Bioinformatica
Bioinformatica
BIOINFORMATICS
A PRACTICAL INTRODUCTION
Series Editors
Alison M. Etheridge
Department of Statistics
University of Oxford
Louis J. Gross
Department of Ecology and Evolutionary Biology
University of Tennessee
Suzanne Lenhart
Department of Mathematics
University of Tennessee
Philip K. Maini
Mathematical Institute
University of Oxford
Shoba Ranganathan
Research Institute of Biotechnology
Macquarie University
Hershel M. Safer
Weizmann Institute of Science
Bioinformatics & Bio Computing
Eberhard O. Voit
The Wallace H. Couter Department of Biomedical Engineering
Georgia Tech and Emory University
Proposals for the series should be submitted to one of the series editors above or directly to:
CRC Press, Taylor & Francis Group
4th, Floor, Albert House
1-4 Singer Street
London EC2A 4BQ
UK
WING-KIN SUNG
This book contains information obtained from authentic and highly regarded sources. Reasonable efforts
have been made to publish reliable data and information, but the author and publisher cannot assume
responsibility for the validity of all materials or the consequences of their use. The authors and publishers
have attempted to trace the copyright holders of all material reproduced in this publication and apologize to
copyright holders if permission to publish in this form has not been obtained. If any copyright material has
not been acknowledged please write and let us know so we may rectify in any future reprint.
Except as permitted under U.S. Copyright Law, no part of this book may be reprinted, reproduced, transmit-
ted, or utilized in any form by any electronic, mechanical, or other means, now known or hereafter invented,
including photocopying, microfilming, and recording, or in any information storage or retrieval system,
without written permission from the publishers.
For permission to photocopy or use material electronically from this work, please access www.copyright.
com (http://www.copyright.com/) or contact the Copyright Clearance Center, Inc. (CCC), 222 Rosewood
Drive, Danvers, MA 01923, 978-750-8400. CCC is a not-for-profit organization that provides licenses and
registration for a variety of users. For organizations that have been granted a photocopy license by the CCC,
a separate system of payment has been arranged.
Trademark Notice: Product or corporate names may be trademarks or registered trademarks, and are used
only for identification and explanation without intent to infringe.
Sung, Wing-Kin.
Algorithms in bioinformatics : a practical introduction / Wing-Kin Sung.
p. cm. -- (CHAPMAN & HALL/CRC mathematical and computational biology
series)
Includes bibliographical references and index.
ISBN 978-1-4200-7033-0 (hardcover : alk. paper)
1. Bioinformatics. 2. Genetic algorithms. I. Title. II. Series.
QH324.2.S86 2009
572.80285--dc22 2009030738
Preface xv
2 Sequence Similarity 29
2.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
2.2 Global Alignment Problem . . . . . . . . . . . . . . . . . . 30
2.2.1 Needleman-Wunsch Algorithm . . . . . . . . . . . . 32
2.2.2 Running Time Issue . . . . . . . . . . . . . . . . . . 34
2.2.3 Space Eciency Issue . . . . . . . . . . . . . . . . . 35
vii
viii
3 Sux Tree 57
3.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
3.2 Sux Tree . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
3.3 Simple Applications of a Sux Tree . . . . . . . . . . . . . 59
3.3.1 Exact String Matching Problem . . . . . . . . . . . 59
3.3.2 Longest Repeated Substring Problem . . . . . . . . 60
3.3.3 Longest Common Substring Problem . . . . . . . . 60
3.3.4 Longest Common Prex (LCP) . . . . . . . . . . . 61
3.3.5 Finding a Palindrome . . . . . . . . . . . . . . . . . 62
3.3.6 Extracting the Embedded Sux Tree of a String from
the Generalized Sux Tree . . . . . . . . . . . . . . 63
3.3.7 Common Substring of 2 or More Strings . . . . . . 64
3.4 Construction of a Sux Tree . . . . . . . . . . . . . . . . . 65
3.4.1 Step 1: Construct the Odd Sux Tree . . . . . . . 68
3.4.2 Step 2: Construct the Even Sux Tree . . . . . . . 69
3.4.3 Step 3: Merge the Odd and the Even Sux Trees . 70
3.5 Sux Array . . . . . . . . . . . . . . . . . . . . . . . . . . . 72
3.5.1 Construction of a Sux Array . . . . . . . . . . . . 73
3.5.2 Exact String Matching Using a Sux Array . . . . 73
3.6 FM-Index . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76
3.6.1 Denition . . . . . . . . . . . . . . . . . . . . . . . . 77
3.6.2 The occ Data Structure . . . . . . . . . . . . . . . . 78
3.6.3 Exact String Matching Using the FM-Index . . . . 79
3.7 Approximate Searching Problem . . . . . . . . . . . . . . . 81
3.8 Exercises . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82
4 Genome Alignment 87
4.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . 87
4.2 Maximum Unique Match (MUM) . . . . . . . . . . . . . . . 88
4.2.1 How to Find MUMs . . . . . . . . . . . . . . . . . . 89
4.3 MUMmer1: LCS . . . . . . . . . . . . . . . . . . . . . . . . 92
4.3.1 Dynamic Programming Algorithm in O(n2 ) Time . 93
4.3.2 An O(n log n)-Time Algorithm . . . . . . . . . . . . 93
ix
References 349
Index 375
Preface
xv
xvi
Wing-Kin Sung
Chapter 1
Introduction to Molecular Biology
1.1.1 Proteins
Proteins constitute most of a cells dry mass. They are not only the building
blocks from which cells are built, but also execute nearly all cell functions.
Understanding proteins can guide us to understand how our bodies function
and other biological processes.
A protein is made from a long chain of amino acids, each linking to its
neighbor through a covalent peptide bond. Therefore, proteins are also known
as polypeptides. There are 20 types of amino acids and each amino acid carries
dierent chemical properties. The length of a protein is in the range of 20
to more than 5000 amino acids. On average, a protein contains around 350
amino acids.
In order to perform their chemical functions, proteins need to fold into
certain 3 dimensional shapes. The folding of the proteins is caused by the
weak interactions among amino acid residues. The weak interactions include
1
2 Algorithms in Bioinformatics A Practical Introduction
hydrogen bonds, ionic bonds, van der Waals attractions, and the hydrophobic
interactions. These interactions determine the shape of a protein, which is
vital to its functionality.
Amino H O
group
NH2 C C OH Carboxyl group
C R
(the central carbon) R group
All three groups are attached to a single carbon atom called -carbon or
C (see Figure 1.1). There are 20 common amino acids, characterized by
dierent R groups. These 20 amino acids can be classied according to their
mass, volume, acidity, polarity, and hydrophobicity. Figure 1.2 shows a table
describing the properties of these 20 amino acids. The mass and volume are
given in Daltons and in A3 , respectively, of the R groups of the 20 amino
acids. The acidity indicates if the R group of an amino acid is basic, acidic,
or neutral. A basic amino acid is positively charged while an acidic amino
acid is negatively charged.
The polarity indicates if the charge distribution within the R group of an
amino acid is uneven or not. All acidic and basic amino acids are polar. For
neutral amino acids, they are non-polar if the R groups are overall uncharged;
otherwise, if they have uneven charge distribution, they are polar.
Amino acids can be hydrophilic or hydrophobic. A hydrophilic amino acid
can form hydrogen bonds with water; otherwise, the amino acid is hydropho-
bic. The hydropathy index measures the hydrophobicity of an amino acid.
A positive index indicates the amino acid is hydrophobic; a negative index
indicates it is hydrophilic. As polar amino acids can form hydrogen bonds,
Introduction to Molecular Biology 3
Amino Acid 1-Letter 3-Letter Avg. Mass volume Side chain Side chain acid- Hydropathy
(Da) (A3 ) polarity ity or basicity index
Alanine A Ala 89.09404 67 non-polar Neutral 1.8
Cysteine C Cys 121.15404 86 polar basic (strongly) -4.5
Aspartic acid D Asp 133.10384 91 polar Neutral -3.5
Glutamic acid E Glu 147.13074 109 polar acidic -3.5
Phenylalanine F Phe 165.19184 135 polar neutral 2.5
Glycine G Gly 75.06714 48 polar acidic -3.5
Histidine H His 155.15634 118 polar neutral -3.5
Isoleucine I Ile 131.17464 124 non-polar neutral -0.4
Lysine K Lys 146.18934 135 polar basic (weakly) -3.2
Leucine L Leu 131.17464 124 non-polar neutral 4.5
Methionine M Met 149.20784 124 non-polar neutral 3.8
Asparagine N Asn 132.11904 96 polar basic -3.9
Proline P Pro 115.13194 90 non-polar neutral 1.9
Glutamine Q Gln 146.14594 114 non-polar neutral 2.8
Arginine R Arg 174.20274 148 non-polar neutral -1.6
Serine S Ser 105.09344 73 polar neutral -0.8
Threonine T Thr 119.12034 93 polar neutral -0.7
Valine V Val 117.14784 105 non-polar neutral -0.9
Tryptophan W Trp 204.22844 163 polar neutral -1.3
Tyrosine Y Tyr 181.19124 141 non-polar neutral 4.2
FIGURE 1.2: Table for the 20 standard amino acids and their chemical
properties.
polar amino acids are usually hydrophilic while non-polar amino acids are
hydrophobic. Moreover, there are exceptions since the hydrophilic and hy-
drophobic interactions do not have to rely only on the side chains of amino
acids themselves. Usually, hydrophilic amino acids are found on the outer
surface of a folded protein and hydrophobic amino acids tend to appear inside
the surface of a folded protein.
In addition to the 20 common amino acids, there are non-standard amino
acids. Two non-standard amino acids which appear in proteins and can be
specied by genetic code (see Section 1.4.3.1) are selenocysteine (Sec, U) and
pyrrolysine (Pyl, O). There are also non-standard amino acids which do not
appear in proteins. Examples include lanthionine, 2-aminoisobutyric acid, and
dehydroalanine. They often occur as intermediates in the metabolic pathways
for standard amino acids. Some non-standard amino acids are formed through
modication to the R-groups of standard amino acids. One example is hydrox-
yproline, which is made by a post-translational modication (see Section 1.5)
of proline.
H O H O Peptide bond
NH2 C C OH + NH2 C C OH
R R' H O H O
NH2 C C N C C OH
R H R'
1.1.2 DNA
Deoxyribonucleic acid (DNA) is the genetic material in all organisms (with
certain viruses being an exception) and it stores the instructions needed by
the cell to perform daily life functions.
DNA can be thought of as a large cookbook with recipes for making every
protein in the cell. The information in DNA is used like a library. Library
books can be read and reread many times. Similarly, the information in the
genes is read, perhaps millions of times in the life of an organism, but the
DNA itself is never used up.
DNA consists of two strands which are interwoven together to form a double
helix. Each strand is a chain of small molecules called nucleotides.
1.1.2.1 Nucleotides
Nucleotides are the building blocks of all nucleic acid molecules. Their
structure is shown in Figure 1.4. Each nucleotide consists of:
N
N Base
N
OH (Adenine)
5
Phosphate HO P O CH3 N N
O O
4 H 1
H Deoxyribose
H H
3 2
OH H
FIGURE 1.4: Structure of the nucleotide that forms DNA. The numbers
1 , 2 , . . . , 5 label the dierent carbons on the ring structure.
N
N
N
O O O
O P O P O P O CH3 N N
O O O O
H H
H H N
OH H
N
N
O O
H2O
O P O P O CH3 N N
O
+ HPO42- + H+
O O
H H
H H
OH H
N O O N O
N N N N
N N N
N N N N N N O N O N O
The nitrogenous bases are dierent, but they still show similarities. A and
G are called purines and they have two ring structure. C, T, and U are
pyrimidines and they have one ring structure. For DNA, only the bases A, C,
G, and T are used.
Two nucleotides can be linked through the sugar-phosphate bond, which
connects the phosphate (at the 5 carbon of one nucleotide) to the 3 carbon
of another nucleotide. By repeatedly linking the nucleotides, we get a polynu-
cleotide. Figure 1.7 shows an example of a chain of 5 nucleotides. Similar to
a polypeptide, a polynucleotide is also asymmetric. Conventionally, we write
the sequence from the 5 end to the 3 end. So, the chain in Figure 1.7 is
written as ACGTA.
P P P P
3
5
A C G T A
A C G T T G C A A C G T T G C A
|| ||| ||| || || ||| ||| || || ||| ||| || || ||| ||| ||
T G C A A C G T T G C A A C G T
(a)
(b)
FIGURE 1.8: (a) The double-stranded DNA. The two strands show a com-
plementary base pairing. A = T and C G are formed by two and three
hydrogen bonds, respectively. (b) The three-dimensional structure of the same
double-stranded DNA. They form double helix. (See color insert after page
270.)
From the two observations, Watson and Crick proposed that DNA exists
as a double helix in which polynucleotide chains consist of a sequence of
nucleotides linked together by the sugar-phosphate bond. The two polynu-
cleotide strands are held together by hydrogen bonds between bases in op-
posing strands. The base pairs are of high specicity such that: A is always
paired with T and G is always paired with C. These base pairs are called the
complementary base pairing (or Watson-Crick base pairing). A can form two
hydrogen-bonds with T, whereas G can form three hydrogen-bonds with C.
Figure 1.9 shows the two base pairings.
As shown in Figure 1.7, nucleotides are chained to form a strand of DNA. It
has direction: from 5 to 3 (upstream). Similarly, the complementary strand
are formed by chaining the complementary nucleotides. It goes from 3 to 5
(downstream). Two strands are held together due to the Watson-Crick base
8 Algorithms in Bioinformatics A Practical Introduction
T
A
|10
FIGURE 1.9: Watson-Crick base pairing. Note that the distance between
the complementary base pair is about 10A. (See color insert after page 270.)
pairing. The distance between the two strands is about 10A. Due to the weak
interaction force, the two strands form double helix as shown in Figure 1.8.
There are two types of organisms, i.e., prokaryotes and eukaryotes. Prokary-
otes are single-celled organisms with no nuclei (e.g., bacteria). They have no
distinct nuclear compartment to house their DNA and therefore the DNA
swims within the cells. Eukaryotes are organisms with single or multiple
cells, for example, plant and animal. Each eukaryotes cell contains a nucleus
surrounded by cytoplasm, which is contained within a plasma membrane.
Most DNA is located within the nucleus. Moreover, some DNA is located in
mitochondria and chloroplasts1.
DNA usually exists in linear form, e.g., the nuclear DNA in human and
yeast exists in linear form. However, in mitochondria, chloroplasts, viruses,
and prokaryotes, DNA exists in circular form.
1.1.3 RNA
Ribonucleic acid (RNA) is the nucleic acid which is produced during the
transcription process (i.e., from DNA to RNA). However, in certain organisms,
such as viruses, RNA is used as genetic material instead of DNA.
want to do two dierent things at the same time, you can never do either one
as perfectly as those people who only focus on one thing. For the storage of
information, RNA is not as stable as DNA and thats why we still have DNA.
Protein can perform more functions than RNA does, which is the reason why
protein is still needed.
1.2.2 Chromosome
A genome is not one consecutive double-stranded DNA chain. For instance,
the 3 billion bases of the human genome is partitioned into 23 separate pairs
of DNA, called chromosomes. Each chromosome is a double-stranded DNA
Introduction to Molecular Biology 11
1.2.3 Gene
A gene is a DNA sequence that encodes a protein or an RNA molecule.
Each chromosome contains many genes, which are the basic physical and
functional units of heredity. Each gene exists in a particular position of a par-
ticular chromosome. In the human genome, there are approximately 20,000
30,000 genes. In the prokaryotic genome, one gene corresponds to one protein,
whereas in a eukaryotic genome, one gene can correspond to more than one
protein because of the process called alternative splicing (see Section 1.4.2).
RNA AAAA
DNA DNA
transcription
transcription
Add 5 cap and
poly A tail
AAAAA
RNA splicing
translation
AAAAA
nucleus export
AAAAA
modification translation
modification
cytoplasm cytoplasm
FIGURE 1.12: Central dogma for (a) prokaryotes and (b) eukaryotes. (See
color insert after page 270.)
from DNA to mRNA and (2) T is replaced by U (in RNA we only have U
instead of T). Once the RNA polymerase reaches the transcription stop site
(a marker denoting the end of a gene), the transcription process is stopped
and an mRNA is obtained.
1.4.3 Translation
Translation is also called protein synthesis. It synthesizes a protein from
an mRNA. The translation process is handled by a molecular complex known
as a ribosome which consists of both proteins and ribosomal RNA (rRNA).
First, the ribosome reads mRNA from 5 to 3 . The translation starts around
the start codon (translation start site). Then, with the help of transfer RNA
(tRNA, a class of RNA molecules that transport amino acids to ribosomes for
incorporation into a polypeptide undergoing synthesis), each codon is trans-
lated to an amino acid. Finally the translation stops once the ribosome reads
the stop codon (translation stop site).
T C A G
TTT Phe [F] TCT Ser [S] TAT Tyr [Y] TGT Cys [C] T
TTC Phe [F] TCC Ser [S] TAC Tyr [Y] TGC Cys [C] C
T
TTA Leu [L] TCA Ser [S] TAA Ter [end] TGA Ter [end] A
TTG Leu [L] TCG Ser [S] TAG Ter [end] TGG Trp [W] G
CTT Leu [L] CCT Pro [P] CAT His [H] CGT Arg [R] T
CTC Leu [L] CCC Pro [P] CAC His [H] CGC Arg [R] C
C
CTA Leu [L] CCA Pro [P] CAA Gln [Q] CGA Arg [R] A
CTG Leu [L] CCG Pro [P] CAG Gln [Q] CGG Arg [R] G
ATT Ile [I] ACT Thr [T] AAT Asn [N] AGT Ser [S] T
ATC Ile [I] ACC Thr [T] AAC Asn [N] AGC Ser [S] C
A
ATA Ile [I] ACA Thr [T] AAA Lys [K] AGA Arg [R] A
ATG Met [M] ACG Thr [T] AAG Lys [K] AGG Arg [R] G
GTT Val [V] GCT Ala [A] GAT Asp [D] GGT Gly [G] T
GTC Val [V] GCC Ala [A] GAC Asp [D] GGC Gly [G] C
G
GTA Val [V] GCA Ala [A] GAA Glu [E] GGA Gly [G] A
GTG Val [V] GCG Ala [A] GAG Glu [E] GGG Gly [G] G
terminates.
Two stop codons UGA and UAG sometimes can also encode two non-
standard amino acids selenocysteine (Sec, U) and pyrrolysine (Pyl, O), respec-
tively. The UGA codon is normally a stop codon. In the presence of a SECIS
element (SElenoCysteine Insertion Sequence) in the mRNA, the UGA codon
encodes selenocysteine. Pyrrolysine is used by some enzymes in methanogenic
archaea to produce methane. It is coded by the UAG codon in the presence
of a PYLIS element.
Although most amino acids are coded by more than one codon in the genetic
code table, dierent organisms often prefer to encode each amino acid with
one particular codon. Even more interesting, some organisms use the codon
usage to control the eciency of translation. For example, in S. pombe, C.
elegans, D. melanogaster, and many unicellular organisms, highly expressed
genes like those encoding ribosomal proteins use codons whose tRNAs are the
most abundant in the organism; on the other hand, low expressed genes use
codons whose tRNAs are the least abundant.
codons, there are a total of 61 dierent tRNAs. Each tRNA has a cloverleaf-
shaped structure. On one side it holds an anticodon (a sequence of three
adjacent nucleotides in tRNA designating a specic amino acid that binds to
a corresponding codon in mRNA during protein synthesis), and on the other
side it holds the appropriate amino acid. The structure of tRNA helps to
associate the codon with the corresponding amino acid.
transcription transcription
start site start codon stop codon start site
regulatory region 5' untranslated region coding region 3' untranslated region
Nowadays, over 3000 restriction enzymes have been studied and many of
them have been isolated. The isolated restriction enzymes become a standard
tool for cutting DNA at specic sites with many applications. For example,
restriction enzymes are used in cloning applications (see Section 1.7.3) to
assist the insertion of the target DNA segment into the plasmid vectors.
1.7.2 Sonication
Sonication is another method to cut a DNA fragment. It applies high vibra-
tion (usually ultrasound) to randomly chop a sample of the DNA fragment
into small fragments. Sonication has been applied to binding site nding,
genome sequencing, bacteria detection, etc.
1.7.3 Cloning
Cloning allows us to multiply the available amount of DNA in order to
have enough DNA for many experiments. Precisely, given a piece of DNA
X, cloning is the process of duplicating many copies of DNA X. The idea is
to insert the DNA X into bacterial host cells. Through replicating the cells,
DNA X is replicated. The basic steps of cloning are as follows.
and obtain a recombinant DNA molecule. This step is done with the
help of a restriction enzyme and a DNA ligase2 .
2. Insert the recombinant DNA into the host cell (usually E. coli) using
the chemical transformation method, where the bacterial cells are made
competent to take up foreign DNA by treating the cells with calcium
ions. An alternative way is to insert the recombinant DNA by the elec-
troporation method. After the recombinant DNA molecules are mixed
with the bacteria cells, a brief heat shock is applied to facilitate uptake
of DNA.
3. Grow the host cells in the presence of antibiotic. Note that only cells
with the antibiotic-resistance gene can grow. When the host cell dupli-
cates, X is also duplicated.
4. Select those cells that contain both the antibiotic-resistance genes and
the foreign DNA X. DNA X is then extracted from these cells.
1.7.4 PCR
PCR is an acronym which stands for polymerase chain reaction. It applies
DNA polymerase in a chain reaction to amplify the target DNA fragments in
vitro (i.e., outside a living cell). As stated in Section 1.3, the DNA polymerase
is a naturally occurring biological macromolecule that catalyzes the formation
and repairs DNA. The accurate replication of all living matter depends on this
activity. In the 1980s, Kary Mullis at Cetus Corporation conceived a way to
start and stop a DNA polymerases action at specic points along a single-
strand of DNA. Mullis also realized that by harnessing this component of
molecular reproduction technology, the target DNA could be exponentially
amplied.
Inputs for PCR include:
1. The DNA fragment we hope to amplify;
2. Two oligonucleotides are synthesized, each complementary to the two
ends of the DNA fragments to be amplied. They are called primers;
and
3. The thermostable DNA polymerase Taq3 . This polymerase can perform
replication at a temperature up to 95 C.
2A DNA ligase is an enzyme that can catalyse the joining of two DNA fragments.
3 Taqstands for the bacterium Thermus aquaticus which lives in hot springs and can be
found in Yellowstone National Park. From this bacterium, the thermostable DNA poly-
merase was isolated.
