is effectively a new machine, so your student can log in securely to his or her
own account.

5.2 Data Mining Activities


We end this chapter with several examples that do data mining via the Internet. Some of
these are mere glimpses into what might be possible as tools for accessing this kind of data
become more prevalent and easier to use.

5.2.1 What percentage of Earth is Covered with Water?

We can estimate the proportion of the world covered with water by randomly sampling points on the
globe and inspecting them using GoogleMaps.

First, lets do a sample size computation. Suppose we want to estimate (at the 95% confidence level)
this proportion within 5%. There are several ways to estimate the necessary sample size, including
algebraically solving p
(1.96) p(1 p)/n = 0.05
for n given some estimated value of p. The uniroot() function can solve this sort of thing numerically.
Here we take an approach that looks at a table of values of n and p and margin of error.
> n <- seq(50,500, by=50)
> p.hat <- seq(.5, .9, by=0.10)
> margin_of_error <- function(n, p, conf.level=.95) {
-qnorm( (1-conf.level)/2) * sqrt( p * (1-p) / n )
}
> # calculate margin of error for all combos of n and p.hat
> outer(n, p.hat, margin_of_error) -> tbl
> colnames(tbl) <- p.hat
> rownames(tbl) <- n
> tbl
0.5 0.6 0.7 0.8 0.9
50 0.13859 0.13579 0.12702 0.11087 0.08315
100 0.09800 0.09602 0.08982 0.07840 0.05880
150 0.08002 0.07840 0.07334 0.06401 0.04801
200 0.06930 0.06790 0.06351 0.05544 0.04158
250 0.06198 0.06073 0.05681 0.04958 0.03719
300 0.05658 0.05544 0.05186 0.04526 0.03395
350 0.05238 0.05132 0.04801 0.04191 0.03143
400 0.04900 0.04801 0.04491 0.03920 0.02940
450 0.04620 0.04526 0.04234 0.03696 0.02772
500 0.04383 0.04294 0.04017 0.03506 0.02630

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Taking Advantage of the Internet 91

From this it appears that a sample size of approximately 300400 will get us the accuracy we desire.
A class of students can easily generate this much data in a matter of minutes if each student inspects
1020 maps. The example below assumes a sample size of 10 locations per student. This can be
adjusted depending on the number of students and the desired margin of error.

1. Generate 10 random locations.


> positions <- rgeo(10); positions
lat lon
1 -54.910 132.836
2 6.848 -17.641
3 -51.543 -73.535
4 -60.924 -7.936
5 -4.447 -57.897
6 15.100 -26.120
7 -64.686 159.347
8 66.661 46.460
9 -32.937 140.952
10 -15.802 169.742

2. Open a GoogleMap centered at each position.


> googleMap(pos=positions, mark=TRUE)

You may need to turn off pop-up blocking for this to work smoothly.

3. For each map, record whether the center is located in water or on land. The options mark=TRUE
is used to place a marker at the center of the map (this is helpful for locations that are close to
the coast).

You can zoom in or out to get a better look.

4. Record your data in a GoogleForm at

http://mosaic-web.org/uscots2011/google-water.html

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


92 Taking Advantage of the Internet

Caution!
This sort of copy- For the latitude and longitude information, simply copy and paste the output of
and-paste operation
works better in > positions
some browsers
(Firefox) than in 5. After importing the data from Google, it is simple to sum the counts across the class.
others (Safari).
> sum(googleData$Water)
[1] 215
> sum(googleData$Land)
[1] 85
Then use your favorite method of analysis, perhaps binom.test().
> interval(binom.test(215, 300)) # numbers of successes and trials
Method: Exact binomial test

probability of success
0.7167

95% confidence interval:


0.662 0.767

5.2.2 Roadless America

The rgeo() function can also sample within a latitude longitude rectangle. This allows us to sample
subsets of the globe. In this activity we will estimate the proportion of the continental United States
that is within 1 mile of a road.

1. Generate a random sample of locations in a box containing the continental United States. Some
of these points may be in Canada, Mexico, an ocean or a major lake. These will be discarded
from our sample before making our estimate.
> positions <- rgeo(10, lonlim=c(-125,-65), latlim=c(25,50)); positions

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Taking Advantage of the Internet 93

lat lon
1 42.02 -113.53
2 40.55 -94.14
3 42.88 -71.02
4 45.00 -80.19
5 35.33 -117.09
6 33.62 -97.26
7 48.96 -115.82
8 40.33 -85.28
9 49.48 -98.56
10 38.88 -123.51

2. Open a GoogleMap centered at each position. This time well zoom in a bit and add a circle of
radius 1 to our map.
> googleMap(pos=positions, mark=TRUE, zoom=12, radius=1)

You may need to turn off pop-up blocking for this to work smoothly.
3. For each map, record whether the center is close (to a road), far (from a road), water, or foreign.
You may need to zoom in or out a bit to figure this out.

5.2.3 Variations on the Google Maps theme

There are many other quantities one could estimate using these tools. For example:

1. What proportion of your home state is within m miles of a lake? (The choice of m may depend
upon your state of interest.)

2. Use two proportion procedures or chi-squared tests to compare states or continents. Do all
continents have roughly the same proportion of land withing m miles of water (for some m)?
Are Utah and Arizona equally roadless?
3. In more advanced classes: What is the average distance to the nearest lake (in some region)? By
using concentric circles, one could estimate this from discretized data indicating, for example,
whether the nearest lake is within 1/2 mile, between 1/2 mile and 1 mile, between 1 mile and 2
miles, between 2 miles, and 4 miles, between 4 miles and 10 miles, or more than 10 miles away.
It may be interesting to discuss what sort of model should be used for distances from random
locations to lakes. (It probably isnt normally distributed.)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


94 More About R

More About R
A
This material is more advanced than students in Intro Stats need,
but is good for more advanced students and instructors to know.