Introduction to Molecular Biology 21
After the last cycle, Phase 3 is kept for a longer time, about 10 minutes, to
ensure that DNA synthesis for all strands is complete. Then, only the anked
region by the primers has been amplied exponentially, while the other regions
are not. Please refer to Figure 1.16 for a comprehensive picture of how PCR
works.
The PCR method is used to amplify DNA segments to the point where
it can be readily isolated for use. When scientists succeeded in making the
polymerase chain reaction to perform as desired in a reliable fashion, they
had a powerful technique for providing unlimited quantities of the precise
genetic material for experiments. For instance, PCR has been applied to (1)
clone DNA fragments from mummies and (2) detect viral infections in blood
samples. For the latest developments in the PCR method, please refer to [32].
22 Algorithms in Bioinformatics A Practical Introduction
a particular base.
DNA sequencing can be automated by using a laser to detect the separated
products in real time during gel electrophoresis. The four bases are labelled
with dierent uorophores and they are placed in a single lane. In this way,
many DNA samples can be sequenced simultaneously. Sequences of greater
than 900 bases can be obtained with 98% accuracy.
1.7.6 Hybridization
Routinely, biologists need to nd a DNA fragment containing a particular
DNA subsequence among millions of DNA fragments. The above problem
can be solved through hybridization. For example, suppose we need to nd a
DNA fragment which contains ACCGAT, we can perform the following steps.
FIGURE 1.18: This gure shows an array with 9 probes. Each probe is
the reverse complement of some short DNA fragment which forms a nger-
print (that is, unique identier) of a certain target DNA sequence. When the
array is exposed to a certain DNA sample, some probes will light-up if the
corresponding target DNA sequences exist in the sample. (See color insert
after page 270.)
bonds. This idea allows us to detect what DNA sequences appear in the
sample.
1.9 Exercises
1. Can you visit the gene bank and check a number of protein sequences?
What are the rst amino acids in those protein sequences? Any expla-
nation for your observation?
2. Within a Eukaryotes cell, how many copies of nuclear DNA and mito-
chondrial DNA do we have?
3. Are genes randomly distributed in our genome? For example, can you
check the distribution of the Hox genes in human?
4. Dierent species encodes the same amino acid using dierent codons.
For the amino acid Q, can you check the most frequent used codons
in Drosophila melanogaster, human, and Saccharomyces cerevisiae? Is
there any codon bias for dierent species?
5. For the following mRNA sequence, can you extract its 5 UTR, 3 UTR
and the protein sequence?
ACTTGTCATGGTAACTCCGTCGTACCAGTAGGTCATG
Chapter 2
Sequence Similarity
2.1 Introduction
The earliest research in sequence comparison can be dated back to 1983,
when Doolittle et al. [82] searched for platelet-derived growth factor (PDGF)
in their database. They found that PDGF is similar to v-sis onc gene.
PDGF-2 01 ------SLGSLTIAEPAMIAECKTREEVFCICRRL?DR?? 34
p28sis 61 LARGKRSLGSLSVAEPAMIAECKTRTEVFEISRRLIDRTN 100
At that time, the function of v-sis onc gene was still unknown. Based on the
similarity between v-sis onc gene and PDGF, they claimed that the trans-
forming protein of the primate sarcoma virus and the platelet-derived growth
factor are derived from the same or closely related cellular genes. This was
later proven by scientists. Research conducted by Riordan et al. [244] showed
a similar result. They tried to understand the cystic brosis gene using mul-
tiple sequence alignment in 1989. They showed that similar gene sequences
did imply similar functionalities.
Motivated by the above examples, there is a well-known conjecture in bi-
ology: If any two protein (or DNA, or RNA) sequences are similar, they will
have similar functions or 3D structures. Bioinformaticians often compare the
similarity between two biological sequences to understand their structures or
functionalities. Below, we show some example applications.
29
30 Algorithms in Bioinformatics A Practical Introduction
As a matter of fact, the reverse of the conjecture may not always be true.
For example, the hemoglobin of V. stercoraria (bacterial) and that of P. mari-
nus (eukaryotic) are similar in structure and function; their protein sequences
share just 8% sequence identity.
There are many dierent sequence comparison problems depending on the
objective functions (or the denitions of similarity). In this chapter, we will
discuss the following three alignment problems: global alignment, local align-
ment, and semi-global alignment. We also study the alignment problems
under dierent gap penalty functions. Finally, we discuss how similarity ma-
trices like PAM and BLOSUM are generated.
mismatch, insert, and delete are 1, 2, and 2, respectively, then the total cost
to transform interestingly to bioinformatics is 16.
Unlike edit distance which measures the dierence between two sequences,
we sometimes want to know the similarity of two sequences. The global align-
ment problem is aimed at this purpose. First, lets give a formal denition of
alignment.
-i--nterestingly
bioinformatics--
Two sequences are similar if their alignment contains many positions having
the same symbols while minimizing the number of positions that are dier-
ent. In general, we can associate a similarity score with every pair of aligned
characters. Let be the alphabet set and be a special symbol representing
a null symbol. The similarity of a pair of aligned characters can be specied
by a matrix , where (x, y) equals the similarity of x and y for x, y { }.
Figure 2.1 shows an example of a similarity matrix. A more in-depth study
of similarity matrices is given in Section 2.6.
The aim of the global alignment problem is to nd an alignment A which
maximizes (x,y)A (x, y). Such alignment is called the optimal alignment.
There is a one-to-one correspondence between a pair of aligned characters
and an edit operation. When a pair of aligned characters are the same, it is
called a match; otherwise it is called a mismatch. When a space is introduced
in the rst sequence, it is called an insert while a space in the second sequence
is called a delete. For the above example, the alignment corresponds ve
matches, six mismatches, three inserts, and two deletes.
The global alignment problem and the string edit distance problem are in
fact a dual problem. The lemma below shows that the solutions reported by
them are in fact the same.
LEMMA 2.1
Let be the cost matrix of the edit distance problem and be the score matrix
of the global alignment problem. If (x, y) = (x, y) for all x, y { },
the solution to the edit distance problem is equivalent to the solution to the
string alignment problem.
32 Algorithms in Bioinformatics A Practical Introduction
Although string edit and global alignment are equivalent, people in com-
putational biology prefer to use global alignment to measure the similarity of
DNA, RNA, and protein sequences.
Before we end this section, we give an example of global alignment. Con-
sider the similarity matrix for { , A, C, G, T } in Figure 2.1, where (x, y) =
2, 1, 1, 1 for match, mismatch, delete, and insert, respectively. One pos-
sible alignment of two DNA sequences S = ACAAT CC and T = AGCAT GC
is shown below.
S = A-CAATCC
T = AGCA-TGC
The above alignment has ve matches, one mismatch, one insert, and one
delete. Thus, the similarity score of this alignment is 7 (2 5 1 1 1 = 7).
We can check that this alignment has the maximum score. Hence, it is an
optimal alignment. Note that S and T may have more than one optimal
alignment. For the example, another optimal alignment is as follows.
S = A-CAATCC
T = AGC-ATGC
- A C G T
- -1 -1 -1 -1
A -1 2 -1 -1 -1
C -1 -1 2 -1 -1
G -1 -1 -1 2 -1
T -1 -1 -1 -1 2
V (i 1, j 1) + (S[i], T [j]) match/mismatch
V (i, j) = max V (i 1, j) + (S[i], ) delete
V (i, j 1) + ( , T [j]) insert
The optimal alignment score of S[1..n] and T [1..m] is V (n, m). This score
can be computed by lling in the table V (1..n, 1..m) row by row using the
above recursive equations. Figure 2.2 shows the table V of the two strings
S = ACAAT CC and T = AGCAT GC. For example, the value in the entry
V (1, 1) is obtained by choosing the maximum of {0 + 2, 1 1, 1 1}. The
score of the optimal alignment is obtained at the bottom right corner of the
table V (7, 7) which is 7.
To recover the optimal alignment, for every entry, we draw arrows to in-
dicate the ways to get the corresponding values. We draw a diagonal arrow,
a horizontal arrow, or a vertical arrow for the entry V (i, j) if V (i, j) equals
V (i 1, j 1) + (S[i], T [j]), V (i, j 1) + ( , T [j]), or V (i 1, j) + (S[i], ),
respectively. Figure 2.2 shows an example. In the example, since the value at
V (1, 1) is obtained by V (0, 0) + 2, we draw a diagonal arrow. For the entry
34 Algorithms in Bioinformatics A Practical Introduction
_ A G C A T G C
_ 0 -1 -2 -3 -4 -5 -6 -7
A -1 2 1 0 -1 -2 -3 -4
C -2 1 1 3 2 1 0 -1
A -3 0 0 2 5 4 3 2
A -4 -1 -1 1 4 4 3 2
T -5 -2 -2 0 3 6 5 4
C -6 -3 -3 0 2 5 5 7
C -7 -4 -4 -1 1 4 4 7
V (3, 2), there are two ways to get the maximum value. Hence, we draw both
diagonal and vertical arrows. The optimal alignment is obtained by back-
tracing the arrows from V (7, 7) back to V (0, 0). If the arrow is diagonal, two
characters will be aligned. If it is horizontal or vertical, a deletion or an inser-
tion, respectively, will be present in the alignment. In Figure 2.2, the optimal
alignment score is V (7, 7) = 7. Through back-tracing from V (7, 7) to V (0, 0),
the path is 0 1 3 5 4 6 5 7. The corresponding opti-
mal alignment is A CAAT CC and AGCA T GC. The optimal alignment
is not unique. We may get another optimal alignment: A CAAT CC and
AGC AT GC.
Finally, we analyze the time and space complexity of the Needleman-Wunsch
algorithm. The Needleman-Wunsch algorithm lls in nm entries of the table
V (1..n, 1..m). Each entry requires O(1) word space and can be computed in
O(1) time. Hence, the Needleman-Wunsch algorithm computes the optimal
global alignment of S[1..n] and T [1..m] using O(nm) time and O(nm) space.
_ A G C A T G C
2d+1 _ 0 -1 -2 -3
A -1 2 1 0 -1
C -2 1 1 3 2 1
A -3 0 0 2 5 4 3
A -1 -1 1 4 4 3 2
T -2 0 3 6 5 4
C 0 2 5 5 7
C 1 4 4 7
(a) (b)
Hence, when we ll in the i-th row in the table V , only the values in the
(i 1)-th row are needed.
Therefore, if we just want to compute the optimal alignment score, it is
unnecessary to store all values in the table V . Precisely, when we ll in the
i-th row of the table V , we only keep the values in the (i 1)-th row. In this
way, the space complexity becomes O(m). This method is called the cost-only
Needleman-Wunsch algorithm.
Although the space complexity is reduced from O(nm) to O(m), we only
compute the optimal alignment score. Can we also reconstruct the optimal
alignment? The answer is YES! Below, we present Hirschbergs algorithm
[147] which computes the optimal alignment of two strings S[1..n] and T [1..m]
in O(n + m) space.
The main observation is that the optimal alignment score of (S[1..n], T [1..m])
is the sum of (1) the optimal alignment score of (S[1..n/2], T [1..j]) and (2) the
optimal alignment score of (S[n/2+1..n], T [j +1..m]) for some j. Equation 2.1
illustrates this idea. Note that AS(A, B) denotes the optimal alignment score
between sequences A and B.
AS(S[1..n], T [1..m]) =
max {AS(S[1..n/2], T [1..j]) + AS(S[n/2 + 1..n], T [j + 1..m])} (2.1)
1jm
The integer j, which maximizes the sum, is called the mid-point. The
algorithm FindMid in Figure 2.4 describes how to compute the mid-point
using the cost-only Needleman-Wunsch algorithm.
Figure 2.5 gives an example demonstrating how the algorithm FindMid
computes the mid-point. Step 1 lls in the rst half of the table to compute
AS(S[1..n/2], T [1..j]) for all j. Then, Step 2 lls in the second half of the table
in reverse to compute AS(S[n/2 + 1..n], T [j + 1..m]) for all j. Finally, Step
3 computes the score AS(S[1..n/2], T [1..j]) + AS(S[n/2 + 1..n], T [j + 1..m]),
for j = 0, 1, . . . , m 1, by getting the m sums of the m diagonal pairs from
the two middle rows. Then, we obtain the mid-point j which corresponds to
the maximum sum. Here the maximum score is 7, which is the sum of 4 and
3 and the position j = 4 is determined to be the mid-point.
Sequence Similarity 37
_ A G C A T G C _
_ 0 -1 -2 -3 -4 -5 -6 -7
A -1 2 1 0 -1 -2 -3 -4
C -2 1 1 3 2 1 0 -1
A -3 0 0 2 5 4 3 2
A -4 -1 -1 1 4 4 3 2
T -1 0 1 2 3 0 0 -3
C -2 -1 1 -1 0 1 1 -2
C -4 -3 -2 -1 0 1 2 -1
_ -7 -6 -5 -4 -3 -2 -1 0
If we divide the problem into two halves based on the mid-point and recur-
sively deduce the alignments for the two halves, we can compute the optimal
alignment while using O(n + m) word space. The detailed algorithm is shown
in Figure 2.6 and the idea is illustrated in Figure 2.7.
Below, we analyze the time and the space complexities. For algorithm
FindMid, both steps 1 and 2 take O(nm/2) time. Step 3 nds the maximum
of m sums, which requires O(m) time. In total, FindMid takes O(nm) time.
For algorithm Alignment, let the running time of Alignment(S[1..n], T [1..m])
be T ime(n, m). T ime(n, m) = time for nding the mid-point + time for solv-
ing the two subproblems = O(nm) + T ime(n/2, j) + T ime(n/2, m j). By
solving the recursive equation, the time complexity is T ime(n, m) = O(nm).
For space complexity, the working memory for nding the mid-point takes
O(m) space. Once we nd the mid-point, we can free the working memory.
38 Algorithms in Bioinformatics A Practical Introduction
n/2 n/2
j j
(a) (b)
FIGURE 2.7: (a) When we call Alignment(S[1..n], T [1..m]),
we rst compute the mid-point j and generate two subproblems
Alignment(S[1..n/2], T [1..j]) and Alignment(S[n/2 + 1..n], T [j + 1..m]).
(b) By recursion, we obtain the alignments for the two subproblems. By
concatenating the two alignments, we obtain the alignment of S[1..n] and
T [1..m].
In each recursive call, we only need to store the alignment path. Therefore
the space complexity is O(m + n).
V (i, 0) = 0 for 0 i n
V (0, j) = 0 for 0 j m
40 Algorithms in Bioinformatics A Practical Introduction
_ C T C A T G C
_ 0 0 0 0 0 0 0 0
A 0 0 0 0 2 1 0 0
C 0 2 1 2 1 1 0 2
A 0 1 1 1 4 3 2 1
A 0 0 0 0 3 3 2 1
T 0 0 2 1 2 5 4 3
C 0 2 1 4 3 4 4 6
G 0 1 1 3 3 3 6 5
For case (2), when both i > 0 and j > 0, there are two scenarios. The rst
scenario is that the best alignment aligns empty strings of S and T . In this
case, V (i, j) = 0. For another scenario, within the best alignment between
some substring of S ends at i and some substring of T ends at j, the last pair
of aligned characters should be either match/mismatch, delete, or insert. To
get the optimal score, we choose the maximum value among 0 and these three
cases. Thus, we get the following recurrence relation:
0 align empty strings
V (i 1, j 1) + (S[i], T [j]) match/mismatch
V (i, j) = max
V (i 1, j) + (S[i], ) delete
V (i, j 1) + ( , T [j]) insert
The optimal local alignment score is maxi,j V (i, j). Smith and Waterman
proposed that this score can be computed by lling in the table V row by row
using the above recursive equations. For example, consider S = ACAAT CG
and T = CT CAT GC. Assume a match score is +2 and an insert/delete score
is 1. Figure 2.8 shows the table V . The maximum score in the table V is
6. Thus, the optimal local alignment score is 6. Through back-tracing from
V (7, 6), we can recover the optimal alignment, which corresponds to the path
in Figure 2.8:
CAATCG
C-AT-G
Similar to the optimal global alignment, the space complexity for computing
the optimal local alignment can be reduced from O(mn) to O(n + m) (see
Exercise 12).
To compute the optimal global alignment score under the general gap
penalty, we just ll in the table V row by row. Then, the optimal align-
ment score is stored in V (n, m). The optimal alignment can be recovered by
back-tracing the dynamic programming table V .
Below, we analyze the time and space complexities. We need to ll in nm
entries in the table V (1..n, 1..m). Each entry can be computed in O(n + m)
time according to the recursive equation. The global alignment of two strings
S[1..n] and T [1..m] can be computed in O(nm(n+m)) time and O(nm) space.
Similarly, for computing local or semi-global alignment, we can also modify
the algorithms to handle the general gap penalty.
Note that, when h = 0, the ane gap penalty is reduced to the uniform gap
penalty.
Given two strings S[1..n] and T [1..m], their global alignment under the
ane gap penalty can be computed as ecient as that under the uniform gap
penalty (that is, h = 0). The idea is again to use dynamic programming [120].
Moreover, we require four dynamic programming tables instead of one. The
rst table is table V where V (i, j) is dened as the global alignment score
between S[1..i] and T [1..j]. The other three tables are dened depending on
the last pair of aligned characters.
G(i, j): the global alignment score between S[1...i] and T [1...j] with S[i]
matches T [j]
F (i, j): the global alignment score between S[1...i] and T [1...j] with S[i]
matches a space
E(i, j): the global alignment score between S[1...i] and T [1...j] with T [j]
matches a space
The global alignment score between S[1..n] and T [1..m] is V (n, m). Below,
we devise the recursive formula for the tables V, G, F, and E depending on
whether (1) i = 0 or j = 0 and (2) i
= 0 and j
= 0.
When i = 0 or j = 0, the basis for the recurrence equations are as follows:
V (0, 0) = 0
V (i, 0) = F (i, 0) = g(i) = h is
V (0, j) = E(0, j) = g(j) = h js
E(i, 0) = F (0, j) =
G(i, 0) = G(0, j) =
When i > 0 and j > 0, the recurrence of V (i, j), G(i, j), E(i, j), and F (i, j)
are dened as follows:
V (i, j) = max{G(i, j), F (i, j), E(i, j)}
G(i, j) = V (i 1, j 1) + (S[i], T [j])
F (i, j) = max{F (i 1, j) s, V (i 1, j) h s}
E(i, j) = max{E(i, j 1) s, V (i, j 1) h s}
The recurrences for V and G are straightforward. For F (i, j), it is the score
of the global alignment of S[1..i] and T [1..j] with S[i] matches a space. There
are two cases:
S[i 1] matches with a space.
In this case, we need to add the space penalty, that is, F (i, j) = F (i
1, j) s.
S[i 1] matches with T [j].
In this case, we need to add the space penalty and the gap initiating
penalty, that is, F (i, j) = V (i 1, j) h s.
Sequence Similarity 45
FIGURE 2.10: The global alignment algorithm under the ane gap
penalty.
Then, by taking the maximum value of the two cases, we have F (i, j) =
max{F (i 1, j) s, V (i 1, j) h s}. Similarly, we can derive the recurrence
for E.
To compute the optimal alignment of S[1..n] and T [1..m], we need to ll
in the four tables according to the algorithm in Figure 2.10. The optimal
alignment score is stored in V (n, m). The optimal alignment can be recovered
by back-tracing on the four tables.
Below, we analyze the time complexity and the space complexity. We main-
tain four n m matrices E, F , G, and V . Hence, the space complexity is
O(nm). Since the 4 tables have 4nm entries where each entry can be com-
puted in O(1) time, the time complexity is O(nm).
function. Under the convex gap model, the gap penalty function employed is
any non-negative increasing function g() such that g(q + 1) g(q) g(q)
g(q 1) for any q 1. In other words, the convex gap model required that
the penalty incurred by additional space in a gap decreases as the gap gets
longer. Note that both the ane gap penalty function and the logarithmic
gap penalty function are kind of convex gap function.
The O(mn(n + m))-time dynamic programming algorithm for the general
gap penalty can be readily applied for the convex gap penalty. Moreover,
Miller and Myers [212] and Galil and Giancarlo [113] independently proposed
a practically more ecient method, which runs in O(mn log(mn)) time. This
section will describe the O(mn log(mn))-time algorithm.
First, we restate the O(mn(n + m))-time dynamic programming algorithm.
We introduce two substitution functions A(i, j) and B(i, j) that serve to ease
the discussion of the upcoming proof.
Let V (i, j) be the global alignment score between S[1..i] and T [1..j].
For either i = 0 or j = 0, we have
V (0, 0) = 0, V (0, j) = g(j), V (i, 0) = g(i)
For both i > 0 and j > 0, we have
V (i 1, j 1) + (S[i], T [j]) match/mismatch
V (i, j) = max A(i, j) insert T [k + 1..j]
B(i, j) delete S[k + 1..i]
where
A(i, j) = max {V (i, k) g(j k)}
0kj1
The most time consuming part for lling up the dynamic programming
table for this algorithm is to compute the tables A and B. It takes O(n) time
and O(m) time to compute each A(i, j) and each B(i, j), respectively. Since
there are nm entries in tables A and B, computing A(i, j) and B(i, j) for all
1 i n and 1 j m requires O(nm2 + n2 m) time.
When the gap penalty function is a convex function, we claim that {A(i, 1),
. . . , A(i, m)} can be computed in O(m log m) time for any xed i while {B(1, j),
. . . , B(n, j)} can be computed in O(n log n) time for any xed j. Hence, in
total, A(i, j) and B(i, j) for all 1 i n and 1 j m can be computed in
O(nm log(nm)) time. Then, the table V can be lled in using O(nm) time.
In total, the optimal alignment can be found in O(nm log(nm)) time.
What remains is to prove the claim that, for any xed i, {A(i, 1), . . . , A(i, m)}
can be computed in O(m log m) time. To simplify the discussion, we dene
the following functions.
E(j) = A(i, j)
Ck (j) = V (i, k) g(j k)
Sequence Similarity 47
Ck1 ( j )
Ck 2 ( j )
k2+1 h(k1, k2) m j
LEMMA 2.2
For any k1 < k2 , let h(k1 , k2 ) = arg mink2 <jm {Ck1 (j) Ck2 (j)}. We have
j < h(k1 , k2 ) if and only if Ck1 (j) < Ck2 (j).
PROOF If j < h(k1 , k2 ), by the denition of h(k1 , k2 ), we have Ck1 (j) <
Ck2 (j). On the other hand, if j h(k1 , k2 ), we show that Ck1 (j) Ck2 (j) by
induction. When j = h(k1 , k2 ), by the denition of h(k1 , k2 ), Ck1 (j) Ck2 (j).
Assume Ck1 (j) Ck2 (j) for some j h(k1 , k2 ). Then, we have
LEMMA 2.3
For any k1 < k2 , h(k1 , k2 ) can be computed in O(log m) time.
PROOF By Lemma 2.2, j < h(k1 , k2 ) if and only if Ck1 (j) < Ck2 (j).
Hence, we can perform binary search in the interval k2 + 1..m to identify
h(k1 , k2 ). The running time is O(log m).
Let Env (j) = max0k< Ck (j) for any j . Note that E(j) = Envj (j).
Env () is a curve formed by merging the segments of the curves Ck for
k . For example, Env5 () in Figure 2.12 is formed by three segments
C3 (5..h(2, 3)), C2 (h(2, 3) + 1..h(0, 2)), and C0 (h(0, 2) + 1..m). We represent
Env5 () as ((3, h(2, 3)), (2, h(0, 2)), (0, m)).
Formally, for any , suppose Env () is formed by ts segments Ckt (..zt ),
Ckt1 (zt + 1..zt1 ), . . . , Ck1 (z2 + 1..z1 ) where z1 = m and zi = h(ki1 , ki ) for
i = t, . . . , 2. We represent Env () as ((kt , zt ), . . . , (k1 , z1 )).
LEMMA 2.4
Let ((kt , zt ), (kt1 , zt1 ), . . . , (k1 , z1 )) be the representation of Env (). We
have k1 < . . . < kt < < zt < . . . < z1 = m.
1. Case 1: If C () Ckt (), then the curve C (j) cant cross C(kt , j) and
will always be below C(kt , j) (by Lemma 2.2). Thus, Env+1 is still the
same as Env . Figure 2.13a illustrates this case.
2. Case 2: If C () > Ckt (), then C () > Env (). We need to nd
position h such that C (h ) > Env (h ) and C (h + 1) < Env (h + 1).
We remove all pairs (ki , zi ) such that zi < h ; then, we insert the pair
(, h ). Figure 2.13b describes this pictorially.
FIGURE 2.12: The gure shows 5 curves Ck (j) for 0 k 4. The thick
black curve corresponds to Env4 (j) = max0k4 Ck (j). (See color insert after
page 270.)
C0(j) C0(j)
C2(j) C2(j)
C1(j) C1(j)
C3(j) C3(j)
C4(j) C4(j)
6 m
j j
6 m
(a) (b)
It is easy to see that for every , we push at most one pair onto the stack
S and thus, we push at most m pairs onto the stack S, which in turn limits
the number of pops from stack S to m pops. Since the value h(k, k ) can
be computed in O(log m) time by Lemma 2.3, the total time to ll E(j) is
O(m log m).
50 Algorithms in Bioinformatics A Practical Introduction
Algorithm Filling E
1: Push (0, m) onto stack S
2: E(1) = Ckt (1)
3: for = 2 to m 1 do
4: if C ( + 1) > Ckt ( + 1) then
5: while S
= and C (zt 1) > Ckt (zt 1) do
6: pop S
7: end while
8: if S = then
9: push (, m) onto S
10: else
11: push (, h(kt , ))
12: end if
13: end if
14: report E() = Ckt ()
15: end for
Oa,b
log
Ea,b
where Oa,b and Ea,b are the observed substitution frequency and the expected
substitution frequency, respectively, between amino acid residues a and b.
With the assumption that the aligned residue pairs are statistically indepen-
dent, the alignment score of an aligned sequence equals the sum of individual
log-odds score. Below, we detail both PAM and BLOSUM methods.
LASGCTAFK
LACACTAFK IGCGCTGFK IGCGCTLFK LASGCTAFK LACACTAFK
(a) (b)
FIGURE 2.15: The left gure is an ungapped alignment of seven amino
acid sequences and the right gure is the corresponding phylogenetic tree of
those seven sequences.
BLOSUM 80 PAM 1
2.7 Exercises
1. Calculate the score for the following alignment.
54 Algorithms in Bioinformatics A Practical Introduction
--TCATAC-TCATGAACT
GGTAATCCCTC---AA--
3. Given two sequences S and T (not necessarily the same length), let
G, L, and H be the scores of an optimal global alignment, an optimal
local alignment, and an optimal global alignment without counting the
beginning space of S and end space of T , respectively.
4. Consider two DNA sequences of the same length n and let the scoring
function be dened as follows: 1 for match, 1 for mismatch, 2 for
indel. Let the score of the optimal global alignment be G and that of
the optimal local alignment be L.
5. Under the ane gap penalty model, can you describe an O(nm)-time al-
gorithm to compute the optimal local alignment between two sequences
S[1..n] and T [1..m].
A C - G G T T A T -
- C T G G - - A T C
Sequence Similarity 55
A C G T
A 1
C -1 2
G -1 -2 1
T -2 -1 -2 1
10. Consider two sequences S[1..n] and T [1..m]. Assume match, mismatch,
and indel scores 1, 1, and 2, respectively. Give an algorithm which
computes the maximum score of the best alignment (S , T ) of S and T ,
forgiving the space at the beginning of S and the space at the end of
T .
12. Given two sequences S[1..n] and T [1..m], can you design an algorithm
which computes the optimal local alignment between S and T using
O(nm) time and O(n + m) space?
13. Given two strings S1 [1..n] and S2 [1..m], we would like to nd two non-
overlapping alignments (S1 [i1 ..i2 ], S2 [j1 ..j2 ]) and (S1 [i3 ..i4 ], S2 [j3 ..j4 ])
such that i2 < i3 and j2 < j3 and the total alignment score is maxi-
mized. Give an ecient algorithm to compute the total alignment score.
What is the running time of your algorithm? (We assume the match
score is 2 and the mismatch/indel score is 1.)
Chapter 3
Sux Tree
3.1 Introduction
The sux tree of a string is a fundamental data structure for pattern match-
ing [305]. It has many biological applications. The rest of this book will
discuss some of its applications, including
Biological database searching (Chapter 5)
Whole genome alignment (Chapter 4)
Motif nding (Chapter 10)
In this chapter, we dene a sux tree and present simple applications of
a sux tree. Then, we discuss a linear sux tree construction algorithm
proposed by Farach. Finally, we discuss the variants of a sux tree like sux
array and FM-index. We also study the application of sux tree related data
structures on approximate matching problems.
57
58 Algorithms in Bioinformatics A Practical Introduction
Suffix g
$ a c $ $ a c g $
1 acacag$ a
7 6 7 u 6
c g a
2 cacag$ c g
a g
a $
3 acag$ $ c c
c g 5 v a g
4 cag$ $ 5 g
a a $
5 ag$ $ 4 ac g $
g g g $
$ 2 4
6 g$ 3
$ $ 1 3
7 $ 1 2
FIGURE 3.1: For S = acacag$, (a) shows all suxes of S, (b) shows the
sux trie of S, and (c) shows the sux tree of S.
edges of the sux trie which are merged. The path label of a node is dened
as the concatenation of the edge labels from the root to the node. We dene
the string depth of a node to be the length of the path label of the node. For
example, in Figure 3.1(c), the edge label of the edge (u, v) is ca, the path label
of the node v is aca, and the string depth of the node v is 3.
In general, we can store two or more strings using a generalized sux tree.
For example, the generalized sux tree of S1 = acgat# and S2 = cgt$ is
shown in Figure 3.2. Note that dierent terminating symbols are used to
represent the ends of dierent strings.
Sux Tree 59
r
a c g t
# $ g
w x y z
6 4 c t
g a a
a # t t$ t
t
$ # $
t # #
#
1 4 2 1 3 2 5 3
occurs in S. The positions of occurrences are 1 and 3, which are the leaves of
the corresponding subtree.
Consider the case when Q = acc. We can nd a path with label ac when
we traverse down the sux tree. However, from this point, we cannot extend
the path for the character c; thus we report that the pattern acc does not
exist in S.
Next, we give the time analysis. Consider the sux tree T for S. For any
query Q of length m, we can identify if there exists a path label in T matches
Q in O(m) time. Then, traversing the subtree to report all occurrences takes
O(occ) time where occ is the number of occurrences of Q in S. In total, all
occurrences of Q in S can be found in O(m + occ) time.
1: Build a generalized sux tree for P1 and P2 . This takes O(n) time.
2: Mark each internal node with leaves representing suxes of P1 and P2 .
This takes O(n) time. This will ensure that the path labels of the marked
internal nodes are common substrings of P1 and P2 .
3: Report the deepest marked node. This step can be done in O(n) time.
For example, consider P1 = acgat and P2 = cgt, the longest common substring
between P1 and P2 is cg. See Figure 3.3.
Note that this solution can be generalized to nd the longest common sub-
string for more than 2 sequences (see Exercise 13). By the way, the longest
common substring is not the same as the longest common subsequence. The
longest common subsequence is a sequence of characters that are not necessary
contiguous, whereas the longest common substring is a contiguous substring!
Besides, the longest common substring problem can be solved in O(n) time
using a sux tree, whereas the longest common subsequence takes O(n2 ) time
for a general alphabet (see Section 2.2.4).
a c g t
# $ g
6 4 c t
a a a
g # t t$ t
t
$ # $
t # #
#
1 4 2 1 3 2 5 3
FIGURE 3.3: This is the generalized sux tree for P1 = acgat# and
P2 = cgt$. All square nodes are leaves representing suxes. For suxes
of P2 , the corresponding integers are underlined. The gray colored internal
nodes are nodes whose subtrees contain suxes of both P1 and P2 . The path
label of the deepest gray colored node is of depth 2, whose path label is cg,
which is the longest common substring of P1 and P2 .
create a data-structure such that, for any i, j, LCP (i, j) can be reported in
O(1) time.
Let T be the sux tree for S. The key observation is that LCP (i, j)
equals the length of the path label of the lowest common ancestor of the two
leaves representing suxes i and j (this lowest common ancestor is denoted
as LCA(i, j)).
The problem of nding the lowest common ancestor (LCA) of two nodes in
a tree is well studied. Harel and Tarjan [137] showed that for a tree of size n,
after an O(n)-time preprocessing, the LCA for any two nodes in the tree can
be computed in O(1) time. The solution was then simplied by Schieber and
Vishkin [259] and Bender and Farach-Colton [21]. Based on the O(n)-time
preprocessing for the lowest common ancestor, the longest common prex of
any two suxes can be computed in O(1) time.
The LCP data-structure nds many applications. Section 3.3.5 demon-
strates one such application.
r r r r r r
# # # a #
a # a a c # a c
c c
6 o 6 g o 6
w w g 6 w g g 6 w g g
c t o 6 c a o c a a o c a a
a g g t g t t g t
a # a t a # t a # t t t
t t t # # t # t #
# # # #
# # # #
1 1 4 1 4 2 1 4 2 3 1 4 2 3 5
FIGURE 3.4: Constructing the embedded sux tree of S1 from the gen-
eralized sux tree in Figure 3.2 for S1 = acgat# and S2 = cgt$.
time. Hence, the overall time complexity of the above algorithm is O(Kn).
Can we further speed up the algorithm? Below, we give a denite answer
by showing a way to reduce the running time of Step 3 to O(n). Thus, we
can compute (k) for k = 2, . . . , K using O(n) time.
Prior to describe a faster solution for Step 3, we need some denitions. For
every internal node v in T , let N (v) be the number of leaves in the subtree of
v. Let nk (v) be the number of leaves in the subtree of v representing suxes
of Sk . Intuitively, nk (v) 1
is the number of duplicated suxes of Sk in the
subtree of v. Hence U (v) = k:nk (v)>0 (nk (v) 1) is the number of duplicate
suxes in the subtree of T rooted at v. Therefore, C(v) = N (v) U (v).
The diculty is in computing U (v) eciently for all internal nodes v of
T . Let degk (v) be the degree of v in Tk where Tk is the embedded sux
tree of Sk in T . We observe that, for every internal node v in T , nk (v) 1
equals {degk (u) 1 | u is a descendant of v in T and u is in Tk }. Based
on this observation, we dene h(u) to be k=1..K,uTk (degk (u) 1). Then
U (v) = k:nk (v)>0 (nk (v) 1) = h(v) + {U (u) | u is a child of v}.
Note that, for any node v in T , N (v) = {N (u) | u is a child of v}.
Therefore, C(v) for all v T can be computed as follows using O(n) time.
c a c
a a ca
$
$ $ $ $ $ $ a $ c
$ a ca a c
$ $ $ ca $ a$
$
5 5 4 5 4 3 5 4 3 2 5 4 1 3 2
I5 I4 I3 I2 I1
FIGURE 3.5: Constructing the sux tree for S = acca$.
a c a c a c
$ c c #$ c c #$ c c
c a
$ a $ a $ ca $a a $ ca $a a #
$ $ $ $ $ $
5 4 1 3 2 2 5 4 1 3 2 2 5 4 1 3 2 1
I1 J2 J1
FIGURE 3.6: Constructing the generalized sux tree for S = acca$ and
S = c#.
Many works tried to address this problem and we can now construct a sux
tree using O(n) time. As early as 1973, Weiner [305] introduced the sux
tree data structure and he gave the rst linear time sux tree construction
algorithm when the alphabet size is constant. Weiners algorithm, however,
requires a lot of memory. McGreight [211] improved the space complexity
to O(n2 ) in 1976. Later, in 1995, Ukkonen [295] presented a simplied on-
line variant of the algorithm. In 1997, Farach [100] showed that, even for a
general alphabet of unbounded size, a sux tree can be constructed in linear
time. The rest of this section will discuss the Farach sux tree construction
algorithm.
Before presenting Farachs algorithm, we rst introduce the concept of sux
link. Let T be the sux tree of S. For any internal node u in T whose path
label is ap where a is a character and p is a string, a sux link is a pointer
from u to another node whose path label is p. Based on Lemma 3.1, every
internal node has a sux link. Figure 3.7 shows the sux links for all internal
nodes of the sux tree of the string acacag$.
Sux Tree 67
LEMMA 3.1
Let T be a sux tree. If the path label of an internal node v in T is ap, then
there must be another internal node w in T whose path label is p. [305]
PROOF Since the path label of v is ap, there exist two suxes Si and Sj
such that the longest common prex between them is ap. Then, the longest
common prex between Si+1 and Sj+1 is p. Hence, there exists a node w in
T whose path label is p.
$ a c g $
a
7 6
c g
a $
c
a g
5 g $
c $
ga g
$ $ 2 4
1 3
FIGURE 3.7: The arrows indicate the sux links of the sux tree for
S = acacag$.
$ 4233$ bba bb $ b
1 $ aba$ a babba
ba$
a
ba
7 2 2 3 3 13
a a
13 a b a 5
4 b
a b 5 a b
b
b
2 3 2 b b
b
b
3 3 a b b b
b
a b
3 4 $ $
a b
$ a
3 $ b a b a b b a
$ 2 a
b b a
b
$
a
b a b $
$ 3 6 5 b
a
b
$ b
a $ b
a 11 9 a
a
b
11 9
1 4 3 $ b
$
a
$ 7 a 7 $
1 $ 1
2 3 3
For example, for the string S = aaabbbabbaba$, its P S is (aa, ab, bb, ab, ba, ba).
By bucket sort, these character pairs could be sorted to aa < ab < ba < bb
and the rank of each pair is {Rank(aa) = 1, Rank(ab) = 2, Rank(ba) =
3, Rank(bb) = 4}. Now we can form a new string S = 124233$ and get the
sux tree of S as shown in Figure 3.8(a) by recursion.
The last job of Step 1 is to rene T into the odd sux tree To . To do this,
the characters si on every edge of T should be replaced by the corresponding
character pairs and the leaf labels j in T should be replaced by the leaf labels
2j 1. For example, after replacement, the sux tree of S in Figure 3.8(a)
becomes a tree in Figure 3.8(b). However, the tree after replacement may not
be a sux tree. For example, in Figure 3.8(b), the root node has two edges
whose labels are aaabbbabbaba$ and ab and both labels start with a. There
are two other faults in the same tree. To correct the tree into a sux tree,
for each internal node u, if some of its child edges whose labels start with
the same character, say x, a new node v is introduced between u and these
Sux Tree 69
child edges and the edge (u, v) is labeled by x. Because the edges coming
from any node are lexicographically sorted, we can identify and correct all
those faults by checking the rst characters on the adjacent edges. Hence,
the correction takes linear time. Figure 3.8(c) shows the odd sux tree of
S = aaabbbabbaba$ generated by Step 1.
For time analysis, the bucket sorting and the renement of T take O(n)
time in Step 1. Suppose T ime(n) is the time to build the sux tree for a
string of length n, then Step 1 takes T ime(n/2) + O(n) time in total.
a b a b
a a a
b
a a b
b
a $ a $ a b $ a b b $ a b b a
$ a b
a
b a
b
$ b a b a b b a b b b a b b
b
12 b
b
12 b $ 12 b $ a 12 b $ a a 12 b $ a a
a
b b b b $ b b
a b b
$
12 b
a
b 10
a
b 10
a
$
a
b 10 a
8
a
b 10 a b
a
b b b b
$
b
$ 8 b
a a
b
a
b
a
b
6 a
b
6 a
b $
a a a a a 6
$ $ $ $ $ 4
2 2 2 2 2
LCP (2, 10) = 1, LCP (10, 6) = 0, LCP (6, 8) = 1, LCP (8, 4) = 2}.
For (iii), given the order of the leaves and the LCP information, we can
construct Te incrementally from left to right in linear time using an approach
similar to Section 3.3.6. Figure 3.9 shows the process of constructing the even
sux tree for S. In summary, Step 2 takes O(n) time to construct the even
tree Te for S.
3.4.3 Step 3: Merge the Odd and the Even Sux Trees
b,1
$,1 a,1
b,1
13 b,2 a,1
$,1
12 a,11
$,1
a,4
$,1 b,3
10 b,8
8
a,4 11 9 b,3
2 b,9
7 b,3 4
$,1 5
1 6
3
FIGURE 3.10: The over-merged tree of the odd and even sux trees of
S = aaabbbabbaba$. Every edge is labeled by the rst character of the edge
and the length of the edge. All the thick edges are formed by merging between
the odd and even suxes.
After the rst two steps, we get the odd sux tree To and the even sux
tree Te of S. In the nal step, To and Te will be merged to generate the sux
tree T of S.
Consider the uncompressed version of both To and Te so that every edge
is labeled by one character (that is, they are treated as sux tries). We can
merge To and Te using depth rst search (DFS). Precisely, we start by the
two roots of both trees. Then, we simultaneously take the edges in both trees
whose labels are the same and recursively merge the two subtrees. If only
one tree has an edge labeled a, then we do nothing since there is nothing to
merge. Merging trees in this way may take O(n2 ) time since there may be
O(n2 ) characters in the sux tree.
Merging the uncompacted version of To and Te is time consuming. Farach
introduced a method which merges the original To and Te directly in O(n)
time. The method is also based on DFS. Moreover, two edges are merged as
long as they start with the same character. The merge is ended when the label
of one edge is longer than that of the other. Figure 3.10 shows an example
of an over-merged tree M , which merges our example odd and even sux
Sux Tree 71
trees To and Te of S = aaabbbabbaba$. The thick edges in Figure 3.10 are the
merged edges and they may be over-merged. What remains is to unmerge
these incorrectly merged parts of the tree. Before explaining the unmerging
process, lets rst introduce two denitions d and L.
For any node v created by merging, its incoming edge may be over-merged.
We let L(v) be the correct depth of v.
Since v is a node created by merging, there must exist one even sux S2i
and one odd sux S2j1 such that v = LCA(2i, 2j 1) in M . The sux link
d(v) is the node LCA(2i + 1, 2j) if v is not a root; otherwise d(v) is undened.
The dotted edges in Figure 3.11 show the d relationship of the vertices in M .
Since every vertex has at most one out-going dotted edge, the dotted edges
form a tree, which is denoted as d tree. By construction, L(v) = 1 + L(d(v))
if v is not the root; otherwise L(v) = 0. Hence, L(v) equals the depth of v in
the d tree.
u
$,1 a,1 b,1
w
v
13 b,1 L(2)=2
b,2 a,1 z L(8)=4
$,1
x y L(9)=3
12 a,11
$,1
a,4 L(v)=1
$,1 b,3 L(w)=1
10 b,8 L(x)=2
8 L(y)=2
a,4 11 9 L(z)=2
b,3
2 b,9
7 b,3 4
$,1 5
1 6
3
FIGURE 3.11: The dotted edges form the d tree for the over-merged tree
M in Figure 3.10. We also show the L values for the nodes on the d tree,
which are the depths of the nodes with respect to the d tree.
The depth of every node in the d tree can be determined in linear time by
DFS. Then, we identify all the real over-merged nodes. In Figure 3.11, the
real over-merged nodes are 2, 8, 9, and x, whose L values are smaller than
the depth in M . For any over-merged node v, we adjust its depth to L(v).
Then, all the children of v are appended under v in the lexicographical order.
The nal tree computed is just the sux tree T for S. Figure 3.12 shows the
sux tree for S = aaabbbabbaba$.
When these three steps are completed, we get the sux tree T for S.
Finally, we analyze the time complexity of Farachs algorithm. Let T ime(n)
be the time required to construct a sux tree for a sequence of length n. Then,
Step 1 takes T ime(n/2) + O(n) time. Steps 2 and 3 take O(n) time. In total,
72 Algorithms in Bioinformatics A Practical Introduction
13 b,1
b,1 a,1
$,1
a,1 a,2
12 a,2 b,1 b,1
$,1 a,2
10 b,8
a,11 a,2 8
11 9 b,5
1 b,10
a,4 b,9 b,5
4
5
2 7 3 6
FIGURE 3.12: The sux tree for S = aaabbbabbaba$.
SA binary search(Q)
1: Let L = 1 and R = n;
2: while L R do
3: Let M = (L + R)/2.
4: Find the length m of the longest common prex of Q and sux SA[M ];
5: if m = |Q| then
6: Report suxes SA[M ] contain the occurrence of Q;
7: else if sux SA[M ] > Q then
8: set R = M ;
9: else
10: set L = M ;
11: end if
12: end while
13: if L > R then
14: Report Q does not exist in S;
15: end if
3.6 FM-Index
Although the space requirement of a sux array is less than that of a sux
tree, it is still unacceptable in many real life situations. For example, to store
the human genome, with its 3 billion base pairs, it takes up to 40 gigabytes
using a sux tree and 13 gigabytes using a sux array. This is clearly beyond
the capacity of a normal personal computer. A more space-ecient solution is
required for practical solutions. Two such alternatives were proposed. They
are the compressed sux array by Grossi and Vitter [123] and the FM-index
by Ferragine and Manzini [106]. Both data structures require only O(n) bits
where n is the length of the string. For instance, we can store the FM-index
of the whole human genome using less than 1.5 gigabytes. We will introduce
the FM-index data structure below.
Sux Tree 77
3.6.1 Denition
The FM-index is a combination of the Burrows-Wheeler (BW) text [45]
and an auxiliary data structure. Let S[1..n] be a string of length n, and
SA[1..n] be its sux array. The FM-index for S stores the following three
data structures:
We will now analyze the space complexity of the FM-index. In the case
of the DNA sequence, structure one can be stored in 2n bits because we are
storing n characters, each character having four possible choices (log 4 = 2).