A.1 Installing and Using Packages

R is open source software. Its development is supported by a team of core developers and a large
community of users. One way that users support R is by providing packages that contain data and
functions for a wide variety of tasks.

A.1.1 Installing packages from CRAN

If you need to install a package, most likely it will be on CRAN. Before a package can be used, it must
be installed (once per computer) and loaded (once per R session). For example, to use mosaic:

> install.packages("mosaic") # fetch package from CRAN to local machine.


> require(mosaic) # load the package so it can be used.

If you are running on a machine where you dont have privileges to write to the default library location,
you can install a personal copy of a package. If the location of your personal library is first in R_LIBS,
this will probably happen automatically. If not, you can specify the location manually:

> install.packages("mosaic", lib="~/R/library")

On a networked machine, be sure to use a different local directory for each platform since packages
must match the platform.

Installing packages on a Mac or PC is something you might like to do from the GUI since it will
provide you with a list of packages from which you can select the ones of interest. Binary packages
have been precompiled for a particular platform and are generally faster and easier to set up, if they
are available. Source packages need to be compiled and built on your local machine. Usually this
happens automatically provided you have all the necessary tools installed on your machine so the
only disadvantage is the extra time it takes to do the compiling and building.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 95

A.1.2 Installing other packages

Occasionally you might find a package of interest that is not available via a repository like CRAN.
Typically, if you find such a package, you will also find instructions on how to install it. If not, you
can usually install directly from the zipped up package file.
> install.packages('some-package.tar.gz',
repos=NULL) # use a file, not a repository

A.1.3 Finding packages

There are several ways to find packages

Ask your friends.

Google: Put cran in the search.

Rseek: http://rseek.org provides a search engine specifically designed to find information


about R.

CRAN task views.


A number of folks have put together task views that annotate a large number of packages and
summarize they are good for. They are organized according to themes. Here are a few examples
of available task views:

Bayesian Bayesian Inference


Econometrics Computational Econometrics
Finance Empirical Finance
Genetics Statistical Genetics
Graphics Graphic Displays, Dynamic Graphics, Graphic Devices, and Visualiza-
tion
Multivariate Multivariate Statistics
SocialSciences Statistics for the Social Sciences

Bioconductor (http://www.bioconductor.org/) and Omegahat (http://www.omegahat.org/


R) are another sources of packages (specify the repos= option to use these).

R Journal (formerly R News) is available via CRAN and often has articles about new packages
and their capabilities.

Write your own.


You can write your own packages, and it isnt that hard to do (but we wont cover this here).

A.2 Some Workflow Suggestions

In short: Think like a programmer.

Use R interactively only to get documentation and for quick one-offs.

Store your code in a file.


You can execute all the code in a file using

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


96 More About R

> source("file.R")
RStudio has options for executing some or all lines in a file, too. See the buttons in the panel
for any R script. (You can create a new R script file in the main file menu.)
If you work at the interactive prompt in the console and later wish you had been putting your
commands into a file, you can save your past commands with
RStudio makes this
especially easy by > savehistory("someRCommandsIalmostLost.R")
providing a inte-
grated environment You can selectively save portions of your history to a script file using the History panel in
for working with R RStudio.
script files, an active
Then you can go back and edit the file.
R session, the R
session history, etc.
Use meaningful names.
Many of these tasks
can be done with Write reusable functions.
the click of a button
in RStudio. Learning to write your own functions will greatly increase your efficiency. (Stay tuned for
details.)
Comment your code.
Its amazing what you can forget. The comment character in R is #.

A.3 Working with Data

A.3.1 Data in R packages

Data sets in the datasets package or any other loaded package are available via the data() function.
Usually, the use of data() is unnecessary, however, since R will search most loaded packages (they
must have been created with the lazy-load option) for data sets without the explicit use of data().
The data() function can be used to restore data after it has been modified or to control which package
is used when data sets with the same name appear in multiple packages.

A.3.2 Loading data from flat files

R can read data from a number of file formats. The two most useful formats are .csv (comma separated
values) and white space delimited. Excel and most statistical packages can read and write data in
these formats, so these formats make it easy to transfer data between different software. R provides
read.csv() and read.table() to handle these two situations. They work nearly identically except
for their default settings: read.csv() assumes that the first line of the file contains the variable names
but read.table() assumes that the data begins on the first line with no names for the variables, and
read.table() will ignore lines that begin with # but read.csv() will not.

The default behavior can be overridden for each function, and there are a number of options that
make it possible to read other file formats, to omit a specified number of lines at the top of the file,
etc. If you are making the file yourself, always include meaningful names in either file format.

It is also possible to read data from a file located on the Internet. Simply replace the file name with
a URL. The data read below come from [Tuf01].
> # need header=TRUE because there is a header line.
> # could also use read.file() without header=TRUE
> traffic <-
read.table("http://www.calvin.edu/~rpruim/fastR/trafficTufte.txt",
header=TRUE)
> traffic

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 97

year cn.deaths ny cn ma ri
1 1951 265 13.9 13.0 10.2 8.0
2 1952 230 13.8 10.8 10.0 8.5
3 1953 275 14.4 12.8 11.0 8.5
4 1954 240 13.0 10.8 10.5 7.5
5 1955 325 13.5 14.0 11.8 10.0
6 1956 280 13.4 12.1 11.0 8.2
7 1957 273 13.3 11.9 10.2 9.4
8 1958 248 13.0 10.1 11.8 8.6
9 1959 245 12.9 10.0 11.0 9.0

Notice the use of <- in the example above. This is the assignment operator in R. It can be used
in either direction (<- or ->). In the first line of the example above, the results of read.table()
are stored in a variable called traffic. traffic is a data frame, Rs preferred container for data.
(More about data types in R as we go along.)