Structure 2 can be stored in O(log n) bits and structure 3 can be stored in
O( n log log n
log n ) bits. Therefore, in total the size of the FM-index is O(n) bits.
1 2 3 4 n/log2 n
BW
log2 n log n
1 2 3 log n
00x0xxx0x0
FIGURE 3.18: The data structure for answering the occ(x, i) query.
Algorithm BW search(Q[1..m])
1: x = Q[m]; st = C[x] + 1; ed = C[x + 1];
2: i = m 1;
3: while st ed and i 1 do
4: x = Q[i];
5: st = C[x] + occ(x, st 1) + 1;
6: ed = C[x] + occ(x, ed);
7: i = i 1;
8: end while
9: if st > ed, then pattern not found else report [st..ed].
LEMMA 3.2
The number of suxes which are lexicographically smaller than or equal to
xT [SA[i]..n] equals C[x] + occ(x, i), where x A.
PROOF A sux S[j..n] which is smaller than xS[SA[i]..n] has two types:
(1) S[j] < x and (2) S[j] = x and S[j + 1..n] < S[SA[i]..n]. The number
of suxes of type 1 equals C[x]. The number of suxes of type 2 equals
occ(x, i). The lemma follows.
LEMMA 3.3
Consider a string S[1..n] and a query Q. Suppose range(S, Q) is [st..ed].
Then, we have range(S, xQ) = [p..q] where p = C[x] + occ(x, st 1) + 1 and
q = C[x] + occ(x, ed).
FIGURE 3.21: The sux array and inverse sux array of S = acacag$.
LEMMA 3.4
Suppose [st1 ..ed1 ] = range(S, P1 ) and [st2 ..ed2 ] = range(S, P2 ) then we can
compute [st..ed] = range(S, P1 P2 ) in O(log n) time.
the smallest st such that st2 < SA1 [SA[st] + k] < ed2 and
the largest ed such that st2 < SA1 [SA[ed] + k] < ed2
3.8 Exercises
1. Given three DNA sequences S1 , S2 , and S3 of total length n.
Sux Tree 83
8. For the sux tree for a DNA sequence S and a query Q of length m,
describe an algorithm to determine whether there exists a substring x
of S such that the hamming distance between Q and x is smaller than
or equal to 1. What is the time complexity?
Sux Tree 85
9. For the sux tree for S, describe a linear time algorithm for searching
maximal complementary palindromes.
10. Consider a set Z of n pairs {(ai , bi ) | i = 1, 2, . . . , n}, where each symbol
ai or bi can be represented as a positive integer smaller than or equal
to n. Can you describe an O(n)-time algorithm to sort the pairs into a
sequence (a(1) , b(1) ), . . . , (a(n) , b(n) )?
11. Given only the FM-index without the text, can you recover the text
from the FM-index? If yes, can you describe the detail of the algorithm?
What is the time complexity?
12. Given the FM-index, can you generate the sux array in O(n) time
using O(n) bits working space? (For counting the working space, we
do not include the space for outputting the sux array. Also, we are
allowed to write the output once. Based on this model, the output
can be written directly to the secondary storage, without occupying the
main memory.)
13. Given a set of k strings of total length n, give an O(n)-time algorithm
which computes the longest common substring of all k sequences.
14. Given a set of k strings, we would like to compute the longest common
substring of each of the k2 pairs of strings.
(a) Assume each string is of length n. Show how to nd all the longest
common substrings in O(k 2 n) time.
(b) Assume the string lengths are dierent but sum to m. Show how
to nd all the longest common substrings in O(km) time.
15. Given a text of length n with constant alphabet, propose an O(n log n)-
bit space index and a query algorithm such that, for any pattern P of
length m, the 2-mismatch query can be answered in O(m2 log n + occ)
time.
16. Let T be a DNA sequence of length n. Suppose we preprocess T and
get its sux array SA, its inverse sux array SA1 , and its FM-index.
Consider a pattern P of length m whose alphabet is {a, c, g, t, }, where
is a wild card (which represents any DNA base). Assuming P contains
x wild cards, can you propose an O(m + 4x log n + occ)-time algorithm
to nd all the occurrences of P ? (occ is the number of occurrences of P
in T .)
17. Consider two DNA sequences S and T of total length n. Describe an
O(n) time algorithm which detects whether there exists a substring T
of T such that the score of the global alignment between S and T is
bigger than or equal to 1. (Suppose the score for a match is 0 and the
score for insert, delete, or mismatch is 1.)
86 Algorithms in Bioinformatics A Practical Introduction
4.1 Introduction
Due to the advance in sequencing technologies, complete genomes for many
organisms are available. Biologists start to ask if we can compare two or more
related organisms to extract their similarities and dierences. Such a question
can be answered by solving the whole genome alignment problem, which tries
to align the two closely related genomes.
In the literature, a lot of methods are available to align two DNA sequences,
including the Smith-Waterman algorithm, the Needleman-Wunsch algorithm,
etc. (See Chapter 2 for details.) Those methods are eective when we compare
two genes or two proteins which are short. When we compare two genomes,
those methods become ineective due to the high time and space complexity,
which is O(nm) where n and m are the lengths of the two genomes.
Hence, special tools for comparing large scale genomes were developed,
including: MUMmer [76], Mutation Sensitive Alignment [56], SSAHA [220],
AVID [34], MGA [149], BLASTZ [261], and LAGAN [39].
In general, all genome alignment methods assume the two genomes should
share some conserved regions. Then, they align the conserved regions rst;
afterward, the alignment is extended to cover the non-conserved regions. More
precisely, genome alignment methods often run in three phases.
Phase 3 closes the gaps between the anchors to obtain the nal align-
ment.
87
88 Algorithms in Bioinformatics A Practical Introduction
S = acga ctc a gctac t ggtcagctatt acttaccgc #
T = actt ctc t gctac ggtcagctatt c acttaccgc $
To illustrate the idea of the whole genome alignment, this chapter discusses
two methods, MUMmer and Mutation Sensitive Method. The organization
of this chapter is as follows. We rst study the concept Maximal Unique
Match (MUM), which is a type of anchor. Then, we will detail the algorithms
of MUMmer (Versions 1 to 3) and Mutation Sensitive Alignment algorithm.
Last, we discuss dot plot, a way to visualize the alignment of two genomes.
Algorithm Brute-force-MUM
Require: Two genome sequences S[1..m1 ] and T [1..m2 ], a threshold d
Ensure: The set of MUMs of S and T
1: for every position i in S do
2: for every position j in T do
3: Find the longest common prex P of S[i..m1 ] and T [j..m2 ]
4: Check whether |P | d and whether P is unique in both genomes.
If yes, report it as a MUM.
5: end for
6: end for
FIGURE 4.3: Algorithm for computing the MUMs of two genomes S and
T using the brute-force method.
Algorithm Sux-tree-MUM
Require: Two genome sequences S[1..m1 ] and T [1..m2 ], a threshold d
Ensure: The set of MUMs of S and T
1: Build a generalized sux tree for S and T .
2: Mark all the internal nodes that have exactly two leaf children, which
represent both suxes of S and T .
3: For each marked node of depth at least d, suppose it represents the i-th
sux Si of S and the j-th sux Tj of T . We check whether S[i 1] =
T [j 1]. If not, the path label of this marked node is a MUM.
FIGURE 4.4: A sux tree-based algorithm for computing the MUMs of
two genomes S and T .
sux tree for S and T is constructed. Step 2 marks internal nodes with path
labels cg, g, and t since they have exactly two leaf children, which represent
both suxes of S and T . In Step 3, for the node with the path label g, it
represents the third sux gat# of S and the second sux gta$ of T . Since
both S[3 1] and T [2 1] equal c, the path label g of this marked node is not
a MUM. So the set of MUMs is {cg, t}.
# a c g t
$ g
6 5
gc t a t
t a
a t a
$ a # t a # $
Output: t # $ # $
#
cg and t
4 1 4 2 1 3 2 5 3
FIGURE 4.5: Consider two genomes S = acgat# and T = cgta$. Step 1
constructs the generalized sux tree for genomes S and T . Step 2 identies
internal nodes with exactly one descendant leaf representing S and exactly
one descendant leaf representing T . Those nodes are lled with solid color.
Step 3 identies MUMs, which correspond to those highlighted paths.
FIGURE 4.6: Mice and humans share a lot of gene pairs. The set of known
conserved genes was obtained from GenBank [217]. The number of MUMs
was computed using the method in Section 4.2.1.
92 Algorithms in Bioinformatics A Practical Introduction
Mouse Chromosome 16
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 30 31 29
Human Chromosome 16
FIGURE 4.7: There are 31 conserved gene pairs found between mouse
chromosome 16 and human chromosome 16. The genes are labeled according
to their positions in the chromosomes. The gure shows that the ordering of
30 conserved gene pairs (out of 31 gene pairs) is preserved. (See color insert
after page 270.)
Based on this observation, Delcher et al. [76] suggested that MUMs which
preserve order in both S and T are likely to cover the conserved regions of S
and T . They proposed MUMmer1 to identify those order preserving MUMs.
Consider two closely related genomes S and T . Suppose S and T contain
n MUMs. Let A = (a1 , a2 , , an ) and B = (b1 , b2 , , bn ) be the ordering
of the n MUMs in S and T , respectively. A sequence C = (c1 , c2 , , cm ) is
a subsequence of A (or B) if C can be formed by removing n m elements
from A (or B).
The aim of MUMmer1 is to compute the longest common subsequence
(LCS) of A and B, that is, the longest possible common subsequence of both
A and B. For example, for the set of MUMs of two genomes S and T in
Figure 4.8, (2, 4, 5, 6, 7) is a longest common subsequence.
The nave way to solve the longest common subsequence problem is to use
dynamic programming. Suppose there are n MUMs. Section 4.3.1 shows a
dynamic programming algorithm which solves the LCS problem using O(n2 )
time and space. This approach quickly becomes infeasible as the number of
MUMs increases.
Moreover, since all MUMs are unique (by denition), we can represent each
Genome Alignment 93
3 6 9
1 2 4 5 7 8
Genome S 123456789
Genome T 5 6 7 245831697
2 4 8 3 1 9
6
2 4 5 7
Genome S 123456789
Genome T 5 6 7 245831697
2 4
MUM by a dierent character. For this special case, we can solve the LCS
problem in O(n log n) time. Below, we rst briey describe the O(n2 )-time
algorithm; then, we detail the O(n log n)-time algorithms.
V 0 1 2 3 4 5 6 7 8 9
0 0 0 0 0 0 0 0 0 0 0
1 0 0 0 0 0 0 1 1 1 1
2 0 1 1 1 1 1 1 1 1 1
3 0 1 1 1 1 2 2 2 2 2
4 0 1 2 2 2 2 2 2 2 2
5 0 1 2 3 3 3 3 3 3 3
6 0 1 2 3 3 3 3 4 4 4
7 0 1 2 3 3 3 3 4 4 5
8 0 1 2 3 4 4 4 4 4 5
9 0 1 2 3 4 4 4 4 5 5
FIGURE 4.9: The dynamic programming table V when A[1..9] =
123456789 and B[1..9] = 245831697.
Instead of storing Vi [0..n] explicitly, we can store only the boundaries at which
the values change. We will store (j, Vi [j]) for all j such that Vi [j] > Vi [j
1]. For example, consider the row 7 of the table V in Figure 4.9, which is
V7 [0..9] = 0123333445. We can represent the row using a list of ve tuples
(1, 1),(2, 2),(3, 3),(7, 4), and (9, 5).
Given the row Vi1 , the lemma below states how to compute the row Vi .
LEMMA 4.1
Let j be the smallest integer greater than (i) such that Vi1 [(i) 1] + 1 <
Vi1 [j ]. We have, for j = 1, 2, . . . , n,
Vi1 [(i) 1] + 1 if (i) j j 1
Vi [j] =
Vi1 [j] otherwise
Algorithm Sux-tree-MUM
Require: A[1..n] and B[1..n]
Ensure: The LCS between A and B
1: Construct a binary search tree T1 which contains one tuple ((1), 1).
2: for i = 2 to n do
3: Ti = Ti1
4: Delete all tuples (j, Vi1 [j]) from Ti where j (i) and Vi1 [j]
Vi1 [(i) 1] + 1;
5: Insert ((i), Vi [(i)]) into Ti .
6: end for
FIGURE 4.10: An O(n log n)-time algorithm for computing the length of
the longest common subsequence (LCS) between A and B.
By the above lemma, we can construct the row Vi from the row Vi1 as
follows.
1. We delete all tuples (j, Vi1 [j]) in Vi1 where j (i) and Vi1 [j]
Vi1 [(i) 1] + 1.
Mouse Chromosome 16
1 28 29 30 31 37 38 39 75
75 39 1 28 37 31 29 30 38
Human Chromosome 3
FIGURE 4.11: There are 31 conserved gene pairs found in mouse chromo-
some 16 and human chromosome 3. Note that the relative ordering of genes
31 to 37 in the human chromosome is exactly the reverse of that in the mouse
chromosome. The same occurs in genes 39 to 75. (See color insert after page
270.)
bigger genomes. The last two improvements help to improve the coverage of
the alignment.
same time, this sequence of MUMs generally has a sucient length. The set
of such MUMs is called a cluster.
For example, as shown in Figure 4.12, for the given two sequences, there
are two clusters: 123 and 567.
1 2 3 4 5 6 7
7 5 6 4 1 2 3
FIGURE 4.12: Clusters of MUMs.
MUMmer1 presumed that the two input genomes have no major rearrange-
ment between them. Hence, it computed a single longest alignment between
the sequences. In order to facilitate comparisons involving unnished assem-
blies and genomes with signicant rearrangements, a module has been added
in MUMmer2. This module rst groups all the close consecutive MUMs into
clusters and then nds consistent paths within each cluster. The clustering is
performed by nding pairs of matches that are suciently close and on su-
ciently similar diagonals in an alignment matrix (using thresholds set by the
user), and then computing the connected components for those pairs. Within
each component, a longest common subsequence is computed to yield the most
consistent sequence of matches in the cluster.
As the result of the additional module, the system outputs a series of sep-
arate, independent alignment regions. This improvement enables MUMmer2
to achieve better coverage.
1 MWCS is a generalization of LCS (see Section 4.3.2). If the weight of every MWM is 1,
In total, the running time is O(n3 log n). Below, we show a better algorithm
which takes O(n2 log n) time. The basic observation is that after computing
the MWCS for A[1..n] and B[1..n] using the O(n log n)-time algorithm, we
obtain a set of binary search trees T1 , . . . , Tn . Then, the MWCS for A[1..i]
and B[1..j] can be retrieved from the binary search tree Ti in O(log n) time.
Hence, we have the following O(n2 log n)-time algorithm.
1: for i = 1 to n do
2: Find the MWCS for A[i..n] and B[(i)..n] in O(n log n) time.
3: Find the MWCS for A[i..n] and reverse of B[1..(i)] in O(n log n) time.
4: Retrieve MWCS(A[i..j], B[(i)..(j)]) in O(log n) time for every j i
5: end for
The third step of the heuristic algorithm nds k intervals i1 ..j1 , i2 ..j2 , . . . ,
and ik ..jk among all intervals such that they are mutually disjoint and max-
imize the sum of their scores. This step can be solved by dynamic program-
ming. For 0 c k and j n, we dene Opt(c, j) to be the maximum sum
of the scores of c intervals in A[1..j].
Opt(c, j 1)
Opt(c, j) = max
max1ij [Opt(c 1, i 1) + Score(i, j)]
Based on the recursive formula, we have the algorithm in Figure 4.14. For
time complexity, since the table Opt has kn entries and each entry can be
computed in O(n) time, we can compute Opt(k, n) in O(kn2 ) time.
The last step of the heuristic algorithm is to rene the k intervals i..j so that
B[(i)..(j)] are disjoint. While there exist (i)..(j) and (i )..(j ) that are
overlapping, we examine all possible ways to shrink the intervals i..j and i ..j
so that the score is maximized and (i)..(j) and (i )..(j ) do not overlap.
This step can be done in O(k 2 ) time. Hence, the heuristic algorithm takes
O(n2 (log n + k)) time.
In summary, given two genomes S[1..m1 ] and T [1..m2 ] and a non-negative
parameter k as its input, the MSA algorithm computes the maximum weight
k-similar subsequence as output. The MSA algorithm consists of 2 steps as
follows:
1. Find all MUMs of S and T (as shown in Section 3.2.2, it can be done
in linear time) and let A and B be the ordering of those MUMs on the
two genomes.
The total running time of the algorithm is O(m1 + m2 + n2 (log n + k)) where
n is the total number of MUMs.
102 Algorithms in Bioinformatics A Practical Introduction
Algorithm Compute-Opt
Require: A set of n MUMs, a parameter k, and a score function Score()
Ensure: A set of at most k disjoint intervals {(i1 , j1 ), . . . , (ik , jk )} which
k
maximizes =1 Score(i , j )
1: Set Opt(c, 0) = 0 for all c = 0 to k
2: Set Opt(0, j) = 0 for all j = 0 to n
3: for c = 1 to k do
4: for j = 1 to n do
5: Set Opt(c, j) = Opt(c, j 1)
6: for i = 1 to j do
7: Set Opt(c, j) = max{Opt(c, j), Opt(c 1, i 1) + Score(i, j)}
8: end for
9: end for
10: end for
11: Report Opt(k, n)
Coverage Preciseness
Exp. No. MUMmer MSA MUMmer MSA
1 76.50% 92.20% 21.70% 22.70%
2 71.40% 91.70% 21.30% 25.10%
3 87.00% 100.00% 24.80% 25.50%
4 76.30% 94.70% 27.40% 26.70%
5 92.50% 96.30% 32.50% 32.00%
6 72.20% 95.80% 31.20% 32.90%
7 67.70% 87.10% 13.50% 17.80%
8 78.10% 90.60% 37.20% 36.70%
9 80.00% 86.70% 40.70% 49.70%
10 82.00% 92.00% 30.90% 32.10%
11 65.20% 89.10% 30.50% 36.00%
12 60.00% 80.00% 27.50% 41.90%
13 89.10% 95.30% 18.20% 18.40%
14 72.70% 86.40% 10.40% 12.60%
15 78.50% 91.40% 30.00% 29.70%
average 76.60% 91.30% 26.50% 29.30%
Coverage Preciseness
Exp. No. MUMmer MSA MUMmer MSA
1 100% 100% 44% 91%
2 58% 80% 80% 85%
3 58% 69% 64% 80%
4 83% 95% 91% 94%
5 61% 68% 70% 85%
6 59% 73% 78% 87%
7 58% 69% 47% 79%
8 83% 94% 86% 94%
9 63% 69% 65% 86%
10 75% 85% 75% 85%
11 53% 68% 77% 83%
12 75% 87% 71% 93%
13 60% 67% 52% 89%
14 74% 75% 65% 90%
15 52% 63% 66% 82%
16 61% 85% 83% 89%
17 58% 74% 83% 84%
18 61% 76% 76% 86%
average 66% 78% 71% 87%
For any base x, y, let (x, y) be the similarity score. Given two sequences
A[1..n] and B[1..m], a dot plot is a two-dimensional matrix M of size n m.
There are two parameters for generating the dot plot, which are the window
size w and the similarity limit
w1 d. For any 1 i n w + 1 and 1 j
m w + 1, M [i, j] = 1 if p=0 (A[i + p], B[j + p]) d; and 0 otherwise.
Figure 4.18 shows example dot plots between AGCT CA and ACCT CA. The
left dot plot allows no mismatches and w = 3 while the right dot plot allows
1 mismatch per 3 nucleotides. Figure 4.19 shows two dot plots between a
HIV type 1 subtype C (AB023804) sequence and itself, using window size 9.
The left gure allows no mismatches while the right gure allows 1 mismatch.
The main diagonal always appears in the two dot plots since we compare
a sequence with itself. The two diagonals on the top right corner and the
bottom left corner represent the repeat appears at the beginning and the end
of the sequence. The short lines in the gures are noise. In general, when
the window size w is longer and the similarity limit d is higher, we get less
random noise but also increase the chance of missing similar regions.
Genome Alignment 105
A C C T C A A C C T C A
A 0 0 0 0 A 1 0 0 0
G 0 0 0 0 G 0 1 0 0
C 0 0 1 0 C 0 0 1 0
T 0 0 0 1 T 0 0 0 1
C C
A A
FIGURE 4.18: The two gures show the dot plot for two sequences
AGCT CA and ACCT CA. Both of them use window size w = 3. The left
gure sets d = 3 while the right gure sets d = 2.
4.8 Exercises
1. Suppose the minimum length of MUM is 3. What are the set of MUMs
for S1 = AAAACGTCGGGATCG and S2 = GGGCGTAAAGCTCT.
2. Refer to the above question. If we further require that the MUMs are
also unique in the sequence and its reverse complement, what is the set
of MUMs?
FIGURE 4.19: The dot plot between a HIV type 1 subtype C (AB023804)
and itself. The dot plot on the left was generated using window size 9 and al-
lowing no mismatches. The dot plot on the right was generated using window
size 9 and allowing at most 1 mismatch.
5.1 Introduction
5.1.1 Biological Database
The number of biological sequences (protein, DNA, and RNA sequences)
has grown exponentially (doubling every 18 months) in the last few years. Of-
ten these sequences are submitted to the International Nucleotide Sequence
Database Collaboration (INSDC), which consists of three databases DDBJ
(DNA Data Bank of Japan, Japan), EMBL (European Molecular Biology
Laboratory, Germany), and GenBank (National Center for Biotechnology In-
formation, USA). In 2008, the database had approximately 110 million se-
quences and 200 billion base pairs for more than 240,000 named organisms.
Searching the database has proven to be useful. For example, in November
2005, an unknown virus from a child in an Amish community was suspected
to be an intestinal virus. Through database searching, the unknown sequence
was found to be a polio virus. This is the rst polio case in the U.S. since
1999 and it demonstrates the power of database search.
In fact, in molecular biology, it is common to search query sequences on
various databases since sequence similarity often leads to functional similarity.
For instance, in 2002, GenBank alone served 100,000 search queries daily
which had risen to over 140,000 queries daily by 2004 (See [210]).
Considering the size of the biological databases and the large amount of
daily queries, the need for time-ecient database searching algorithms is self-
evident.
109
110 Algorithms in Bioinformatics A Practical Introduction
Local Alignment Score: The best possible alignment score between a sub-
string A of S and a substring B of Q.
The main measures used to evaluate the eectiveness of a searching algo-
rithm are sensitivity and eciency which are described below.
Sensitivity is the ratio of the number of true positives (substrings in the
database matching the query sequence) found by the algorithm to the
actual number of true matches. It measures an algorithms ability to
nd all true positives. An algorithm with 100% sensitivity nds all true
positives.
Sensitivity can be viewed as the probability of nding a particular
true positive. The higher/lower the sensitivity of the algorithm, the
more/less likely that a given true positive will be found.
Eciency measures the running time of the method. We prefer an algorithm
which is ecient.
As such, a good search algorithm should be sensitive and at the same time
ecient.
Examples of such algorithms are: QUASAR (Section 5.6) and LSH (Sec-
tion 5.7). Note that unlike heuristic methods, QUASAR does not miss
any solution while LSH is within a known margin of error (i.e., the false
negative rate is within a known error threshold).
Note that the above list is non-exhaustive and it describes some of the more
commonly used approaches. There are many other database search methods.
5.3 FastA
FastA [191] is a heuristic search algorithm which was heavily used before
the advent of BLAST. Given a database and a query, FastA aligns the query
sequence with all sequences in the database and returns some good alignments,
based on the assumption that a good alignment should have some exact match
substrings. This algorithm is much faster but less sensitive than the Smith-
Waterman algorithm.
The development of FastA can be dated back to 1980s. In 1983, Wilbur
and Lipman [308] proposed a diagonal method to align protein and DNA
sequences. Their algorithm, known as the Wilbur-Lipman algorithm, achieved
a balance between sensitivity and specicity on one hand and speed on the
other. In 1985, Lipman and Pearson improved the Wilbur-Lipman algorithm
and proposed the FastP [190] algorithm. FastP assumes insertion and deletion
(indels) are infrequent and it tries to identify good ungapped alignments.
Then, in 1988, an improved version of FastP, called FastA [191], was proposed.
The major modication is to allow indels during the identication of good
112 Algorithms in Bioinformatics A Practical Introduction
Lipman and Pearson [190] observed that amino acid replacements occur
far more than indels. Hence, they targeted the identication of high scor-
ing alignments without indels between the query sequence and the database.
The approach used a lookup table to identify short exact matches known as
hotspots between the query and the database. Then, those hotspots are clus-
tered to identify high scoring alignments without indels, which are known as
diagonal runs. Precisely, there are three steps in the FastP algorithm.
Step 1: Identication of hotspots. Hotspots are k-tuples (length-k
substrings) of the query which match exactly with the k-tuples of the database
sequences. For example, Figure 5.1 shows the hotspots between the query and
the database when k = 2. The parameter k controls the number of hotspots.
A bigger k reduces the number of hotspots, which increases searching speed
but reduces sensitivity. By default, k = 4, 5, or 6 for DNA sequences, and
k = 1 or 2 for protein sequences.
The hotspots can be identied eciently through table lookup. A lookup
table consists of all possible k-tuples (the table size is 4k for DNA and 20k
for protein). For every k-tuple in the query, we ag the corresponding entry
in the lookup table. Then, we scan every k-tuple in the database. A hotspot
is identied if the k-tuple in the database is agged in the lookup table. The
running time of this step is O(n+m) where n is the total length of all sequences
in the database and m is the length of the query.
Query: CAACTTGCC
Seq1: ACGGTTACGTAGGTCCG
Seq2: GCGTAGGCAGAAGTTGCCTGCGT
Seq3: ACGAAGTAGCCGTCAGTC
Seq4: TAGTCCGTAGAAGTCGTAGTC
FIGURE 5.1: Assuming each hotspot is a 2-tuple, the squared boxes are
the hotspots between the query sequence and the database sequences. The
ellipse boxes are the diagonal runs.
Database Search 113
1 It is named as diagonal run since those hotspots lie on the same diagonal when visualizing
FIGURE 5.2: The FastA algorithm: For each database sequence, it exe-
cutes the three steps of FastP to identify the 10 best initial regions (see (a)).
Then, Step 4 joins some of these initial regions by allowing indels (see (b)).
Finally, Step 5 performs bounded Smith-Waterman dynamic programming to
compute the optimal alignment score between the query and the database
sequence (see (c)).
In Step 5, if the initn score of the database sequence is smaller than a (user-
dened) threshold, it is discarded. Otherwise, the banded Smith-Waterman
dynamic programming algorithm (see Section 2.2.2) is applied to get the
optimum alignment and score, as shown in Figure 5.2(c). Finally, all database
sequences are ranked based on their optimum scores.
5.4 BLAST
BLAST stands for Basic Local Alignment Search Tool [114]. It is designed
for speed and is faster than FastA. Although there is a corresponding reduction
in the sensitivity of BLAST compared to FastA, the results returned are still
good enough. As such, BLAST is now the de facto standard and is used by
most public repositories like GenBank.
The rst version of BLAST, namely BLAST1 [9], was proposed in 1990. It
was fast and was dedicated to search for regions of local similarity without
gaps. BLAST2 [10] was created as an extension of BLAST1, by allowing
the insertion of gaps (similar to the dierence in capability between FastP
and FastA). Two versions of BLAST2 were independently developed, namely,
WU-BLAST2 by Washington University in 1996 and NCBI-BLAST2 by the
National Center for Biotechnology Information in 1997. NCBI-BLAST2 is the
version which is more commonly used today.
Database Search 115
5.4.1 BLAST1
BLAST1 is a heuristic method, which searches for local similarity without
gaps. To state exactly what BLAST1 aims to nd, we need some denitions.
Given a query sequence S1 and a database sequence S2 , a pair of equal-length
substrings of S1 and S2 is called a segment pair. The score of a segment
pair is the sum of the similarity score of every pair of aligned bases. For
amino acids, we can use the PAM score or the BLOSUM score; for DNA,
we can use the BLAST score, which scores match +2 and mismatch 1. A
segment pair is called a high scoring segment pair (HSP) if we cannot extend
it to give a higher score. Among all high scoring segment pairs of S1 and
S2 , the HSP with the maximum score is called the maximal segment pair
(MSP). Precisely, given a query sequence Q and a database D, BLAST1 aims
to report all database sequences S in D such that the maximal segment pair
(MSP) score of S and Q is bigger than some threshold . BLAST1 is a
heuristic which tries to achieve the aim. There are 3 steps in the BLAST1
algorithm:
1: query preprocessing
2: database scanning
3: hit extension
Step 1: Query preprocessing. Step 1 tries to identify substrings in D
which look similar to the query sequence Q. Precisely, it scans every w-tuple
(length-w substring) W of Q and generates the set of (w, T )-neighbors of W ,
i.e., all length-w substrings W such that the similarity between W and W
is more than a threshold T , that is, i=1 (W [i], W [i]) T .
w
For example, consider the 3-tuple N II. Using a BLOSUM 62 matrix, the
set of (3, 13)-neighbors of N II is {N II, N IV, N V I}.
In the implementation, a lookup table for all w-tuples is constructed. For
each w-tuple W in the lookup table, we store the list of length-w substrings
W of the query sequence whose (w, T )-neighbor is W .
By default, BLAST1 uses a word size w = 3 and T = 13 for amino acid
sequences (protein) and w = 11 and exact match for nucleic acid sequences
(DNA and RNA).
Step 2: Database scanning. If a database sequence contains some neigh-
bor of some w-tuple of a query sequence, the database sequence has the po-
tential to match the query. Step 2 aims to scan the database D to locate
those matches. Such a match is called a hit. A hit is characterized by the
position pairs (x, y) where x and y are positions in the query sequence and
the database sequence, respectively. All hits can be found by comparing each
w-tuple in D with the lookup table. Hence, all hits can be found in O(|D|)
time.
Step 3: Hit extension. Every hit found in Step 2 corresponds to an
ungapped alignment of length w. Step 3 extends the hit in both directions to
generate a longer alignment without gap as shown in Figure 5.3. To speed up
this step, any extension is truncated as soon as the score decreases by more
116 Algorithms in Bioinformatics A Practical Introduction
p of query
q of DB
5.4.2 BLAST2
BLAST1 cannot report local alignments with gaps. To address this prob-
lem, BLAST2 was developed. BLAST2 performs four steps.
1: query preprocessing
2: database scanning
3: hit extension
4: gapped extension
The rst two steps in BLAST2 are the same as those in BLAST1 and they
generate the list of hits. Step 3 performs the hit extension. For DNA, this
step is the same as that in BLAST1. For protein, an additional requirement,
known as a two-hit requirement, is needed before a hit is extended. A hit
(x, y) is said to satisfy the two-hit requirement if there exists another hit
(x , y ) such that x x = y y and A > x x > w (by default, A = 40).
This process is illustrated in Figure 5.4. Since only a small fraction of hits
can meet this requirement, the computational time of BLAST2 is signicantly
reduced.
Database Search 117
(a) (b)
FIGURE 5.5: (a) Banded dynamic programming and (b) score-limited dy-
namic programming. Observe that banded dynamic programming usually
needs to ll in more entries.
After BLAST2 performs the ungapped hit extension, a set of HSPs is gen-
erated. For those HSPs with scores above some threshold, Step 4 performs
the gapped extension using a modied Smith-Waterman algorithm.
In the modied Smith-Waterman algorithm, the dynamic programming ma-
trix is explored in both directions starting from the mid-point of the hit. When
the alignment score drops o by more than Xg ( a user-dened parameter),
the extension will be truncated. (You are asked to give the detail of this al-
gorithm in Exercise 7.) This approach only computes the scores in the area
denoted by the bubbles in Figure 5.5(b). Hence, it reduces the running time.
Note that this method saves more processing power when compared with the
banded Smith-Waterman algorithm used by FastA (see Figure 5.5(a)).
Using BLAST, we can compare a protein sequence with a protein database
and a DNA sequence with a DNA database. In addition, by translating the
DNA sequence into a protein sequence using six dierent reading frames,
118 Algorithms in Bioinformatics A Practical Introduction
we can also compare a DNA sequence with a protein sequence. Figure 5.6
summarizes ve dierent ways of applying the BLAST algorithm to search
DNA and protein databases.
For sensitivity, BLAST also achieves better sensitivity for protein. How-
ever, for DNA, BLAST is less sensitive than FastA since it uses a long word
size 11. BLAST is less eective than FastA in identifying important sequence
matches with lower similarities, particularly when the most signicant align-
ments contain spaces.
In practice, for most applications, the reduced sensitivity of BLAST over
FastA is not an issue while the increased speed is (due to the number of queries
made daily), so most biological databases use BLAST (and its variants) for
nding local alignment.
5.5.1 MegaBLAST
MegaBLAST [317] is a greedy algorithm used for the DNA gapped sequence
alignment search. MegaBLAST is designed to work only with DNA sequences.
To improve eciency, MegaBLAST uses longer w-tuples (by default, w = 28).
But this reduces the sensitivity of the algorithm. As such, MegaBLAST is
used to search larger databases where standard BLAST would be too slow.
MegaBLAST takes as input a set of DNA query sequences. The algorithm
concatenates all the query sequences together and performs a search on the
obtained long single query sequence. After the search is done, the results are
re-sorted by query sequences.
Unlike BLAST, MegaBLAST by default uses linear gap penalty. To use the
ane gap penalty, advanced options should be set. It is not recommended to
use the ane version of MegaBLAST with large databases or very long query
sequences.
Database Search 121
5.5.2 BLAT
BLAT [174] stands for BLAST-like alignment tool. It only works for
DNA. Similar to BLAST, BLAT locates all hits and extends them into high-
scoring segment pairs (HSPs).
Moreover, BLAT diers from BLAST in some signicant ways. First, recall
that BLAST builds the lookup table for the query and scan the database to
nd hits. BLAT does the reverse. It creates the lookup table for the database
and scan the query to nd hits. This approach speeds up the running time
by a lot since it avoids the time consuming step of scanning the database.
However, since the database is big, this approach takes up a lot of memory.
To reduce the memory usage, BLAT creates the lookup table for the non-
overlapping k-mers of the database instead of all k-mers. Although some hits
may be missed due to this approach, BLAT nds that the sensitivity will not
be reduced by a lot.
Second, BLAT also allows triggering an extension when 2 or more hits
occur in close proximity. By default, BLAT uses the two-hit requirement
and w = 11. It has been noted that BLAT is less sensitive than BLAST, but
it is still more sensitive than MegaBLAST. Also, it is fast. In fact, in some
cases its claimed to be over 100 times faster.
Third, while BLAST returns each pair of homologous sequences as separate
local alignments, BLAT stitches them together into a larger alignment. Such
an approach eectively handles introns in RNA/DNA alignments. Unlike
BLAST, which only delivers a list of exons, BLAT eectively unsplices
mRNA onto the genome giving a single alignment that uses each base of
the mRNA only once, and which correctly positions the splice sites.
5.5.3 PatternHunter
PatternHunter [201] is designed to work for DNA only. It is a Java program
which nds homologies between two DNA sequences with high sensitivity.
PatternHunter can achieve an accuracy similar to BLAST and a speed sim-
ilar to MegaBLAST. Its accuracy is contributed by its patented technology
spaced seed and its eciency is due to the use of a variety of advanced data
structures including priority queues, a variation of red-black tree, queues and
hash tables.
Below, we describe the concept of spaced seed. A seed of weight w and
length m is a binary string BS[1..m] with w 1s and (m w) 0s. Two
DNA sequences A[1..m] and B[1..m] are matched according to the seed BS
if A[i] = B[i] for all positions i where BS[i] = 1. Figure 5.7 shows three ex-
amples of aligning DNA sequences according to two seeds. Note that BLAST
uses a length-11 unspaced seed (a seed without 0). PatternHunter observed
that spaced seeds (seeds with 0s) are better than unspaced seeds in general.
The advantage of spaced seeds is that they can signicantly increase hits to
true homologous regions and reduce false hits as compared to using unspaced
122 Algorithms in Bioinformatics A Practical Introduction
11111111111 111010010100110111 111010010100110111
AGCATTCAGTC ACTCCGATATGCGGTAAC ACTCCAATATGCGGTAAC
||||||||||| |||-|--|-|--||-||| |||-|--|-|--x|-|||
AGCATTCAGTC ACTTCACTGTGAGGCAAC ACTCCAATATGCAGTAAC
(a) (b) (c)
FIGURE 5.7: This gure shows three alignments according to two seeds.
(a) An example of aligning two length-11 strings according to the unspaced
seed 11111111111. (b) An example of aligning two length-18 strings according
to the space seed 111010010100110111. Note that, even though there are some
mismatches for positions with 0s, we consider the two strings are matches
according to the space seed. (c) An example not matched according to the
space seed pattern (since there is one mismatch at position 13).
11111111111 111010010100110111
11111111111 111010010100110111
(a) (b)
FIGURE 5.8: (a) Two adjacent unspaced 11-tuples. They share 10 sym-
bols. (b) Two adjacent spaced 11-tuples. They share 5 symbols only.
LEMMA 5.1
The expected number of hits of a weight-w length-m seed model within a length
L region with similarity p(0 p 1) is (L m + 1)pw .
Database Search 123
PROOF For each possible position within the region, the probability of
having w specic matches is pw . Since there are L m + 1 possible positions
within the region, the expected number of hits is (L m + 1)pw .
5.6.1 Algorithm
QUASAR is an approximate matching algorithm. Formally, the problem is
dened as follows.
distance with the query sequence. The precise ltering criteria is stated in
the following lemma.
LEMMA 5.2
Given two length-w sequences X and Y , if their edit distance is at most k,
then they share at least t common q-grams (length-q substrings) where t =
w + 1 (k + 1)q.
The threshold stated in Lemma 5.2 is tight. For example, consider two
strings ACAGCTTA and ACACCTTA. They have an edit distance of 1 and
have 8 3(1 + 1) + 1 = 3 common q-grams: ACA, CTT, and TTA.
Lemma 5.2 gives a necessary condition for any substring in D to be a
candidate for an approximate match with S[i..i + w 1]. If S[i..i + w 1] and
D[j..j + w 1] share less than t q-grams where t = w + 1 (k + 1)q, the edit
distance between S[i..i + w 1] and D[j..j + w 1] is more than k and we
can lter it away. Hence, we have the basic q-gram ltration method.
First, the method nds all matching q-grams between the pattern S and
the database D. In other words, it nds all pairs (i, j) such that the
q-gram at position i in S is identical to the q-gram at position j in D.
Such a pair is called a hit.
FIGURE 5.10: The basic QUASAR algorithm for nding potential ap-
proximate matches.
i SA[i]
ACT idx(AC)
AGCACT idx(AG)
CACT
idx(CA)
CAGCACT
idx(CT)
CT
GCACT idx(GC)
T
i1 i2 ik
Pr(same value)
s1 = 1 - d/w
s2
k
d
Pr ((s1 ) = (s2 )) = Pr (s1 [ij ] = s2 [ij ]) = 1
w
j=1,...k
For the time analysis, in the worst case, O(N ) w-mers might be hashed to
the same LSH value, either because they are all pairwise similar or because
the hash functions () yielded many false positives. The number of string
comparisons performed can therefore in theory be as high as O(N 2 ). On
average, we expect 4Nw w-mers are hashed to the same bucket. Hence, the
2 2
expected number of string comparisons is 4w 4Nw = N 4w . This implies that
2
the expected running time is O( N (km+w)
4w ), which is ecient in practice.
130 Algorithms in Bioinformatics A Practical Introduction
5.8 BWT-SW
As discussed previously, the optimal local alignment between a query se-
quence and a database can be computed using the Smith-Waterman dynamic
programming. This approach, however, is slow. On the other hand, heuris-
tic solutions like FastA, BLAST, BLAT, and PatternHunter are much faster;
however, they cannot guarantee nding the optimal local alignment. This sec-
tion discusses a method called BWT-SW [182] which uses a sux tree or an
FM-index to speed up the Smith-Waterman dynamic programming. BWT-
SW is ecient and guarantees nding the optimal local alignment.
_ a c a c a g
_ 0 -1 -2 -3 -4 -5 -6 Corresponding
alignment:
c 0 -1 1 0 -1 -2 -3 acac
t 0 -1 0 0 -1 -2 -3 -ctc
c 0 -1 1 0 2 1 0
cac -
ctc -
Q and S[3..6]: (Score= 1) Q and S[6..6]: (Score= 0)
ac -
tc -
0
-1
-2 0
-1
1 0
-1
0 0
-1
1
$ a c g$
a
7 -3 6
c g
0
a $
0 c
a
0
5 g g$
c $
ga g
$ 2 4
$
1 3
FIGURE 5.16: Let Q = ctc be the query. The gure shows the sux tree
for the sequence S = acacag. We also show the dynamic programming table
columns when we go down the tree along the path aca. Note that it is the
same as the rst 4 columns in the dynamic programming table in Figure 5.14.
Furthermore, observe that aca is the common prex of the two suxes S[1..6]
and S[3..6]. We can avoid lling in these four columns twice when we ll in
the dynamic programming along the paths in the sux tree.
sux tree T . We can ll in the dynamic programming table for any sux of
S along the corresponding path in the sux tree. When two suxes share
a common prex, the sux tree can avoid redundant table lling, which is
illustrated in Figure 5.16.
How deep should we go when we align a pattern to a sux trie? The depth
of the sux trie is n. However, we do not need to go down to depth n. If the
pattern Q is of length m, we only need to go down the tree by at most cm
characters, for some constant c depending on the scoring matrix. For instance,
for our scoring matrix (score 2 for match and 1 for mismatch/insert/delete),
we claim that we need to go down the sux trie to depth at most 3m. To
prove the claim, observe that within every alignment, let x be the number of
match/mismatch positions and y be the number of indel positions. Using our
scoring matrix, the alignment score should be at most 2x y 2m y. Since
every alignment has a non-zero score, we have y 2m. Hence, we need to go
down the sux trie at most x + y characters, which is at most 3m. The claim
is proved.
Figure 5.17 shows the algorithm for local alignment using a sux trie.
Below, we analyze the time complexity. Let L be the number of paths in T
with depth cm. The number of nodes in those paths is at most cmL. For
each node, we need to compute a dynamic programming column of size m + 1.
Hence the running time is O(cm2 L). Note that L = O(min{n, cm }). Hence,
when m is not big, the worst case running time is faster than O(nm).
Database Search 133
FIGURE 5.17: Algorithm for computing the optimal local alignment using
a sux trie.
_ c a c a g
_ 0 -f -f -f -f -f Corresponding
alignment:
c 0 2 1 0 -f -f cac
t 0 -f 1 0 -f -f ctc
c 0 -f -f 3 2 1
The dynamic programming for nding the optimal meaningful alignment be-
tween all substrings of Q and S is illustrated in Figure 5.18. To generate the
best local alignment, we repeat the same computation for all suxes S of S.
Figure 5.19 shows the optimal meaningful alignments between Q = ctc and
all suxes of S = acacag. Among all the meaningful alignment scores, the
best alignment score is 3, which is the best local alignment score.
There are two advantages when we compute the optimal local alignment
using the new formulation. First, we can perform the meaningful alignments
for all suxes of S on the sux trie T of S, thus avoiding redundant compu-
tations. Second, in practice, many entries in the dynamic programming are
either zero or (see Figure 5.18 for example). This allows us to have two
pruning strategies.
Pruning strategy 2: When we go down the tree, we do not need O(m) time
to compute a column when the column has many non-positive entries
(see Figure 5.20(b)).
The algorithm can be further extended to handle the ane gap penalty (see
Exercise 11).
Database Search 135
FIGURE 5.19: For any i = 1, 2, . . . , 6, the gure shows the optimal mean-
ingful alignment between any substring of Q = ctc and any prex of S[i..6],
where S = acacag.
0 0
0 0
-f -f
0 0
-f 2
0 0
-f -f
$ -f a c g$ $ -f a c g$
a a
7 6 7 6
c g c g -f
a $ a $
c c 1
a g a g 1
5 g $ 5 g $
c $ c $
-f
ga g
$ ga g
$ 2 4
$ 2 4 $
1 3 1 3
(a) (b)
FIGURE 5.20: Figure (a) illustrates pruning strategy 1. Starting from the
root and when we move down to a, all entries in the dynamic programming
column are ; in this case, we can prune the whole subtree. Figure (b)
illustrates pruning strategy 2. Starting from the root and when we move
down to c, only the second entry in the dynamic programming column is a
positive integer. Hence, when we move further down to a, we only need to
compute the values for the second and third entries. In this case, we can
prune the computation for the rst and the fourth entries.
136 Algorithms in Bioinformatics A Practical Introduction
5.10 Exercises
1. Go to the NCBI Genbank (http://www.ncbi.nlm.nih.gov/Genbank/)
to extract the sequence NM 011443. This gene is called Sox2 in mice. Se-
lect a DNA segment and a corresponding amino acid segment of the gene
and BLAST them using BLASTn and BLASTp, respectively. What are
the results? Can you nd the Sox2 gene in the other organisms?