The na.strings argument can be used to specify codes for missing values. The following can be
useful for SAS output, for example:
> read.csv('file.csv', na.strings=c('NA','','.','na')) -> someData

because SAS uses a period (.) to code missing data, but R by default reads that as string data, which
forces the entire variable to be of character type instead of numeric.

For convenience the mosaic package provides read.file() which uses the file name to determine
which of read.csv(), read.table(), and load() to use and sets the defaults to

header=TRUE,

comment.char="#", and

na.strings=c('NA','','.','na')

for read.csv() and read.table().


> traffic <- read.file("http://www.calvin.edu/~rpruim/fastR/trafficTufte.txt")

A.3.3 Manually typing in data

If you need to enter a small data set by hand, the scan() function is quick and easy. Individual
values are separated by white space or new lines. A blank line is used to signal the end of the data.
By default, scan() is expecting decimal data (which it calls double, for double precision), but it is
possible to tell scan() to expect something else, like character data (i.e., text). There are other
options for data types, but numerical and text data will usually suffice for our purposes. See ?scan
for more information and examples.

myData1 <- scan()


15 18
12
21 23 50 15

myData1

myData2 <- scan(what="character")


"red" "red" "orange" "green" "blue" "blue" "red"

myData2

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


98 More About R

Be sure when using scan() that you remember to save your data somewhere. Otherwise you will have
to type it again.

A.3.4 Creating data frames from vectors

The scan() function puts data into a vector, not a data frame. We can build a data frame for
our data as follows.
> myDataFrame <- data.frame(color=myData2, number=myData1)
> myDataFrame
color number
1 red 15
2 red 18
3 orange 12
4 green 21
5 blue 23
6 blue 50
7 red 15

A.3.5 Getting data from mySQL data bases

The RMySQL package allows direct access to data in MySQL data bases. This can be convenient when
dealing with subsets of very large data sets. A great example of this is the 12 gigabytes of data from
the Airline on-time performance dataset included in the 2009 Data Expo (http://stat-computing.
org/dataexpo/2009). There is an online document describing this type of manipulation.

A.3.6 Generating data

The following code shows a number of ways to generate data systematically.


> x <- 5:20; x # all integers in a range
[1] 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20
> # structured sequences
> seq(0, 50, by=5)
[1] 0 5 10 15 20 25 30 35 40 45 50
> seq(0, 50, length=7)
[1] 0.000 8.333 16.667 25.000 33.333 41.667 50.000
> rep(1:5, each=3)
[1] 1 1 1 2 2 2 3 3 3 4 4 4 5 5 5
> rep(1:5, times=3)
[1] 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5
> c(1:5, 10, 3:5) # c() concatenates vectors
[1] 1 2 3 4 5 10 3 4 5

R can also sample from several different distributions.


> rnorm(10, mean=10, sd=2) # random draws from normal distribution
[1] 7.062 8.766 13.322 9.800 7.999 10.770 8.862 10.212 8.166 7.381
> x <- 5:20 # all integers in a range
> sample(x, size=5) # random sample of size 5 from x (no replacement)

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 99

[1] 18 19 16 8 12

Functions for sampling from other distributions include rbinom(), rchisq(), rt(), rf(), rhyper(),
etc. See Section ?? for more information.

A.3.7 Saving Data

write.table() and write.csv() can be used to save data from R into delimited flat files.
> ddd <- data.frame(number=1:5, letter=letters[1:5])
> args(write.table)
function (x, file = "", append = FALSE, quote = TRUE, sep = " ",
eol = "\n", na = "NA", dec = ".", row.names = TRUE, col.names = TRUE,
qmethod = c("escape", "double"), fileEncoding = "")
NULL
> write.table(ddd, "ddd.txt")
> write.csv(ddd, "ddd.csv")
> # this system call should work on a Mac or Linux machine
> system("head -20 ddd.txt ddd.csv")

Data can also be saved in native R format. Saving data sets (and other R objects) using save() has
some advantages over other file formats:

Complete information about the objects is saved, including attributes.

Data saved this way takes less space and loads much more quickly.

Multiple objects can be saved to and loaded from a single file.

The downside is that these files are only readable in R.


> abc <- "abc"
> ddd <- data.frame(number=1:5, letter=letters[1:5])
> save(ddd, abc, file="ddd.rda") # saves both objects in a single file
> load("ddd.rda") # loads them both

For more on importing and exporting data, especially from other formats, see the R Data Im-
port/Export manual available on CRAN.

A.4 Primary R Data Structures

A.4.1 Modes and other attributes

In R, data is stored in objects. Each object has a name, contents, and also various attributes.
Attributes are used to tell R something about the kind of data stored in an object and to store other
auxiliary information. Two important attributes shared by all objects are mode and length.
> w <- 2.5; x <- c(1,2); y <- "foo"; z <- TRUE; abc <- letters[1:3]

> mode(w); length(w)


[1] "numeric"
[1] 1
> mode(x); length(x)

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


100 More About R

[1] "numeric"
[1] 2
> mode(y); length(y)
[1] "character"
[1] 1
> y[1]; y[2] # not an error to ask for y[2]
[1] "foo"
[1] NA
> mode(z); length(z)
[1] "logical"
[1] 1
> abc
[1] "a" "b" "c"
> mode(abc); length(abc)
[1] "character"
[1] 3
> abc[3]
[1] "c"

Each of the objects in the example above is a vector, an ordered container of values that all have the
same mode.1 The c() function concatenates vectors (or lists). Notice that w, y, and z are vectors of
length 1. Missing values are coded as NA (not available). Asking for an entry off the end of a vector
returns NA. Assigning a value off the end of a vector results in the vector being lengthened so that
the new value can be stored in the appropriate location.

There are important ways that R has been optimized to work with vectors since they correspond to
variables (in the sense of statistics). For categorical data, a factor is a special type of vector that
includes an additional attribute called levels. A factor can be ordered or unordered (which can affect
how statistics are done and graphs are made) and its elements can have mode numeric or character.

A list is similar to a vector, but its elements may be of different modes (including list, vector, etc.).
A data frame is a list of vectors (or factors), each of the same length, but not necessarily of the same
mode. This is Rs primary way of storing data sets. An array is a multi-dimensional table of values
that all have the same mode. A matrix is a 2-dimensional array.

The access operators ([ ] for vectors, matrices, arrays, and data frames, and [[ ]] for lists) are
actually functions in R. This has some important consequences:

Accessing elements is slower than in a language like C/C++ where access is done by pointer
arithmetic.
These functions also have named arguments, so you can see code like the following

> xm <- matrix(1:16, nrow=4); xm


[,1] [,2] [,3] [,4]
[1,] 1 5 9 13
[2,] 2 6 10 14
[3,] 3 7 11 15
[4,] 4 8 12 16
1 There are other modes in addition to the ones shown here, including complex (for complex numbers), function,

list, call, and expression.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 101

> xm[5]
[1] 5
> xm[,2] # this is 1 dimensional (a vector)
[1] 5 6 7 8
> xm[,2, drop=FALSE] # this is 2 dimensional (still a matrix)
[,1]
[1,] 5
[2,] 6
[3,] 7
[4,] 8

Many objects have a dim attribute that stores the dimension of the object. You can change it to
change the shape (or even the number of dimensions) of a vector, matrix, or array. You can see all
of the non-intrinsic attributes (mode and length are intrinsic) using attributes(), and you can set
attributes (including new ones you make up) using attr(). Some attributes, like dimension, have
special functions for accessing or setting. The dim() function returns the dimensions of an object as
a vector. Alternatively the number of rows and columns can be obtained using nrow() and ncol().
> ddd <- data.frame(number=1:5, letter=letters[1:5])
> attributes(ddd)
$names
[1] "number" "letter"

$row.names
[1] 1 2 3 4 5

$class
[1] "data.frame"
> dim(ddd)
[1] 5 2
> nrow(ddd)
[1] 5
> ncol(ddd)
[1] 2
> names(ddd)
[1] "number" "letter"
> row.names(ddd)
[1] "1" "2" "3" "4" "5"

A.4.2 What is it?

R provides a number of functions for testing the mode or class of an object.


> mode(xm); class(xm)
[1] "numeric"
[1] "matrix"
> c(is.numeric(xm), is.character(xm), is.integer(xm), is.logical(xm))
[1] TRUE FALSE TRUE FALSE
> c(is.vector(xm), is.matrix(xm), is.array(xm))
[1] FALSE TRUE TRUE

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


102 More About R

A.4.3 Changing modes (coercion)

If R is expecting an object of a certain mode or class but gets something else, it will often try to
coerce the object to meet its expectations. You can also coerce things manually using one of the
many as.???() functions.
> apropos("^as\\.")[1:10] # just a small sample
[1] "as.array" "as.array.default" "as.call"
[4] "as.category" "as.character" "as.character.condition"
[7] "as.character.Date" "as.character.default" "as.character.error"
[10] "as.character.factor"
> xm
[,1] [,2] [,3] [,4]
[1,] 1 5 9 13
[2,] 2 6 10 14
[3,] 3 7 11 15
[4,] 4 8 12 16
> # convert numbers to strings (this drops attributes, including dimension)
> as.character(xm)
[1] "1" "2" "3" "4" "5" "6" "7" "8" "9" "10" "11" "12" "13" "14" "15" "16"

> # convert matrix to vector


> as.vector(xm)
[1] 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
> as.logical(xm)
[1] TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE TRUE

> alpha <- c("a", "1", "b", "0.5")


> mode(alpha)
[1] "character"

> as.numeric(alpha) # can't do the coercion, so NAs are introduced


[1] NA 1.0 NA 0.5
> as.integer(alpha) # notice coercion of 0.5 to 0
[1] NA 1 NA 0

A.5 More About Vectors

Vectors are so important in R that they deserve some additional discussion. In Section A.3.6 we
learned how to generate some simple vectors. Here we will learn about some of the operations and
functions that can be applied to vectors.

A.5.1 Names and vectors

We can give each position in a vector a name. This can be very handy for certain uses of vectors.
> myvec <- 1:5; myvec
[1] 1 2 3 4 5
> names(myvec) <- c('one','two','three','four','five'); myvec
one two three four five
1 2 3 4 5

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 103

Names can also be specified as a vector is created using c().


> another <- c(mean=10, sd=2, "trimmed mean"=9.7); another
mean sd trimmed mean
10.0 2.0 9.7

A.5.2 Vectorized functions

Many R functions and operations are vectorized and can be applied not just to an individual value but
to an entire vector, in which case they are applied componentwise and return a vector of transformed
values. Most traditional mathematics functions are available and work this way.
> x <- 1:5; y <- seq(10, 60, by=10); z <- rnorm(10); x; y
[1] 1 2 3 4 5
[1] 10 20 30 40 50 60
> y + 1
[1] 11 21 31 41 51 61
> x * 10
[1] 10 20 30 40 50
> x < 3
[1] TRUE TRUE FALSE FALSE FALSE
> x^2
[1] 1 4 9 16 25
> log(x); log(x, base=10) # natural and base 10 logs
[1] 0.0000 0.6931 1.0986 1.3863 1.6094
[1] 0.0000 0.3010 0.4771 0.6021 0.6990

Vectors can be combined into a matrix using rbind() or cbind(). This can facilitate side-by-side
comparisons.
> # compare round() and signif() by binding rowwise into matrix
> rbind(round(z, digits=2), signif(z, digits=2))
[,1] [,2] [,3] [,4] [,5] [,6] [,7] [,8] [,9] [,10]
[1,] 0.82 1.23 1.77 1.2 -0.25 0.16 0.030 1.29 -0.010 -0.58
[2,] 0.82 1.20 1.80 1.2 -0.25 0.16 0.031 1.30 -0.011 -0.58