Seq1 : CGTTTACGGGTACTTTGCAGTAGCTGATGGC
Seq2 : ACGTAAATCGGGAGCATTTCGTACAGACT
Assume the match score is +2, the indel score is 1, and the mismatch
score is 1. Assume each hotspot is a 3-tuple.
Database Search 137
(a) Can you identify the hotspots and the diagonal runs for both
database sequences?
(b) Can you compute the init1 score for both database sequences?
(c) Can you compute the initn score for both database sequences?
3. Consider the following query sequence Q = VPNMIHCTSAG. Can you per-
form the query preprocessing step of BLAST and generate the lookup
table for all 2-tuples of Q? Assume the similarity threshold T = 8.
4. Consider a query sequence S=TCTCACCGTGCACGACATC and a database se-
quence T=CGGAACTGTGAACAATCCT. Assume the match score is +5, the
mismatch score is 4, and the extension truncation threshold is X = 13.
Suppose the word length is 3. One of the hit between S and T is GT G.
Starting from the hit GT G, can you demonstrate the hit extension step
in BLAST1? What is the MSP of this database sequence?
5. This question generalizes the two-hit requirement in BLAST to a three-
hit requirement. Given a query Q[1..m] and a database sequence S[1..n].
A hit (x, y) exists if Q[x..x+w1] looks similar to S[y..y+w1], where w
is the word size. A hit (x1 , y1 ) is said to satisfy the three-hit requirement
if there exist (x2 , y2 ), (x3 , y3 ) such that (1) x2 x1 = y2 y1 > w and
x3 x2 = y3 y2 > w, and (2) x3 x1 < A for some constant A. Suppose
138 Algorithms in Bioinformatics A Practical Introduction
you are given the set of hits D of size s. Can you give an ecient
algorithm to identify all the hits satisfying the three-hit requirement?
What is the running time?
6. Referring to the above question, generalize the denition of the three-
hit requirement to the k-hit requirement. Can you give an ecient
algorithm to identify all the hits satisfying the k-hit requirement? What
is the running time?
7. Can you give the algorithm for score-limited dynamic programming for
BLAST2?
8. Consider the following four seeds: 101010101, 11111, 111011, and 110111.
Can you rank the goodness of the three seeds in term of getting at least
one hit in the homologous region? Explain your answer. (You can as-
sume the database is a randomly generated sequence.)
9. Design the shortest space seed of weight 4 so that every overlapping seed
shares at most 1 position.
10. Consider a text S[1..n] and a query Q[1..m] where n >> m. If the
scores for match, mismatch, open gap, and space are 5, 4, 5, and 1,
respectively, what is the maximum length of the optimal local alignment
between S and Q? (State the answer in term of m.)
11. Describe how to extend the algorithm discussed in Section 5.8 to handle
the ane gap penalty.
Chapter 6
Multiple Sequence Alignment
6.1 Introduction
Chapter 2 dened the alignment of two sequences and proposed methods
for computing such alignment. This chapter extends the alignment concept
to multiple sequences (that is, three or more sequences). Given a set of three
or more DNA/RNA/protein sequences, multiple sequence alignment (MSA)
aims to align those sequences by introducing gaps in each sequence. Figure 6.1
shows an example of a multiple sequence alignment of a set of HIV sequences.
Observe that the similarity among a set of sequences can be determined
by pairwise alignment. Why do we need MSA? One reason is that pairwise
alignment cannot identify regions which are conserved among all sequences.
Multiple sequence alignment, on the other hand, can tell us such information.
For example, biologists can align proteins of similar function to identify the
functionally conserved regions of a set of proteins. Those conserved amino
acid stretches in proteins are strong indicators of protein domains or preserved
three-dimensional structures. Hence, multiple sequence alignment has been
widely used in aiding structure prediction and characterization of protein
families.
Below, we rst formally dene the multiple sequence alignment (MSA)
problem. Then, we describe dierent methods for computing multiple se-
quence alignment, including the dynamic programming approach, the pro-
gressive approach, and the iterative approach.
139
140 Algorithms in Bioinformatics A Practical Introduction
*** * * * ** * * ******* * * * ** * *
CAAGAAAAAG___TATAAATATAGGACCAGGGAGAGCATTTTATACAACA
CAAGAAAAAG___TATACATATAGGACCAGGGAGAGCTTTTTATACAACA
CAAGRAAAAG___TATACMTATAGGACCAGGGAGAGCATTTTATACAACA
CAAGAAAAAG___TATAMMTATAAGACCAGGGAGAGCATTTTATACAACA
CAAGAAAAAG___GATACATATAGGACCAGGGAGAGCAGTTTATACAACA
CAAGAAGAAG___TATACMTTTMGGACCAGGGAAAGCATTTTATRC___A
CAAGAAGAAG___TATACATTTWGGACCAGGGAAAGCATTTTWTGC___A
CAAAAATAAGACATATACATATAGGACCAGGGAGACCATTTTATACAGCA
CAAGAAGARG___TRTACATATAGGACCAGGGARAGCATATTATAC___A
CAAGAAAAAG___TATACCTATAGGACCAGGGAGAGCMTTTTATRCAACA
CAAGAAAAAG___TGTACATATRGGACCAGGGAGAGCATATTAYAC___A
CAAGAAAAAG___TGTACATATAGGACCAGGGAAAGCATATTATAC___A
CAAGAAAAAG___TATACATATAGGACCAGGAARAGCATTTTATGCAACA
S1 = ACG__GAGA
S2 = _CGTTGACA
S3 = AC_T_GA_A
S4 = CCGTTCAC_
In fact, we can describe the three cases using another way. For each j =
1, 2, let bj be an indicator variable which equals 0 if the last column of the
alignment Aopt is a space in Sj ; and 1, otherwise. Then, (b1 , b2 ) = (1, 1) if the
last column is match/mismatch; (b1 , b2 ) = (0, 1) if the last column is insert;
and (b1 , b2 ) = (1, 0) if the last column is delete. For technical reasons, we
dene S1 [0] = S2 [0] = . Then, the recursive equation for V can be rewritten
Multiple Sequence Alignment 143
as:
V (i1 , i2 , . . . , ik ) =
max {V (i1 b1 , . . . , ik bk ) + SP-score(i1 b1 , i2 b2 , . . . , ik bk )}
(b1 ,...,bk ){0,1}k {0k }
where SP-score(i1 , i2 , . . . , ik ) = 1p<qk (S[ip ], S[iq ]).
Using the above recursive equation, the optimal SP score V (n1 , n2 , . . . , nk )
can be computed by lling in the dynamic programming table V . Then, by
back-tracing starting from the entry V (n1 , n2 , . . . , nk ) (similar to the back-
tracing described in Section 2.2.1), we can recover the optimal multiple align-
ment.
For time complexity, since we need to ll in n1 n2 . . . nk entries and each en-
try can be computed in O(k 2 2k ) time, the time required is O(k 2 2k n1 n2 . . . nk ).
For space complexity, since we need to store the table V , the space required
is O(n1 n2 . . . nk ).
S1: CCTGCTGCAG
S2: GATG-TGCCG
S1 S2 S3 S4 S5
S1 0 4 3 2 4 6i=1..k D(S1,Si) = 13 S1: CCTGCTGCAG S 1: CCTGCT-GCAG
S 1: CCTGCTGCAG
6i=1..k D(S2,Si) = 16 S3: GATG-TGCAG S 2: GATG-T-GCCG
S 2: GATGTGCCG S2 0 1 6 5
S 3: GATGTGCAG 6i=1..k D(S3,Si) = 14 S 3: GATG-T-GCAG
S3 0 5 5 6i=1..k D(S4,Si) = 17 S1: CCTGCT-GCAG S 4: CC-GCTAGCAG
S 4: CCGCTAGCAG
S4: CC-GCTAGCAG S 5: CCTG-TAG--G
S 5: CCTGTAGG S4 0 4 6i=1..k D(S5,Si) = 18
S5 0 S1: CCTGCT-GCAG
S5: CCTG-TAG--G
S1: CCTGCTGCAG
S2: GATG-TGCCG S1: CCTGCTGCAG
S2: GATG-TGCCG S 1: CCTGCTG-CAG
S1: CCTGCTGCAG S3: GATG-TGCAG S 2: GATG-TG-CCG S 1: CCTGCT-GCAG
S3: GATG-TGCAG S 3: GATG-TG-CAG
S1: CCTGCT-GCAG S 2: GATG-T-GCCG
S 4: CC-GCTAGCAG S 3: GATG-T-GCAG
S4: CC-GCTAGCAG
S 4: CC-GCTAGCAG
S1: CCTGCT-GCAG S 5: CCTG-TAG--G
S5: CCTG-TAG--G
FIGURE 6.5: This gure demonstrates how to convert the pairwise align-
ments in Figure 6.4(d) to the multiple alignment in Figure 6.4(e).
Multiple Sequence Alignment 145
Below, we show that the multiple alignment generated by the center star
method has the sum of pair distance at most twice the optimal sum of pair
distance. Our proof relies on the fact that, for any multiple alignment M,
the distance score dM () satises the triangle inequality, that is, dM (X, Y )
dM (X, Z) + dM (Z, Y ) for any three sequences X, Y , and Z in the multiple
alignment M.
Let M be the multiple alignment generated by the center star method.
Let M be the optimal multiple alignment which minimizes the sum of pair
k
distance. By the denition of the center string Sc , for any i, j=1 D(Si , Sj )
k
j=1 D(Sc , Sj ). Hence, the sum of pair distance for M
= dM (i, j)
1i<jk
1i<jk D(Si , Sj )
1
k k
= 2 i=1 j=1 D(Si , Sj )
12 ki=1 kj=1 D(Sc , Sj )
k k
= 2 j=1 D(Sc , Sj )
Thus, the sum of pair distance for M is at least k2 j D(Sc , Sj ).
Then, by the triangle inequality, the sum of pair distance for M
= 1i<jk dM (i, j)
1
k k
= 2 i=1 j=1 dM (i, j)
k k
12 i=1 j=1 [D(Sc , Si ) + D(Sc , Sj )]
k k
= k2 i=1 D(Sc , Si ) + k2 j=1 D(Sc , Sj )
= k j D(Sc , Sj )
Hence, the sum of pair distance of M is at most twice the optimal sum of
pair distance for S. We have the following lemma.
LEMMA 6.1
Let M be the multiple alignment of S = {S1 , . . . , Sk } computed by the center
star method. The sum of pair distance of M is at most twice that of the
optimal alignment.
S1 S2 S3 S4 S5
S1: PPGVKSDCAS
S1 0 0.111 0.25 0.555 0.444
S2: PADGVKDCAS
S2 0 0.375 0.222 0.111
S3: PPDGKSDS
S4: GADGKDCCS S3 0 0.5 0.5
(a) S5 0
(b)
S1: PPGVKSDCAS
S2: PATGVKDCAS
S3: PPTGKSD--S
S4: GATGK-DCCS
s1 s3 s2 s4 s5
S5: GATGK-DCAS
(d) (c)
FIGURE 6.7: The gure shows the alignment of S1 and S3 in Figure 6.6.
There are eight non-gap positions and six identical positions. Hence, the
distance is 1 68 = 0.25.
6.6.1 ClustalW
Given a set of sequences S = {S1 , S2 , . . . , Sk }, each of length O(n). ClustalW
[145, 287] performs the following three steps.
First, ClustalW computes the optimal global alignment for every pair of
sequences Si and Sj (see Section 2.2.1); then, the distance score of Si and Sj
is set to be 1 xy where x and y are the number of non-gap positions and the
number of identical positions, respectively, in the alignment between Si and
Sj . Figure 6.7 shows an example to compute the distance between S1 and S2
in Figure 6.6(a). The pairwise distance matrix for the ve sequences is shown
in the table in Figure 6.6(b).
Second, ClustalW builds the guide tree from the distance matrix using the
neighbor joining algorithm which is discussed in Section 7.3.4. The guide tree
is shown in Figure 6.6(c).
Third, according to the guide tree, we perform a series of alignments to
align larger and larger groups of sequences. For the sequences in Figure 6.6(a),
according to the guide tree in Figure 6.6(b), we perform 4 stages of alignment:
(a) align S1 with S3 , (b) align S4 with S5 , (c) align the alignment of (S1 , S3 )
with S2 , and (d) align the alignment of (S1 , S2 , S3 ) with the alignment of
(S4 , S5 ). At each stage, two sets of alignments are aligned by introducing new
gaps. Moreover, gaps that are present in the original alignments will not be
deleted. Such alignment is known as prole-prole alignment and its detail is
described in Section 6.6.2.
After the three steps, ClustalW reports the nal multiple alignment. For
time complexity, Step (1) performs k 2 global alignments, which takes O(k 2 n2 )
time. Step (2) builds the guide tree using neighbor joining, which takes O(k 3 )
time. For Step (3), each prole-prole alignment takes O(kn+n2 ) time. Since
the guide has at most k internal nodes, Step (3) takes O(k 2 n + kn2 ) time. In
total, the running time of ClustalW is O(k 2 n2 + k 3 ).
LEMMA 6.2
Assuming that the size of A is a constant, the prole-prole alignment of A1
and A2 can be computed in O(k1 n1 + k2 n2 + n1 n2 ) time.
PROOF We rst need to compute gxi for any x A and any column i in
A1 . This takes O(k1 n1 ) time. Similarly, we can compute gyj for any y A and
Multiple Sequence Alignment 149
6.7.1 MUSCLE
Stage (3) renes the multiple alignment to maximize the SP score using the
tree-dependent restricted partitioning technique. By deleting any edge from
the guide tree, the tree and the corresponding sequences are partitioned into
two disjoint sets. The multiple alignment of each subset can be extracted from
the multiple alignment of the previous iteration. Then, the two multiple align-
ments of the two subsets are realigned by means of prole-prole alignment.
If the SP score of the new multiple alignment is improved, we keep the new
multiple alignment; otherwise, we discard the new multiple alignment. The
process is repeated until all edges are visited without a change in SP score or
until a user-dened maximum number of iterations. In MUSCLE, the edges
are visited in decreasing distance from the root, which has the eect of rst
realigning individual sequences, then realigning closely related groups.
Multiple Sequence Alignment 151
i
where fG is the observed frequency of gaps in column i and fxi isthe normal-
ized observed frequency of character x in column i, that is, gxi /( xA gxj ). In
MUSCLE, the score (x, y), for any pair of amino acids x and y, is dened
using the 240 PAM VTML matrix [215].
6.9 Exercises
1. Extract some sequences from BAliBASE. (The website of BAliBASE is
http://www-bio3d-igbmc.u-strasbg.fr/balibase/.) Can you align
those sequences using ClustalW and MUSCLE? Do the results look sim-
ilar to the answers in BAliBASE?
S1 = ACTCTCGATC
S2 = ACTTCGATC
S3 = ACTCTCTATC
S4 = ACTCTCTAATC
Can you compute their multiple sequence alignment using the center
star method? Please show the steps.
7.1 Introduction
DNA is commonly known to be responsible for encoding the information of
life. Through sexual reproduction, DNA is passed on as hereditary material
to ospring. During the process, mistakes might sometimes occur. These
mistakes cause the DNA to be a bit dierent from its parent DNA (one or
more of the bases might have been changed). Such mistakes are known
as mutations. Due to the mutations of many generations of reproduction,
dierent taxa (or species) emerge (or evolve). Phylogenetics is the tool for
studying the evolutionary relationship among dierent taxa.
155
156 Algorithms in Bioinformatics A Practical Introduction
7.1.3 Phylogeny
In Cann et al.s project, the tree they built is known as phylogeny. Phy-
logeny, also known as a cladogram or a dendrogram, is usually represented
by a leaf-labeled tree where the internal nodes refer to the hypothetical an-
cestors and the leaves refer to the existing taxa. Two taxa that look alike
will be represented as neighboring external branches and will be joined to a
common parent branch. The objective of phylogenetic analysis is to analyze
all the branching relationships in a tree and their respective branch lengths.
As an example, the phylogeny of lizards is illustrated in Figure 7.1. In the
gure, time is the vertical dimension with the current time at the bottom
and earlier times above it. There are ve extant taxa (taxa currently living)
with their respective names stated. The lines above the extant taxa represent
the same taxa, just in the past. When two lines converge to a point, that
should be interpreted as the point when the two taxa diverge from a common
ancestral taxon. Eventually, until some time in the past, all taxa were derived
from just one taxon, the one displayed as the top point.
Phylogeny Reconstruction 157
To root a tree one should add an outgroup to the data set. An outgroup
is a taxon for which external information (for example, paleontological infor-
mation) is available that indicates that the outgroup branched o before all
other taxa. Using more than one outgroup (they must not be closely related),
we can improve the estimate of the nal tree topology.
Sequence A
Sequence B
Sequence C
Sequence A Sequence C
Sequence B Sequence D
Unrooted tree
Depending on the types of input data, there are two classes of methods:
character-based methods and distance-based methods. We will discuss the
two classes of methods in Sections 7.2 and 7.3.
Phylogeny Reconstruction 159
The Small Parsimony problem: Given the tree topology T , the problem
asks for the parsimony length L(T ) and the corresponding assignment
of the states to the internal nodes.
LEMMA 7.1
For every leaf u in T , we have
Ru = {c(u)}, L(T u) = 0.
For every internal node u in T where v and w are its children, let = 1 if
Rv Rw = ; and 0 otherwise. We have
Rv Rw if = 0
L(T u ) = L(T v ) + L(T w ) + , Ru =
Rv Rw otherwise
PROOF The state of every leaf u is xed to be c(u) by the input. Hence,
Ru = {c(u)}. Since there is no mutation, L(T u ) = 0.
For every internal node u in T , there are two cases depending on whether
= 0 or 1.
When = 0, Rv Rw
= . We claim that L(T u ) = L(T v ) + L(T w ).
Observe that the parsimony length of T u is at least L(T v ) + L(T w ).
Thus, L(T u ) L(T v ) + L(T w ). By labeling u, v, w by any Rv Rw ,
both edges (u, v) and (u, v) have no state change. Thus, we have
Hence, the claim follows. Note that the equality satises when u is
labeled by a state in Rv Rw . This means that Ru = Rv Rw .
When = 1, Rv Rw = . We claim that L(T u ) = L(T v ) + L(T w ) + 1.
Since there is no common state in Rv and Rw , the parsimony length
of T u is strictly larger than L(T v ) + L(T w ). Thus, L(T u ) L(T v ) +
L(T w ) + 1. By label v and w by 1 Rv and 2 Rw , respectively,
and u by where is either sigma1 or sigma2 , we have
L(T u ) L(T u , )
H(, 1 ) + H(, 2 ) + L(T v , 1 ) + L(T w , 2 )
= 1 + L(T v ) + L(T w )
Hence, the claim follows. Note that the equality satises when u is
labeled by a state in Rv Rw . This means that Ru = Rv Rw .
Fitchs algorithm
1: Initialization: Ru = {c(u)} for all leaves u
2: for every internal node u in postorder traversal do
3: Let v and w be the children of u.
4: Set = 1 if Rv Rw = ; 0, otherwise.
5: Set Lu = L v + Lw +
Rv Rw if = 0
6: Set Ru = .
Rv Rw otherwise
7: end for
8: for every internal
node u in preorder traversal do
c(v) if c(v) Ru
9: Set c(u) = where v is us parent.
arbitrary state in Rv otherwise
10: end for
FIGURE 7.4: Algorithm for computing the parsimony length and the cor-
responding character-state assignment of a tree T .
Figure 7.5 shows an example for the implementation of the above algorithm.
In the left phylogeny, we label every internal node u by Ru in the bottom-
up order using the recursive formula in Lemma 7.1. In the right phylogeny,
we traverse the phylogeny in top-down order to generate the label for each
internal node. The time complexity of the algorithm is O(n||) where n is
the number of taxa. Then, the parsimony length equals the number of state
changes in T .
Now, we consider the case when M has m columns, that is, every taxon is
represented by m characters. We note that the i-th character and the j-th
character are independent for any i and j. Thus, the problem can be solved
using m instances of the simple case problem. Then, the parsimony length of T
equals the total number of changes over all m characters. For each character,
the running time is O(n||). For m characters, the time complexity would be
O(mn||).
In the above discussion, we assume the input tree T is rooted. However,
the parsimony length is independent of where the root is located. When T is
unrooted, its parsimony length can be computed by rooting the tree at any
edge and running Fitchs algorithm. The above discussion also assumes the
tree is binary. The solution can be generalized to a non-binary tree case (see
Exercise 6).
{CG} G
{ACG}* {CG}* G* G*
{AC}* C*
A C G C G A C G C G
FIGURE 7.5: Illustration of Fitchs algorithm for solving the small parsi-
mony problem. On the left, we demonstrate the computation of Ru for all
internal nodes u in bottom-up order. Each asterisk (*) indicates a mutation
is required for one of its child edges. On the right, we demonstrate how to
label the internal nodes in top-down order.
enumeration time.
The eciency of this method relies on whether we know some complete tree
with small enough parsimony length. Hence, it is suggested that we can use
some ecient phylogenetic tree construction algorithm like neighbor-joining
(see Section 7.3.4) to generate a good enough tree rst. The parsimony length
of this tree helps to improve the eectiveness of the pruning strategy.
Approximation algorithm: Instead of nding an exact solution, there
exists a polynomial time approximation algorithm to solve the large parsimony
problem. The best known solution has an approximation ratio of 1.55 [7]. In
this section, we present a simple polynomial time algorithm with approxima-
tion ratio 2, that is, we can always nd a tree whose parsimony length is at
most two times worse than that of the most parsimonious tree. The solution
is based on the transformation to the minimum spanning tree problem.
ACCG
W 1 Z 1 0
1 2 3 4 ACGT CCGT
W A C G T 3 ACCT Y
1 0 ACCG
X A C C T 2 2
1 ACGT X
Y A C C G 1 ACCT
Y X 0
Z C C G T
ACCG 1 ACCT Z W
CCGT ACGT
S G(S) T
FIGURE 7.6: An example demonstrating the 2-approximation algorithm
for the large parsimony problem. Given the set of 4 taxa S, we construct the
graph G(S) and compute the minimum weight spanning tree T (bold edges
in G(S)). From T , we construct a phylogenetic tree leaf-labeled by the 4
taxa.
1 A spanning tree of G(S) is a tree which connects all nodes in G(S). The minimum spanning
tree is a spanning tree of the minimum weight. Such a tree can be found in polynomial
time. The current best solution runs in O(n(m, n)) time, where n and m are the number
of nodes and edges, respectively, in G(S). Note that (m, n) is the Ackermann function,
which is a very slow growing function.