A.5.3 Functions that act on vectors as vectors

Other functions, including many statistical functions, are designed to work on the vector as a vector.
Often these return a single value (technically a vector of length 1), but other return types are used as
appropriate.
> x <- 1:10; z <- rnorm(100)
> mean(z); sd(z); var(z); median(z) # basic statistical functions
mean
-0.06371
sd
1.005
var
1.01

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


104 More About R

median
0.03395
> range(z) # range returns a vector of length 2
[1] -3.256 2.012
> sum(x); prod(x) # sums and products
[1] 55
[1] 3628800

> z <- rnorm(5); z


[1] -2.5012 -1.3353 1.4802 0.1213 3.0001
> sort(z); rank(z); order(z) # sort, rank, order
[1] -2.5012 -1.3353 0.1213 1.4802 3.0001
[1] 1 2 4 3 5
[1] 1 2 4 3 5
> rev(x) # reverse x
[1] 10 9 8 7 6 5 4 3 2 1

> diff(x) # pairwise differences


[1] 1 1 1 1 1 1 1 1 1
> cumsum(x) # cumulative sum
[1] 1 3 6 10 15 21 28 36 45 55
> cumprod(x) # cumulative product
[1] 1 2 6 24 120 720 5040 40320 362880 3628800
> sum(x); prod(x) # sums and products
[1] 55
[1] 3628800

Whether a function is vectorized or treats a vector as a unit depends on its implementation. Usually,
things are implemented the way you would expect. Occasionally you may discover a function that
you wish were vectorized and is not. When writing your own functions, give some thought to whether
they should be vectorized, and test them with vectors of length greater than 1 to make sure you get
the intended behavior.

Some additional useful functions are included in Table A.1.

A.5.4 Recycling

When vectors operate on each other, the operation is done componentwise, recycling the shorter vector
to match the length of the longer.
> x <- 1:5; y <- seq(10, 70, by=10)
> x + y
[1] 11 22 33 44 55 61 72

In fact, this is exactly how things like x + 1 actually work. If x is a vector of length n, then 1 (a vector
of length 1) is first recycled into a vector of length n; then the two vectors are added componentwise.
Some vectorized functions that take multiple vectors as arguments will first use recycling to make
them the same length.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 105

Table A.1: Some useful R functions.

cumsum() Returns vector of cumulative sums, products, minima, or


cumprod() maxima.
cummin()
cummax()
pmin(x,y,...) Returns vector of parallel minima or maxima where ith
pmax(x,y,...) element is max or min of x[i], y[i], . . . .
which(x) Returns a vector of indices of elements of x that are true.
Typical use: which(y > 5) returns the indices where ele-
ments of y are larger than 5.
any(x) Returns a logical indicating whether any elements of x
are true. Typical use: if ( any(y > 5) ) { ...}.
na.omit(x) Returns a vector with missing values removed.
unique(x) Returns a vector with repeated values removed.
table(x) Returns a table of counts of the number of occurrences of
each value in x. The table is similar to a vector with names
indicating the values, but it is not a vector.
paste(x,y,..., Pastes x and y together componentwise (as strings) with
sep=" ") sep between elements. Recycling applies.

A.5.5 Accessing elements of vectors

R allows for some very interesting and useful methods for accessing elements of a vector that combine
the ideas above. First, recall that the [ ] operator is actually a function. Furthermore, it is vectorized.
> x <- seq(2, 20, by=2)
> x[1:5]; x[c(1, 4, 7)]
[1] 2 4 6 8 10
[1] 2 8 14

[ ] accepts logicals as arguments well. The boolean values (recycled, if necessary) are used to select
or deselect elements of the vector.
> x <- seq(2, 20, by=2)
> x[c(TRUE, TRUE, FALSE)] # skips every third element (recycling!)
[1] 2 4 8 10 14 16 20
> x[x > 10] # more typical use of boolean in selection
[1] 12 14 16 18 20

Negative indices are used to omit elements.


> x <- seq(2, 20, by=2)
> x[c(TRUE,TRUE,FALSE)] # skips every third element (recycling!)
[1] 2 4 8 10 14 16 20
> x[x > 10] # more typical use of boolean in selection
[1] 12 14 16 18 20

Here are some more examples.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


106 More About R

> notes <- toupper(letters[1:7]); a <- 1:5; b <- seq(10, 100, by=10)
> toupper(letters[5:10])
[1] "E" "F" "G" "H" "I" "J"
> paste(letters[1:5], 1:3, sep='-')
[1] "a-1" "b-2" "c-3" "d-1" "e-2"
> a+b
[1] 11 22 33 44 55 61 72 83 94 105
> (a+b)[ a+b > 50]
[1] 55 61 72 83 94 105
> length((a+b)[a+b > 50])
[1] 6
> table(a+b > 50)
FALSE TRUE
4 6

A.6 Manipulating Data Frames

A.6.1 Adding new variables to a data frame

We can add additional variables to an existing data frame by simple assignment.


> summary(iris)
Sepal.Length Sepal.Width Petal.Length Petal.Width Species
Min. :4.30 Min. :2.00 Min. :1.00 Min. :0.1 setosa :50
1st Qu.:5.10 1st Qu.:2.80 1st Qu.:1.60 1st Qu.:0.3 versicolor:50
Median :5.80 Median :3.00 Median :4.35 Median :1.3 virginica :50
Mean :5.84 Mean :3.06 Mean :3.76 Mean :1.2
3rd Qu.:6.40 3rd Qu.:3.30 3rd Qu.:5.10 3rd Qu.:1.8
Max. :7.90 Max. :4.40 Max. :6.90 Max. :2.5
> iris$SLength <- cut(iris$Sepal.Length, 4:8) # cut places data into bins
> summary(iris)
Sepal.Length Sepal.Width Petal.Length Petal.Width Species
Min. :4.30 Min. :2.00 Min. :1.00 Min. :0.1 setosa :50
1st Qu.:5.10 1st Qu.:2.80 1st Qu.:1.60 1st Qu.:0.3 versicolor:50
Median :5.80 Median :3.00 Median :4.35 Median :1.3 virginica :50
Mean :5.84 Mean :3.06 Mean :3.76 Mean :1.2
3rd Qu.:6.40 3rd Qu.:3.30 3rd Qu.:5.10 3rd Qu.:1.8
Max. :7.90 Max. :4.40 Max. :6.90 Max. :2.5
SLength
(4,5]:32
(5,6]:57
(6,7]:49
(7,8]:12

It is an error to add a vector of the wrong length.

The CPS data frame contains data from a Current Population Survey (current in 1985, that is). Two of
the variables in this data frame are age and educ. We can estimate the number of years a worker has
been in the workforce if we assume they have been in the workforce since completing their education
and that their age at graduation is 6 more than the number of years of education obtained. We can
this as a new variable in the data frame simply by assigning to it:

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 107

> CPS$workforce.years <- with(CPS, age - 6 - educ)


> favstats(CPS$workforce.years)
min Q1 median Q3 max mean sd n missing
-4 8 15 26 55 17.81 12.39 534 0

In fact this is what was done for all but one of the cases to create the exper variable that is already
in the CPS data.
> with(CPS, table(exper - workforce.years))
0 4
533 1

A.6.2 Dropping variables

Since we already have educ, there is no reason to keep our new variable. Lets drop it. Notice the
clever use of the minus sign.
> CPS1 <- subset(CPS, select = -workforce.years)

Any number of variables can be dropped or kept in this manner by supplying a vectors of variables
names.
> CPS1 <- subset(CPS, select = -c(workforce.years,exper))

If we only want to work with the first few variables, we can discard the rest in a similar way. Columns
can be specified by number as well as name (but this can be dangerous if you are wrong about where
the columns are):
> CPSsmall <- subset(CPS, select=1:4)
> head(CPSsmall,2)
wage educ race sex
1 9.0 10 W M
2 5.5 12 W M

A.6.3 Renaming variables

Both the column (variable) names and the row names of a data frames can be changed by simple
assignment using names() or row.names().
> ddd # small data frame we defined earlier
number letter
1 1 a
2 2 b
3 3 c
4 4 d
5 5 e
> row.names(ddd) <- c("Abe","Betty","Claire","Don","Ethel")
> ddd # row.names affects how a data.frame prints
number letter
Abe 1 a
Betty 2 b
Claire 3 c
Don 4 d
Ethel 5 e

More interestingly, it is possible to reset just individual names with the following syntax.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


108 More About R

> row.names(ddd)[2] <- "Bette" # misspelled a name, let's fix it


> row.names(ddd)
[1] "Abe" "Bette" "Claire" "Don" "Ethel"

The faithful data set (in the datasets package, which is always available) has very unfortunate
names.
> names(faithful)
[1] "eruptions" "waiting"

The measurements are the duration of an euption and the time until the subsequent eruption, so lets
give it some better names.
> names(faithful) <- c('duration', 'time.til.next')
> head(faithful, 3)
duration time.til.next
1 3.600 79
2 1.800 54
3 3.333 74

> xyplot(time.til.next ~ duration, faithful)



90





time.til.next







80



















70



60



50






2 3 4 5

duration

If the variable containing a data frame is modified or used to store a different object, the original data
from the package can be recovered using data().
> data(faithful)
> head(faithful, 3)
eruptions waiting
1 3.600 79
2 1.800 54
3 3.333 74

If we want to rename a variable, we can do this using names(). For example, perhaps we want to
rename educ (the second column) to education.
> names(CPS)[2] <- 'education'
> CPS[1,1:4]
wage education race sex
1 9 10 W M

See Section A.5 for If we dont know the column number (or generally to make our code clearer), a few more keystrokes
information that will
make it clearer what
produces
is going on here.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 109

> names(CPS)[names(CPS) == 'education'] <- 'educ'


> CPS[1,1:4]
wage educ race sex
1 9 10 W M

A.6.4 Creating subsets

We can also use subset() to reduce the size of a data set by selecting only certain rows.

> data(faithful)
> names(faithful) <- c('duration', 'time.til.next')
> # any logical can be used to create subsets
> faithfulLong <- subset(faithful, duration > 3)
> xyplot( time.til.next ~ duration, faithfulLong )




time.til.next

90








80











70




3.0 3.5 4.0 4.5 5.0

duration

Of course, if all we want to do is produce a graph, there is no reason to create a new data frame. The
plot above could also be made with
> xyplot( time.til.next ~ duration, faithful, subset=duration > 3 )

A.6.5 Merging datasets

The fusion1 data frame in the fastR package contains genotype information for a SNP (single
nucleotide polymorphism) in the gene TCF7L2. The pheno data frame contains phenotypes (including
type 2 diabetes case/control status) for an intersecting set of individuals. We can merge these together
to explore the association between genotypes and phenotypes using merge().
> require(fastR)
> head(fusion1,3)
id marker markerID allele1 allele2 genotype Adose Cdose Gdose Tdose
1 9735 RS12255372 1 3 3 GG 0 0 2 0
2 10158 RS12255372 1 3 3 GG 0 0 2 0
3 9380 RS12255372 1 3 4 GT 0 0 1 1
> head(pheno,3)
id t2d bmi sex age smoker chol waist weight height whr sbp dbp
1 1002 case 32.86 F 70.76 former 4.57 112.0 85.6 161.4 0.9868 135 77
2 1009 case 27.39 F 53.92 never 7.32 93.5 77.4 168.1 0.9397 158 88
3 1012 control 30.47 M 53.86 former 5.02 104.0 94.6 176.2 0.9327 143 89