Phylogeny Reconstruction 165
internal node labeled by taxa a with an unlabeled node and attaching a leaf
labeled by a as its child. Figure 7.6 shows an example. The running time
of this algorithm is dominated by the construction of the graph G(S), which
takes O(n2 m) time. The lemma below shows that the approximation ratio of
this algorithm is 2.
LEMMA 7.2
Let T be a minimum spanning tree of G(S). Then, the parsimony length of
T is at most twice that of the most parsimonious tree.
7.2.2 Compatibility
Compatibility is another method to reconstruct a phylogenetic tree. It
assumes that mutation is rare and most of the characters mutate at most
once in the history. More precisely, compatibility nds a phylogenetic tree
that maximizes the number of characters which have at most one mutation in
the tree. The following discussion focuses on binary characters, that is, each
character has two states 0 and 1 only.
We rst give some basic denitions. A binary character c is said to be
compatible to a leaf-labeled tree T if and only if there exists an assignment
of states to the internal nodes of T such that at most one edge in T has state
change. There is another way to express the compatibility property. If a
character c is compatible to a tree T , then there exists an edge (u, v) in T
such that the deletion of (u, v) partitions T into two subtrees where all leaves
in one subtree have state 0 while all leaves in another subtree have state 1.
Figure 7.7 shows two examples of leaf-labeled trees where one is compatible
while another one is incompatible.
Based on the concept of compatibility, perfect phylogeny can be dened
as follows. Consider a set S of n taxa; each is characterized by m binary
characters. The input can be expressed as an n m character-state matrix
166 Algorithms in Bioinformatics A Practical Introduction
0 01 1 0 10 1
FIGURE 7.7: The binary character in the left tree is compatible since we
can label the internal nodes so that there is only one state change. For the
right tree, the binary character is not compatible since there are at least two
state changes.
(0, 0, 0) T
M X1 X2 X3
(0, 0, 0)
Species 1 1 1 0 (0, 0, 1)
Species 2 0 0 1 (1, 0, 0)
Species 3 0 0 0 Species 3
Species 4 0 0 1
Species 2 Species 4
Species 5 1 0 0
Species 1 Species 5
the other. For example, in Figure 7.8, X1 and X2 are pairwise compatible
since O1 contains O2 . X1 and X3 are pairwise compatible since O1 and O3
are disjoint. Below is the key lemma for determining compatibility.
LEMMA 7.3
M admits a perfect phylogeny if and only if every pair of characters i and j
are pairwise compatible.
one leaf has state 0 while another leaf has state 1. By induction, suppose T
is a perfect phylogeny for M (i1) in phase i 1. We claim that Oi should be
a subset of N (i1) (r) for some row r in M (i1) . Then, the perfect phylogeny
for M (i) is formed by splitting the leaf r in T into two nodes u and v such
that N (i) (u) = Oi and N (i) (v) = N (i1) (r) Oi .
What remains is to prove the claim. Assume the taxa in Oi occur in both
N (i1) (r) and N (i1) (s) for some rows r and s in M (i1) . Since rows r and s
(i1)
are dierent in M (i1) , there exists some character j < i such that Mrj =0
(i1)
and Msj = 1. Hence, some taxa in Oi have state 0 while some taxa in Oi
have state 1 for the character j. Thus, Oi
Oj . On the other hand, since
|Oj | |Oi |, Oj
Oi . This means that Oi and Oj are neither disjoint nor
one contains the other. This contradicts the fact that i and j are pairwise
compatible.
LEMMA 7.4
If there exists some column j in L with two dierent nonzero entries, then M
does not admit a perfect phylogeny. Otherwise, M admits a perfect phylogeny.
PROOF Suppose Lij = x and Lkj = x where both x and x are non-
zero. Without loss of generality, x > x . Since Lij and Lkj are non-empty,
Phylogeny Reconstruction 169
M X1 X2 X3 L X1 X2 X3
Species 1 1 0 1 Species 1 -1 0 1
Species 2 0 1 0 Species 2 0 -1 0
Species 3 0 0 0 Species 3 0 0 0
Species 4 0 1 0 Species 4 0 -1 0
Species 5 1 0 0 Species 5 -1 0 0
FIGURE 7.9: An example demonstrates how to construct the matrix L
from M . Note that we arrange the characters in M so that |Oi | |Oi+1 |.
by denition, Mij = Mkj = 1. Since Lij = x and Lkj > x, Mix = 1 and
Mkx = 0. (See gure below.)
M x j
i 1 1
k 0 1
Thus, Oj contains taxa i and k and Ox contains taxon i, but not taxon k.
It means that (1) Oj Ox
= , (2) Oj is not a subset of Ox . Note that j > x.
Thus, |Ox | |Oj |. As k
Ox , Ox should contain some taxon which does not
appear in Oj . So, (3) Ox is not a subset of Oj . By (1) to (3) and applying
Lemma 7.3, M does not admit a perfect phylogeny.
Otherwise, for every character j, all nonzero entries Lij have the same value.
We claim that every pair of characters is pairwise compatible and hence, by
Lemma 7.3, M admits a perfect phylogeny. Below, we prove the claim. For
a particular character j, let k be the value of a nonzero entry Lij . Since
all nonzero entries Lij have the same value k, by denition, Oj Ok and
Op Oj = for k < p < j. Hence, character j is pairwise compatible with
any character p where k p < j. If k > 0, we apply the same principle and
set k as the value of a nonzero entry Lik . By the same argument, character
j is pairwise compatible with any character p where k p < k. By applying
this argument repeatedly until k = 1, we show that character j is pairwise
compatible with any character p where p < j.
1,5 1 5 3
1,2,3,4,5 1,5 2,3,4 3 2,4 1 5 3 2,4 2 4
Initial case character 1 character 2 character 3 final
G H
LEMMA 7.5
The clique problem can be transformed to the large compatibility problem in
polynomial time.
LEMMA 7.6
The large compatibility problem can be transformed to the clique problem in
polynomial time.
P r(r = 1, u = 0, a = 1, b = 0, c = 1 | T )
= P r(r = 1)P r(a = 1|r = 1)P r(u = 0|r = 1)P r(b = 0|u = 0)P r(c = 1|u = 0)
= 0.5(1 0.2)(0.1)(1 0.3)(0.4) = 0.0112
P r(u = iu u T |T )
= P r(r = ir ) (iu , iv )(1 p(u,v) ) + (1 (iu , iv ))p(u,v) (7.1)
(u,v)T
For example, for the tree in Figure 7.13, if the observed states of a particular
174 Algorithms in Bioinformatics A Practical Introduction
T r
a u
b c
FIGURE 7.13: Cavender-Felsenstein model.
The CF model also assumes all characters are independent. Hence, for a
character-state matrix M , the likelihood of T is
m
P r(M |T ) = P r(Mi |T ). (7.2)
i=1
Algorithm ComputeLikelihood(i, u)
if u is a leaf then
Compute and return {Li (u, 0), Li (u, 1)} using Equation 7.4;
else
Let v and w be the two children of u;
Call ComputeLikelihood(i, v) to compute {Li (v, 0), Li (v, 1)};
Call ComputeLikelihood(i, w) to compute {Li (w, 0), Li (w, 1)};
Compute and return {Li (u, 0), Li (u, 1)} using Equation 7.5;
end if
Based on Equations 7.4 and 7.5, we apply the algorithm in Figure 7.14 to
compute {Li (r, 0), Li (r, 1)} for every character i. Then, by Equation 7.3, we
compute P r(M | T ).
Now we analyze the time complexity. To compute {Li (r, 0), Li (r, 1)}, the
algorithm in Figure 7.14 needs to evaluate {Li (u, 0), Li (u, 1)} for every node
u according to Equation 7.5; each takes O(1) time. Since there are n nodes
and m characters, {Li (u, 0), Li (u, 1)} for all nodes u T can be computed
in O(mn) time. Then, P r(M | T ) can be computed in O(m) time using
Equation 7.3. The total running time is O(mn).
A B
e
C D
A C
e
B D A C
e
D B
Algorithm DNAml
Let S = {u1 , u2 , . . . , un } be the set of taxa.
Build the tree T for species {u1 , u2 }
for k = 3 to n do
Among all (2k 5) ways to insert uk into T , we choose the way with
the best likelihood.
if k 4 then
while there exists a nearest neighbor interchange (NNI) operation
which can improve the likelihood of T do
We apply such NNI on T ;
end while
end if
end for
principle, [103]). The method starts with a tree T with two taxa u1 and
u2 . Then, we attach taxa u3 , u4 , . . . , un into T one by one. When we at-
tach the k-th taxon uk , the tree T has 2k 5 edges. We try to attach uk
to each of these 2k 5 edges and evaluate the likelihood (the likelihood is
computed based on Section 7.2.3.2 and the mutation probability of an edge is
estimated using Lemma 7.8). The attachment yielding the highest likelihood
is accepted. Then, local rearrangements are carried out in T to see if any of
these improves the likelihood of the tree. The local rearrangement performed
is the nearest neighbor interchange (NNI). It exchanges two subtrees incident
across an internal edge in T . Figure 7.15 gives an example of two possible
NNI operations across an edge. If any NNI operation improves the likelihood,
it is accepted and the local rearrangement process continues until a tree is
found in which no local rearrangement can improve the likelihood. The detail
of the algorithm is presented in Figure 7.16.
In the algorithm in Figure 7.16, we need to estimate the mutation proba-
bility of an edge linking two subtrees (a subtree may be just a leaf). Consider
Phylogeny Reconstruction 177
u v
U V
two rooted phylogenetic trees U and V for two disjoint sets of taxa rooted
at u and v, respectively. Let T be the tree formed by connecting U and V
through the edge (u, v) (see Figure 7.17). Suppose Li (U, s) and Li (V, s) are
given for any character i and any s {0, 1}. The lemma below expresses the
maximum likelihood of T in term of p(u,v) . Then, the next lemma states how
to estimate the mutation probability p(u,v) .
LEMMA 7.7
Given the character-state matrix M and a model T = (T, {pe |e T }) where
T is as shown in Figure 7.17, the likelihood of T , P r(M |T ), equals
m
Li (U, s)Li (V, s)(1 p(u,v) ) + Li (U, s)Li (V, 1 s)p(u,v)
i=1 s{0,1} s{0,1}
p(u,v) if s
= s and (1 p(u,v) ) otherwise. Since P r(M |T ) = m i=1 P r(Mi |T ),
the lemma follows.
LEMMA 7.8
Given the character-state matrix M and a model T = (T, {pe |e T }) where
T is as shown in Figure 7.17, the mutation probability p = p(u,v) of the linking
edge (u, v) in T satises the following equation.
m
Ai Bi
f (p) = =0
i=1
B i (1 p) + Ai p
where Ai = s{0,1} [Li (U, s)Li (V, (1 s))], Bi = s{0,1} [Li (U, s)Li (V, s)].
Since f (p) is a decreasing function, f (p) = 0 can be solved by performing a
binary search.
PROOF By Lemma 7.7, P r(M |T ) = m i=1 (Bi (1 p) + Ai p). The log-
m
likelihood is ln P r(M |T ) = i=1 ln (Bi (1 p) + Ai p). To nd p which max-
178 Algorithms in Bioinformatics A Practical Introduction
LEMMA 7.9
For any edge e T , e = ln(1 2pe ).
PROOF Let ut be the state of the character after time t. Let be the
mutation probability at any point of time. Suppose Pt = P r(ut = 1|u0 = 1).
Then, P0 = 1. We have P1 = (1 ) and P2 = (1 )P1 + (1 P1 ). In
general, Pt+1 = (1 )Pt + (1 Pt ). Thus, Pt+1 Pt = (1 2Pt ) and we
have
dPt
= (1 2Pt )
dt
By solving the dierential equation, we have P r(ut = 1|u0 = 1) = Pt =
2t
2 (1 e
1
). Similarly, we can derive P r(ut = 0|u0 = 0) = Pt = 12 (1 e2t ).
Hence, P r(change|t) = P r(ut = 1 s|u0 = s) = 1 P r(ut = s|u0 = s) = 1
2t
1
2 (1e ). By solving the equation, we have t = 21
ln(12P r(change|t)).
1
As the constant 2 is just a scaling factor, we eliminate it. The lemma follows.
Look back at the matrix in Figure 7.18. It is symmetric and satises the
triangle inequality. Thus, it is a metric. In the following discussion, we will
further discuss two additional constraints for a distance matrix: additive and
ultrametric.
For every i, j S, Mij equals the sum of the edge weights along the
path from i to j in T .
7
e
4
1
M a b c d e 5 d
a 0 11 10 9 15 4
b 11 0 3 12 18
c 10 3 0 11 17 2 1
d 9 12 11 0 8
e 15 18 17 8 0 a b c
i
c
k
j
to a common center c (see Figure 7.19). The following lemma states the edge
weight of (c, i), (c, j), (c, k) can be uniquely determined.
LEMMA 7.10
Consider an additive matrix M . For any three taxa i, j and k, the corre-
sponding additive tree is unique. Its topology is as shown in Figure 7.19 and
the edge weights are:
Mij + Mik Mjk
dic = (7.6)
2
Mij + Mjk Mik
djc = (7.7)
2
Mik + Mjk Mij
dkc = (7.8)
2
PROOF Since M is additive, we have Mik = dic +dck , Mjk = djc +dck , and
Mij = dic + dcj . By solving the three equations, we obtain Equations (7.6)
(7.8). Since M satises triangle inequality, dic , djc , and dkc are positive.
i k
x y
j l
1. Mij equals the sum of the edge weights along the path from i to j in T ;
and
2. A root of the tree can be identied such that the distance to all leaves
from the root is the same, that is, the length is a xed value.
3 2
M a b c d e 3
4 5 5
a 0 8 8 14 14
b 8 0 2 14 14 1 1
c 8 2 0 14 14
d 14 14 14 0 10
e 14 14 14 10 0 a b c d e
FIGURE 7.21: An example of an ultrametric distance matrix and the cor-
responding phylogenetic tree.
For any node v in the ultrametric tree T , we dene height(v) to be the sum
of the edge weights along the path from v to any descendant leaf. We have
the following lemma.
LEMMA 7.11
Consider an ultrametric tree T corresponding to the ultrametric matrix M .
For any pair of leaves i, j, let v be the least common ancestor of i and j in T .
M
We have height(v) = 2ij .
Phylogeny Reconstruction 183
PROOF Let Mvi and Mvj be the length of the paths from v to i and
j, respectively. By denition, height(v) = Mvi = Mvj . Since T is additive,
Mij = Mvi + Mvj = 2height(v). Hence, the lemma follows.
x
y
i j k
FIGURE 7.22: Ultrametric tree.
184 Algorithms in Bioinformatics A Practical Introduction
The rest of this chapter will discuss solutions for these three problems.
The two identied clusters C1 and C2 are linked with a new root r to form
a bigger cluster C. Precisely, C consists of C1 , C2 , and two additional edges
(r, r1 ) and (r, r2 ), where r1 and r2 are the roots of C1 and C2 , respectively.
We dene height(C) = dist(C1 , C2 )/2. To ensure the average distance from
r to the leaves in C equals height(C), We set the edge weights d(r, r1 ) =
height(C) height(C1 ) and d(r, r2 ) = height(C) height(C2 ).
In the algorithm, once two clusters C1 and C2 are merged to form a bigger
cluster C, we need to compute dist(C, C ) for all other clusters C . The
simple method is to apply Equation 7.9 to compute dist(C, C ). However, it
is time consuming. To speed up, UPGMA computes dist(C, C ) based on the
following lemma.
LEMMA 7.12
Suppose C is a cluster formed by merging two clusters C1 and C2 . For all
Phylogeny Reconstruction 185
UPGMA algorithm
1: Set C = {{c1 }, {c2 }, . . . , {cn }} where height({ci }) = 0 for i
{1, . . . , n};
2: For all {ci }, {cj } C, set dist({ci }, {cj }) = Mij ;
3: for i = 2 to n do
4: Determine clusters Ci , Cj C such that dist(Ci , Cj ) is minimized;
5: Let Ck be a cluster formed by connecting Ci and Cj to the same
root;
6: Let height(Ck ) = dist(Ci , Cj )/2;
7: Let d(Ck , Ci ) = height(Ck ) height(Ci );
8: Let d(Ck , Cj ) = height(Ck ) height(Cj );
9: C = C {Ci , Cj } {Ck };
10: For all Cx C {Ck }, dene dist(Cx , Ck ) = dist(Ck , Cx ) =
|Ci |dist(Ci ,Cx )+|Cj |dist(Cj ,Cx )
(|Ci |+|Cj |) ;
11: end for
other clusters C ,
P P P
iC,jC Mij
Mij + iC ,jC Mij
iC1 ,jC
PROOF dist(C, C ) = |C||C | =
2
. As
P P |C||C |
iC1 ,jC Mij Mij
dist(C1 , C ) = |C1 ||C | and dist(C2 , C ) = iC2 ,jC
|C2 ||C | , the lemma
follows.
Figure 7.23 shows the detailed algorithm. The execution of the algorithm is
illustrated in Figure 7.24. The next lemma shows that if M is ultrametric, the
tree reconstructed by the UPGMA algorithm is in fact an ultrametric tree.
LEMMA 7.13
Suppose M is ultrametric. For any cluster C created by the UPGMA algo-
rithm, C is a valid ultrametric tree.
PROOF The UPGMA algorithm starts with a set of n leaves and each
leaf forms a cluster. Then, at the i-th iteration, a cluster Ci is created by
merging two clusters Ci,1 and Ci,2 created before the i-th iteration. We prove
by induction that Ci is a valid ultrametric tree and height(Ci ) height(Ci1 )
for any i.
186 Algorithms in Bioinformatics A Practical Introduction
M a b c d e
a 0 8 8 14 14
b 8 0 2 14 14 1 1
c 8 2 0 14 14 a b c d e a b c d e
d 14 14 14 0 10 Height=1
e 14 14 14 10 0
p
3 2
3 3 3
4
1 1
5 5 4 5 5 4
1 1 1 1
a b c d e a b c d e a b c d e
Height=7 Height=5 Height=4
At the 0-th iteration, since all n clusters are n leaves, every cluster is a valid
ultrametric tree of height 0.
Suppose, at the i-th iteration, Ci is a valid ultrametric tree. We rst show
that height(Ci+1 ) height(Ci ) by considering two cases.
Case 1: Ci
{Ci+1,1 , Ci+1,2 }. In this case, Ci+1,1 , Ci+1,2 , Ci,1 , Ci,2 are clus-
ters available at the i-th iteration. We select to merge Ci,1 and Ci,2
at the i-th iteration implies that dist(Ci+1,1 , Ci+1,2 ) dist(Ci,1 , Ci,2 ).
Hence, height(Ci+1 ) height(Ci ).
Case 2: Ci {Ci+1,1 , Ci+1,2 }. Without loss of generality, assume Ci =
Ci+1,1 . Then, Ci+1,2 , Ci,1 , Ci,2 are clusters available at the i-th it-
eration. We select to merge Ci,1 and Ci,2 at the i-th iteration im-
plies that dist(Ci,1 , Ci+1,2 ) dist(Ci,1 , Ci,2 ) and dist(Ci,2 , Ci+1,2 )
dist(Ci,1 , Ci,2 ). This implies that
both Ci+1,1 and Ci+1,2 are valid ultrametric trees, proving that the weights
of (r, r1 ) and (r, r2 ) are positive is sucient to ensure Ci+1 is a valid ul-
trametric tree. Since height(Ci+1 ) height(Ci ), we have height(Ci+1 )
height(Ci+1,1 ), height(Ci+1,2 ). Then, for j = 1, 2, the weight of the edge
(r, rj ) is height(Ci+1 ) height(Ci+1,j ) 0. The lemma follows.
For every edge of T , we check whether the k-th taxon splits the edge
188 Algorithms in Bioinformatics A Practical Introduction
i k
c cc
j h
using Lemma 7.10. Because the k-th taxon can only split exactly one
edge of T , the additive tree for the k taxa is unique.
M a b c d e
a 0 11 10 9 15
b 11 0 3 12 18
c 10 3 0 11 17
d 9 12 11 0 8 7 e
4
e 15 18 17 8 0 d 1
c c d
5 5
11 9 1 1 4
a b a a
2 4 5 2 2 1
b b
a b c
We now analyze the time complexity. The time complexity for checking if
a taxon should be attached to a particular edge requires O(1) time based on
Lemma 7.10. To attach a taxon into a tree with k leaves, we need to check
O(k) edges, which takes O(k) time. Therefore, to construct an additive tree
for n taxa, the time complexity is O(1 + 2 + . . . + n) = O(n2 ).
Phylogeny Reconstruction 189
Neighbor-Joining algorithm
1: Let Z = {{1}, {2}, , {n}} be the set of initial clusters;
2: For all {i}, {j} Z, set dist({i}, {j}) = Mij ;
3: for i = 2 to n do
4: For every cluster A Z, set uA = n2 1
DZ dist(D, A);
5: Find two clusters A, B Z which minimizes dist(A, B) uA uB ;
6: Let C be a new cluster formed by connecting A and B to the same
root r. Let rA and rB be the roots of A and B. The edge weights of
(r, rA ) and (r, rB ) are 12 dist(A, B) + 12 (uA uB ) and 12 dist(A, B) +
2 (uB uA ), respectively;
1
9: end for
n
SSQ(D) = (Dij Mij )2 .
i=1 j =i
that uA for all A Z can be computed in O(n2 ) time. Also, A and B which
minimize dist(A, B) uA uB can be found in O(n2 ) time. Afterward, we
merge A and B into a new cluster C and remove A and B from Z. Since
C is the new cluster added to Z, we need to update the pairwise distances
between C and all other clusters in Z. This step requires O(n) time. So, the
execution time of each iteration is O(n2 ). There are n 1 iterations. Hence
the time complexity of the neighbor-joining algorithm is O(n3 ).
Apart from the neighbor-joining method, the Fitch-Margoliash method [109]
and a number of other methods also assume the nearly additive tree is the tree
which minimizes the least square error. Moreover, there are other metrics for
dening the nearly additive tree. One example is the L -metric. The L -
metric for two distance matrices A and B is L (A, B) = maxi,j |Aij Bij |.
Based on the L metric, for a given non-additive matrix M , we have to nd
an additive matrix E such that L (M, E) is minimized. The problem of
minimizing the L metric is also NP-hard. However, Agarwala et al. [3] have
proposed a 3-approximation algorithm with respect to the L -metric which
runs in polynomial time.
1 2hij
log 1
2 m
7.4 Bootstrapping
Given a character-state matrix N , the tree generated by character-based
methods or distance-based methods may be unstable. In other words, remov-
ing or adding some characters may change the topology of the reconstructed
phylogenetic tree. Bootstrapping is proposed to reduce the instability.