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


110 More About R

> # merge fusion1 and pheno keeping only id's that are in both
> fusion1m <- merge(fusion1, pheno, by.x='id', by.y='id', all.x=FALSE, all.y=FALSE)
> head(fusion1m, 3)
id marker markerID allele1 allele2 genotype Adose Cdose Gdose Tdose t2d
1 1002 RS12255372 1 3 3 GG 0 0 2 0 case
2 1009 RS12255372 1 3 3 GG 0 0 2 0 case
3 1012 RS12255372 1 3 3 GG 0 0 2 0 control
bmi sex age smoker chol waist weight height whr sbp dbp
1 32.86 F 70.76 former 4.57 112.0 85.6 161.4 0.9868 135 77
2 27.39 F 53.92 never 7.32 93.5 77.4 168.1 0.9397 158 88
3 30.47 M 53.86 former 5.02 104.0 94.6 176.2 0.9327 143 89

In this case, since the values are the same for each data frame, we could collapse by.x and by.y to by
and collapse all.x and all.y to all. The first of these specifies which column(s) to use to identify
matching cases. The second indicates whether cases in one data frame that do not appear in the other
should be kept (TRUE) or dropped (filling in NA as needed) or dropped from the merged data frame.

Now we are ready to begin our analysis.


> xtabs(~t2d + genotype + marker, fusion1m)
, , marker = RS12255372

genotype
t2d GG GT TT
case 737 375 48
control 835 309 27

A.6.6 Slicing and dicing

reshape() provides a flexible way to change the arrangement of data. It was designed for converting
between long and wide versions of time series data and its arguments are named with that in mind.

A common situation is when we want to convert from a wide form to a long form because of a change
in perspective about what a unit of observation is. For example, in the traffic data frame, each row
is a year, and data for multiple states are provided.
> traffic
year cn.deaths ny cn ma ri
1 1951 265 13.9 13.0 10.2 8.0
2 1952 230 13.8 10.8 10.0 8.5
3 1953 275 14.4 12.8 11.0 8.5
4 1954 240 13.0 10.8 10.5 7.5
5 1955 325 13.5 14.0 11.8 10.0
6 1956 280 13.4 12.1 11.0 8.2
7 1957 273 13.3 11.9 10.2 9.4
8 1958 248 13.0 10.1 11.8 8.6
9 1959 245 12.9 10.0 11.0 9.0

We can reformat this so that each row contains a measurement for a single state in one year.
> longTraffic <-
reshape(traffic[,-2], idvar="year", ids=row.names(traffic),
times=names(traffic)[3:6], timevar="state",
varying=list(names(traffic)[3:6]),
v.names="deathRate",
direction="long")
> head(longTraffic)

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 111

year state deathRate


1951.ny 1951 ny 13.9
1952.ny 1952 ny 13.8
1953.ny 1953 ny 14.4
1954.ny 1954 ny 13.0
1955.ny 1955 ny 13.5
1956.ny 1956 ny 13.4

And now we can reformat the other way, this time having all data for a given state form a row in the
data frame.
> stateTraffic <- reshape(longTraffic, direction='wide',
v.names="deathRate", idvar="state", timevar="year")
> stateTraffic
state deathRate.1951 deathRate.1952 deathRate.1953 deathRate.1954
1951.ny ny 13.9 13.8 14.4 13.0
1951.cn cn 13.0 10.8 12.8 10.8
1951.ma ma 10.2 10.0 11.0 10.5
1951.ri ri 8.0 8.5 8.5 7.5
deathRate.1955 deathRate.1956 deathRate.1957 deathRate.1958 deathRate.1959
1951.ny 13.5 13.4 13.3 13.0 12.9
1951.cn 14.0 12.1 11.9 10.1 10.0
1951.ma 11.8 11.0 10.2 11.8 11.0
1951.ri 10.0 8.2 9.4 8.6 9.0

In simpler cases, stack() or unstack() may suffice. Hmisc also provides reShape() as an alternative
to reshape().

A.7 Functions in R

Functions in R have several components:

a name (like histogram)2

an ordered list of named arguments that serve as inputs to the function


These are matched first by name and then by order to the values supplied by the call to the
function. This is why we dont always include the argument name in our function calls. On the
other hand, the availability of names means that we dont have to remember the order in which
arguments are listed.
Arguments often have default values which are used if no value is supplied in the function call.

a return value
This is the output of the function. It can be assigned to a variable using the assignment operator
(=, <-, or ->).

side effects
A function may do other things (like make a graph or set some preferences) that are not neces-
sarily part of the return value.

When you read the help pages for an R function, you will see that they are organized in sections
related to these components. The list of arguments appears in the Usage section along with any
2 Actually, it is possible to define functions without naming them; and for short functions that are only needed once,

this can actually be useful.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


112 More About R

default values. Details about how the arguments are used appear in the Arguments section. The
return value is listed in the Value section. Any side effects are typically mentioned in the Details
section.

Now lets try writing our own function. Suppose you frequently wanted to compute the mean, median,
and standard deviation of a distribution. You could make a function to do all three to save some typing.
Lets name our function favstats(). favstats() will have one argument, which we are assuming
will be a vector of numeric values.3 Here is how we could define it:
> favstats <- function(x) {
mean(x)
median(x)
sd(x)
}
> favstats((1:20)^2)
sd
127.9

The first line says that we are defining a function called favstats() with one argument, named x.
The lines surrounded by curly braces give the code to be executed when the function is called. So our
function computes the mean, then the median, then the standard deviation of its argument.

But as you see, this doesnt do exactly what we wanted. So whats going on? The value returned by
the last line of a function is (by default) returned by the function to its calling environment, where it
is (by default) printed to the screen so you can see it. In our case, we computed the mean, median,
and standard deviation, but only the standard deviation is being returned by the function and hence
displayed. So this function is just an inefficient version of sd(). That isnt really what we wanted.

We can use print() to print out things along the way if we like.
> favstats <- function(x) {
print(mean(x))
print(median(x))
print(sd(x))
}
> favstats((1:20)^2)
mean
143.5
median
110.5
sd
127.9

Alternatively, we could use a combination of cat() and paste(), which would give us more control
over how the output is displayed.
> altfavstats <- function(x) {
cat(paste(" mean:", format(mean(x),4),"\n"))
cat(paste(" edian:", format(median(x),4),"\n"))
cat(paste(" sd:", format(sd(x),4),"\n"))
}
> altfavstats((1:20)^2)
mean: 143.5
edian: 110.5
sd: 127.9

Either of these methods will allow us to see all three values, but if we try to store them . . .
3 There are ways to check the class of an argument to see if it is a data frame, a vector, numeric, etc. A really robust

function should check to make sure that the values supplied to the arguments are of appropriate types.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


More About R 113

> temp <- favstats((1:20)^2)


mean
143.5
median
110.5
sd
127.9
> temp
sd
127.9

A function in R can only have one return value, and by default it is the value of the last line in the
function. In the preceding example we only get the standard deviation since that is the value we
calculated last.

We would really like the function to return all three summary statistics. Our solution will be to store
all three in a vector and return the vector.4
> favstats <- function(x) {
c(mean(x), median(x), sd(x))
}
> favstats((1:20)^2)
mean median sd
143.5 110.5 127.9

Now the only problem is that we have to remember which number is which. We can fix this by giving
names to the slots in our vector. While were at it, lets add a few more favorites to the list. Well
also add an explicit return().
> favstats <- function(x) {
result <- c(min(x), max(x), mean(x), median(x), sd(x))
names(result) <- c("min","max","mean","median","sd")
return(result)
}
> favstats((1:20)^2)
min max mean median sd
1.0 400.0 143.5 110.5 127.9
> summary(Sepal.Length~Species, data=iris, fun=favstats)
Sepal.Length N=150

+-------+----------+---+---+---+-----+------+------+
| | |N |min|max|mean |median|sd |
+-------+----------+---+---+---+-----+------+------+
|Species|setosa | 50|4.3|5.8|5.006|5.0 |0.3525|
| |versicolor| 50|4.9|7.0|5.936|5.9 |0.5162|
| |virginica | 50|4.9|7.9|6.588|6.5 |0.6359|
+-------+----------+---+---+---+-----+------+------+
|Overall| |150|4.3|7.9|5.843|5.8 |0.8281|
+-------+----------+---+---+---+-----+------+------+
> aggregate(Sepal.Length~Species, data=iris, FUN=favstats)
Species Sepal.Length.min Sepal.Length.max Sepal.Length.mean Sepal.Length.median
1 setosa 4.3000 5.8000 5.0060 5.0000
2 versicolor 4.9000 7.0000 5.9360 5.9000
3 virginica 4.9000 7.9000 6.5880 6.5000
Sepal.Length.sd
4 If the values had not all been of the same mode, we could have used a list instead.

Computational Stats with R and RStudio 2011, R Pruim SC 11 Seattle


114 More About R

1 0.3525
2 0.5162
3 0.6359

Notice how nicely this works with aggregate() and with the summary() function from the Hmisc
Notice the use of
package. You can, of course, define your own favorite function to use with summary(). The favstats()
:: to select the
favstats() function function in the mosaic package includes the quartiles, mean, standard, deviation, sample size and
from the mosaic number of missing observations.
package rather than
the one we just > mosaic::favstats(rnorm(100))
defined. min Q1 median Q3 max mean sd n missing
-2.371 -0.6595 0.02846 0.7654 2.249 0.01931 0.9744 100 0

Exercises

A.1 Using faithful data frame, make a scatter plot of eruption duration times vs. the time since
the previous eruption.

A.2 The fusion2 data set in the fastR package contains genotypes for another SNP. Merge fusion1,
fusion2, and pheno into a single data frame.

Note that fusion1 and fusion2 have the same columns.


> names(fusion1)
[1] "id" "marker" "markerID" "allele1" "allele2" "genotype" "Adose"
[8] "Cdose" "Gdose" "Tdose"
> names(fusion2)
[1] "id" "marker" "markerID" "allele1" "allele2" "genotype" "Adose"
[8] "Cdose" "Gdose" "Tdose"

You may want to use the suffixes argument to merge() or rename the variables after you are done
merging to make the resulting data frame easier to navigate.

Tidy up your data frame by dropping any columns that are redundant or that you just dont want to
have in your final data frame.

SC 11 Seattle 2011, R Pruim Computational Stats with R and RStudio


Bibliography

[Fis25] R. A. Fisher, Statistical methods for research workers, Oliver & Boyd, 1925.

[Fis70] , Statistical methods for research workers, 14th ed., Oliver & Boyd, 1970.
[GN02] A Gelman and D Nolan, Teaching statistics: a bag of tricks, Oxford University Press, 2002.
[Gou10] R. Gould, Statistics and the modern student, International Statistical Review 78 (2010),
no. 2, 297315.
[Kap09] D. Kaplan, Statistical modeling: A fresh approach, CreateSpace.com, 2009.
[MH08] B. D. Mccullough and David A. Heiser, On the accuracy of statistical procedures in microsoft
excel 2007, Computational Statistics & Data Analysis 52 (2008), 45704578, available online
at www.pages.drexel.edu/~bdm25/excel2007.pdf.

[NT10] D. Nolan and D. Temple Lang, Computing in the statistics curriculum, The American Statis-
tician 64 (2010), no. 2, 97107.
[Sal01] D. Salsburg, The lady tasting tea: How statistics revolutionized science in the twentieth
century, W.H. Freeman, New York, 2001.

[Tuf01] E. R. Tufte, The visual display of quantitative information, 2nd ed., Graphics Press, Cheshire,
CT, 2001.

115

You might also like