Bootstrapping means sampling with replacement from the input. Consider
n taxa, each described by m characters. Through bootstrapping, we build
a set of character matrices where each character matrix Ni is formed by m
randomly selected characters (with replacement). For each Ni , a tree Ti can
be reconstructed using either a character-based method or a distance-based
method. For a character-based method, we directly reconstruct Ti from Ni
using the character-based method. For a distance-based method, we rst
build a distance matrix Mi from Ni as in Section 7.3.5 and reconstruct a tree
Ti using the distance-based method. By computing the consensus tree of all
Ti (see Section 8.4), we get a stable phylogenetic tree. Figure 7.28 illustrates
an example.
e a
d
b
c
c
a
d c 4 a
4 3
b
e d 4
2 4 b
c a
e 4
d
b
e
b a
d c
e
branches.
The above results showed that phylogenetic reconstruction methods can
correctly reconstruct the real evolution history. However, we still cannot
estimate accurately the length of the branches.
7.6 Exercises
1. For the following matrix M , can you nd the parsimony tree using the
approximation algorithm? Is this the maximum parsimony tree? If not,
what is the maximum parsimony tree?
M C1 C2 C3 C4
S1 1 0 1 1
S2 1 1 0 1
S3 0 1 1 0
2. Can you solve the large compatibility problem, that is, nd the largest
set of characters which admit the perfect phylogeny? Can you check if
the following matrix has a perfect phylogeny? If yes, can you report the
corresponding tree?
M C1 C2 C3 C4
S1 0 0 0 1
S2 1 1 0 0
S3 0 0 0 1
S4 0 1 1 0
S5 0 1 1 1
3. Consider the following tree topology for taxa {AC, CT, GT, AT }. Can
you compute the parsimony length? Also, can you give the correspond-
ing labeling for the internal nodes?
AC
AT
CT GT
194 Algorithms in Bioinformatics A Practical Introduction
4. For the above question, do we have another labeling for the internal
nodes such that we have the same parsimony length?
5. For the following character-state matrix M , can you describe how to
compute construct a phylogenetic tree using the approximation algo-
rithm in Section 7.2.1.2?
M C1 C2 C3
S1 0 0 1
S2 1 1 0
S3 1 0 1
S4 0 1 0
S5 0 1 1
C1 C2 C3
S1 0 0 1
S2 1 1 0
S3 0 0 1
S4 0 1 0
S5 0 1 1
c1 c2 c3 c4 c5
A ? 1 0 1 1
B 0 0 ? 0 0
C 1 ? 0 0 1
D 1 0 ? 0 0
E 0 1 1 1 ?
Phylogeny Reconstruction 195
12. Consider the following tree topology T . The value on the edge is the
mutation probability p. Can you compute (i) P r(a = 1, b = 0, c =
1, u = 1, r = 1 | T, p), (ii) P r(a = 1, b = 0, c = 1, u = 0, r = 0 | T, p),
(iii) P r(a = 1, b = 0, c = 1, u = 1, r = 0 | T, p), (iv) P r(a = 1, b = 0, c =
1, u = 0, r = 1 | T, p), and (v) P r(a = 1, b = 0, c = 1 | T, p)?
r
0.2 0.3
a=1 u
0.2 0.2
b=0 c=1
13. Consider the following tree topology T . The value on the edge is the mu-
tation probability p. Can you compute P r(a = 10, b = 01, c = 11|T, p)?
0.2 0.3
a=10 u
0.2 0.1
b=01 c=11
14. Compute a phylogenetic tree for the following set of DNA sequences
such that the total cost of your phylogenetic tree is at most twice that
of the optimal solution.
196 Algorithms in Bioinformatics A Practical Introduction
S1 = ACCGT
S2 = ACGTT
S3 = CCGTA
S4 = GTCCT
S5 = AGCTT
15. For the following matrix M , does it admit a perfect phylogeny? If not,
can you nd the minimum number of cells you need to ip so that M
admits a perfect phylogeny?
M 1 2 3 4
A 1 1 1 0
B 0 0 1 1
C 1 1 0 0
D 1 0 0 0
E 0 1 0 1
16. For the following matrix M, is it an ultrametric matrix? Can you con-
struct the corresponding ultrametric tree or the corresponding nearly
ultrametric tree?
M S1 S2 S3 S4 S5
S1 0 20 20 20 8
S2 0 16 16 20
S3 0 10 20
S4 0 20
S5 0
17. Is the following matrix additive? If not, give a reason. If yes, give the
additive tree.
S1 S2 S3 S4
S1 0 3 8 7
S2 0 7 6
S3 0 5
S4 0
18. (a) For the distance matrix below, is it an ultrametric? If yes, can you
construct the corresponding ultrametric tree? If not, is it an addi-
tive matrix? If yes, can you construct the corresponding additive
tree?
Phylogeny Reconstruction 197
S1 S2 S3 S4 S5 S6
S1 0 8 12 15 14 6
S2 0 12 13 12 8
S3 0 12 14 12
S4 0 13 15
S5 0 14
S6 0
19. Refer to the matrix in the above question. Suppose d(S4 , S3 ) (= d(S3 , S4 ))
is changed to 17. Is it ultrametric? If yes, can you construct the corre-
sponding ultrametric tree? If not, is it an additive matrix? If yes, can
you construct the corresponding additive tree?
A B C D E
A 0 10 9 16 8
B 0 15 22 8
C 0 13 13
D 0 20
E 0
21. For the following matrix M , can you construct the nearly additive tree
using neighbor joining?
M S1 S2 S3 S4 S5
S1 0 7 11 13 15
S2 0 12 14 18
S3 0 8 10
S4 0 5
S5 0
S1 =actgaatcgtact
S2 =cctgaatcgtact
S3 =actggtaatcact
S4 =actggtaatccct
8.1 Introduction
A phylogenetic tree models the evolutionary history for a set of species/taxa.
The previous chapter describes methods to construct phylogeny for the same
set of taxa. However, dierent phylogenetic trees are reconstructed in dierent
situations:
Dierent kinds of data: The data used to represent the same taxa/species
for tree reconstruction is not always the same, which will denitely lead
to dierent results. For example, dierent segments of the genomes are
used as the input to the tree reconstruction algorithm.
Surely, the resulting trees may agree in some parts and dier in others.
Tree comparison helps us to gain the similarity and dissimilarity information
from multiple trees. There are three computational problems related to tree
comparison.
199
200 Algorithms in Bioinformatics A Practical Introduction
Restricted on
X1, X3, X5 Simplify
x4 x5 x5 x5
x1 x2 x3 x1 x3 x1 x3
To derive a restricted subtree T |L, we remove all leaves not labeled by L and
contract all internal nodes with at most one child. Figure 8.1 illustrates this
process.
Given two phylogenetic trees T1 and T2 , T is called an agreement subtree
of T1 and T2 if T is a common restricted subtree derived from both trees. A
maximum agreement subtree (MAST) of T1 and T2 is an agreement subtree
Phylogeny Comparison 201
T1
x4 x5 x4 x5
x1 x2 x3 x1 x2
Simplify
T2 Restricted on x1 x2 x4 x5
x1, x2, x4, x5
Agreement
subtree of
x1 x2 x4 x1 x2 x4 T1 and T2
x5 x3 x5
of the two trees with the largest possible number of leaves [166]. Figure 8.2
illustrates an example. Note that if the MAST of T1 and T2 has more leaves,
T1 and T2 are considered to be more similar.
LEMMA 8.1
Let u and v be internal nodes in T1 and T2 , respectively. Let u1 and u2 be the
202 Algorithms in Bioinformatics A Practical Introduction
M AST (T1u, T2v ) = max{M AST (T1u1 , T2v ), M AST (T1u2 , T2v )}
M AST (T1u, T2v ) = max{M AST (T1u, T2v1 ), M AST (T1u, T2v2 )}
U Ue
x1 x4
e
rooted at
x1 x2 x4
x2 edge e
x5 x3 x5 x3
M AST (U1 , U2 ) can be computed in O(n1.5 log n) time [166]. This section
shows how can we transform the problem of nding the MAST of two unrooted
trees to the problem of nding the MAST of rooted trees.
For any unrooted tree U , for any edge e in U , we denote U e to be the rooted
tree rooted at the edge e. Figure 8.3 illustrates an example.
LEMMA 8.2
For any edge e of U1 , M AST (U1, U2 ) = max{M AST (U1e , U2f ) | f is an edge
of U2 }.
The above lemma reveals the relationship of the MAST between unrooted
trees and rooted trees. Using this lemma directly, the MAST of U1 and U2 can
be computed by executing the rooted MAST algorithm n times. Moreover,
there is some redundant computation in this nave method. By avoiding the
redundant computation, we can compute the MAST of two unrooted trees in
O(n1.5 log n) time [165].
c a
T1 d T2 e
x xc
y
a e b d
b c
FIGURE 8.4: Both the edge x in T1 and the edge x in T2 form the same
split {a, b, c}|{d, e}. Hence, both x and x are good edges. On the other hand,
y is a bad edge since there is no edge y in T2 such that both y and y form
the same split.
LEMMA 8.3
When both T1 and T2 are of degree-3, the number of bad edges in T1 with
respect to T2 is the same as the number of bad edges in T2 with respect to T1 .
Phylogeny Comparison 205
PROOF As both trees are of degree 3, we know that they have the same
number of edges. Also we know that the number of good edges in T1 with
respect to T2 equals the number of good edges in T2 with respect to T1 .
Since the number of bad edges equals the total number of edges minus the
number of good edges, the lemma follows.
LEMMA 8.4
The set of labels in any subtree of T1 forms a consecutive interval.
k H(k) 5
1 T1
2 2..3
3 1..3
4 1..4
1 2 3 4
LEMMA 8.5
If the intervals are stored in H according to the rules stated above, every entry
in H stores at most one interval.
For case 1, y should be the rightmost child of its parent. Hence, j ..i should
be stored in H[j ] instead. So we get a contradiction! For case 2, y should
be the leftmost child of x. Hence, i..j should be stored in H[j ] instead. We
arrive at a contradiction similarly. In conclusion, we can store at most one
interval in each entry in H.
1. minu and maxu to be the minimum and the maximum leaf labels in the
subtree of T2 rooted at u, respectively; and
Figure 8.7 shows the results of computing minu , maxu , and sizeu for the
internal nodes of T2 in Figure 8.5. If maxu minu + 1 = sizeu , then we
know that the leaf labels in the subtree of T2 rooted at u form a consecutive
interval minu ..maxu . Then we check whether H[minu ] or H[maxu ] equals
minu ..maxu . If yes, (u, v) is a good edge where v is the parent of u in T2 .
Figure 8.8 summarizes the pseudocode for Days algorithm. For time com-
plexity, Step 1 relabels the leaves, which takes O(n) time. For Steps 26,
the for-loop traverses O(n) nodes in T1 and stores the internal nodes of T1
in the hash table H[]. The processing time per node is O(1) time. Lastly,
in Steps 712, the for-loop processes every internal node in T2 and identies
good edges, which also requires O(n) time. In total, the time complexity is
O(n).
208 Algorithms in Bioinformatics A Practical Introduction
FIGURE 8.7: Compute the minimum and maximum leaf labels and the
number of leaves.
Days algorithm
1: Root T1 and T2 at the leaf labeled by the same taxa. Then, the
remaining n 1 leaves are relabeled so that they are in increasing
order in T1 . The leaves in T2 are also relabeled correspondingly.
2: Initialize the hash table H[1..n]
3: for every internal node u in T1 do
4: Let iu ..ju be the interval corresponding to u
5: If u is the leftmost child of its parent in T1 , set H[ju ] to be iu ..ju ;
otherwise, set H[iu ] to be iu ..ju .
6: end for
7: for every internal node u in T2 do
8: Compute minu , maxu , and sizeu
9: if maxu minu + 1 = sizeu then
10: if either H[minu ] or H[maxu ] equals minu ..maxu , (u, v) is a good
edge where v is the parent of u in T2
11: end if
12: end for
3 1 4
T1 4 4 T2 5
1 5 3 5 1
2
2 2 3
NNI-dist(T1, T2) = 2
LEMMA 8.6
NNI-dist(T1 , T2 ) = NNI-dist(T2 , T1 ).
LEMMA 8.7
NNI-dist(T1 , T2 ) number of bad edges in T1 with respect to T2
PROOF To remove one bad edge, we require at least one NNI operation.
Hence, the lemma follows.
210 Algorithms in Bioinformatics A Practical Introduction
STT distance: Given two unrooted degree-3 trees T1 and T2 , the STT
distance is dened as the minimum total cost of the STT operations
required to transfer T1 to T2 , which is denoted as STT-dist(T1 , T2 ).
LEMMA 8.8
STT-dist(T1 , T2 ) = NNI-dist(T1 , T2 ).
Phylogeny Comparison 211
w y w y
x z x z
Butterfly quartet Star quartet
FIGURE 8.11: Buttery quartet and star quartet.
Based on the above lemma, the STT-distance equals the NNI distance.
Therefore, computing the STT-dist(T1 , T2 ) is also an NP-hard problem. How-
ever, there also exists a polynomial time O(log n) approximation algorithm to
compute STT-dist(T1 , T2 ).
The brute-force algorithm takes at least O(n4 ) time to compute the quartet
distance. Ecient methods have been proposed. When both T1 and T2 are of
degree 3, Steel and Penny [271] gave an algorithm which runs in O(n3 ) time.
Bryant et al. [41] improved the time complexity to O(n2 ). Brodal et al. [36]
gave the current best solution, which runs in O(n log n) time. When both
T1 and T2 are arbitrary degree, Christiansen et al. [61] gave an O(n3 )-time
algorithm. The running time can be further improved to O(d2 n2 ) when the
degree of both trees is bounded by d.
Below, we describe the O(n3 )-time algorithm proposed by Christiansen et
al. [61]. We rst give an observation. Consider three leaves x, y, and z. For
each Ti , there exists a unique internal node ci in Ti such that ci appears in
any paths from x to y, y to z, and x to z. We denote ci as the center of
x, y, and z in Ti . Let Tix , Tiy , and Tiz be the three subtrees attached to ci
which contain x, y, and z, respectively. Let Tirest be Ti Tix Tiy Tiz . (See
Figure 8.12 for an illustration.) We have the following observations.
For every taxa w Tix {x}, the quartet for {w, x, y, z} in Ti is wx|yz.
For every taxa w Tiy {y}, the quartet for {w, x, y, z} in Ti is wy|xz.
For every taxa w Tiz {z}, the quartet for {w, x, y, z} in Ti is wz|xy.
For every taxa w Tirest , the quartet for {w, x, y, z} in Ti is a star
quartet.
Based on the above observations, the number of shared buttery quartets
involving x, y, z is |T1x T2x | + |T1y T2y | + |T1z T2z | 3. The number of shared
star quartets involving x, y, z is |T1rest T2rest |. In total, the number of shared
quartets involving x, y, z is Count(x, y, z), which equals
x y
Tx Ty
Tz
z
Second, to compute Count(x, y, z), we require the values |T1a T2b | for all
a, b {x, y, z}. Note that T1a and T2b are subtrees of T1 and T2 , respectively.
So, what we need is an ecient method to compute |R1 R2 | for all subtrees
R1 of T1 and all subtrees R2 of T2 . Since each Ti has O(n) subtrees, there
are O(n2 ) pairs of subtrees (R1 , R2 ). As every |R1 R2 | can be computed in
O(n) time, we can compute |R1 R2 | for all subtree pairs (R1 , R2 ) in O(n3 )
time. In fact, the method can be improved to compute these values in O(n2 )
time (see Exercise 13).
Figure 8.13 summarizes the algorithm for computing the quartet distance
between T1 and T2 . First, Step 1 computes the size of |R1 R2 | for all
subtree pairs (R1 , R2 ). This step takes O(n2 ) time. Then, Steps 312 compute
Count(x, y, z) for every three taxa x, y, z. Since there are n3 sets of {x, y, z}
and Count(x, y, z) can be computed in O(1) time, the running time is O(n3 ).
Last, we report the quartet distance in Step 13. The total running time of
the algorithm is O(n3 ).
We can compute the distance of two rooted trees by counting the num-
ber of dierent triplets. Such a distance is called the triplet distance (see
Exercise 10).
214 Algorithms in Bioinformatics A Practical Introduction
a b
d d b
d
c
e e
c c e
a
b a
T1 T2 T
For running time, the strict consensus tree of two trees Ri1 and Ti can be
computed in O(n) time as discussed earlier. Since the for-loop iterates m 1
times, the time complexity is O(mn).
216 Algorithms in Bioinformatics A Practical Introduction
a b e
d f b
c f c e c f
b e a d a d
T1 T2 T3
c b 3 d b 3 d
3 3 d 3 3
2 2
b 3 2 3 2 1
3 3 3 e 3
3 f 3
a 3
c 3 e c 3 3 f
f e
a a
T T' T"
LEMMA 8.9
Suppose p and c are any two splits in the majority rule consensus tree. There
exists a tree Tj which contains both splits p and c.
PROOF Both p and c appear in more than m/2 trees. By the pigeon-hole
principle, there exists a tree which contains both p and c.
Let C = {c1 , . . . , ck } be the set of splits (or edges) in the majority rule
consensus tree T of T = {T1 , T2 , . . . , Tm }. Suppose we root the consensus
tree T at the leaf 1, every split c C has a corresponding parent split P [c] in
T . Below, we describe an algorithm which compute the parent split P [c] for
every c C. The algorithm is based on the property of the above lemma, i.e.,
there exists at least one tree Ti which contain both splits c and P [c] for every
c C.
Require: A set of splits (or edges) C = {c1 , . . . , ck } which occur more than
m/2 times in T = {T1 , . . . , Tm }
Ensure: A majority rule consensus tree T rooted at the leaf 1
1: We root every tree Ti at the leaf 1.
2: For each Ti , we get Ti which is the tree formed by contracting all edges
whose do not belong to C.
3: For every split c C, initialize P [c] = .
4: For every split c C, let Bc be the partition of c which does not contain
the leaf 1.
5: for i = 1 to m do
6: for every edge c in Ti do
7: Let q be the parent edge of c in Ti .
8: if P [q] = or |Bc | > |BP [q] | then
9: P [q] = c.
10: end if
11: end for
12: end for
13: Construct the majority rule consensus tree according to the parent-child
relationship stated in P [].
By the above algorithm, we can construct the majority rule consensus tree
in O(nm) time. In total, the majority consensus tree can be constructed in
O(nm2 ) time.
218 Algorithms in Bioinformatics A Practical Introduction
As a nal note, the majority rule consensus tree can be built in O(nm)
expected time [11].
Let d(T1 , T2 ) be the symmetric dierence between T1 and T2 , that is, the
number of splits appearing in one tree but not the other. For example, for
T1 and T2 in Figure 8.14, {a, d, e}|{b, c} only appears in T1 and {a, c}|{b, d, e}
only appears in T2 . Hence, d(T 1 , T2 ) = 2. T is called the median tree for
T1 , T2 , . . . , Tm if it minimizes m
i=1 d(T, Ti ).
Note that the median consensus tree is not unique. Moreover, the majority
rule consensus tree is one of a median consensus tree [20]. Hence, a median
consensus tree can be built using the algorithm in Section 8.4.2.
Below we analyze the time complexity. Step 1 takes O(m2 n) time using
the Days algorithm. Since T has m trees and each tree has O(n) edges,
t O(nm). Step 2 can sort the t splits in O(nm) time using radix sort.
Checking if a split is compatible with T takes O(n) time. Hence, for Steps
4-8, the for-loop takes O(tn) = O(n2 m) time. In total, the greedy consensus
tree for T can be constructed in O(m2 n + n2 m) time.
Phylogeny Comparison 219
FIGURE 8.16: The number of triplets occur in the three trees T1 , T2 , and
T3 in Figure 8.17.
d d
c c c d
a b c d a b a b a b
T1 T2 T3 T
8.4.5 R Tree
Given a set of rooted trees T = {T1 , . . . , Tm }, this section describes the R
tree of T . The R tree is a consensus tree constructed from triplets of T . A
triplet is a restricted subtree (see Section 8.2) of any tree in T with respect
to three taxa. (Below, we use ab|c to represent a triplet where the lowest
common ancestor of a and b is a descendant of the lowest common ancestor
of a and c.) The R tree method tries to nd the set of triplets which is the
most commonly occurring in T ; then, the R tree is built from those most
commonly occurring triplets. Note that the R consensus tree always exists
and is unique. Also, the R consensus tree is a renement of the majority-rule
consensus tree.
As an example, consider three trees T1 , T2 , and T3 in Figure 8.17. Fig-
ure 8.16 lists the occurrences of those triplets. For {a, b, c}, the most frequent
triplet is ab|c. For {a, b, d}, the most frequent triplet is ab|d. For both {a, c, d}
and {b, c, d}, there is no frequent triplet. Hence, we set C = {ab|c, ab|d}. The
R tree which is consistent with the set C is shown in Figure 8.17.
By the denition, the R tree can be constructed using three steps as fol-
lows.
1: Compute the number of occurrences of all triplets in all m trees T1 , T2 , . . . ,
Tm .
2: For each set of three taxa, we identify the most commonly occurring triplet
in the m trees. Let C be the set of the most commonly occurring triplets.
3: Construct the tree which is consistent with all triplets in the set C and is
not consistent with any triplet not in C.
220 Algorithms in Bioinformatics A Practical Introduction
First, for the correctness of the algorithm, Steel [270] showed that there
always exists a tree which is consistent with all triplets in the set C and is
not consistent with any triplet not in C. Furthermore, such a tree is unique.
Hence, the algorithm can always report a unique R tree.
Below, we analyze the running time of the algorithm. For step 1, since
there are n3 triplets in each tree and there are m trees, it takes O(mn3 ) time
to count the number of occurrences of all triplets. Step 2 computes C, which
takes O(n3 ) time. Step 3 constructs a tree which is consistent with the set C.
By the triplet method, this step takes O(min{O(k log2 n), O(k + n2 log n)})
time [161] where k = |C| = O(n3 ). Hence, this step takes O(n3 ) time. In
total, the whole algorithm runs in O(mn3 ) time.
For the unrooted variant, a similar problem can be dened. Given a set of
unrooted trees T = {T1 , . . . , Tm }, we aim to construct a consensus tree, called
the Q* tree, from the set of quartets which are the most commonly occurring
in T . This problem can be solved similarly [29]. The running time of the
algorithm is O(mn4 ).
x5 + x4 x5
x4 x5
x1 x3 x2 x3 x1 x2 x3
Root
Leaf
Hybrid nodes
x4
x1 x2 x3
Each node has in-degree 1 or 2 (except the root) and out-degree at most
2. (Nodes with in-degree 2 are called hybrid nodes.)
8.6 Exercises
1. What is the maximum agreement subtree for T1 and T2 ? Is the maxi-
mum agreement subtree unique?
T1 T2
1 3 2 4 5 5 1 3 4 2
2. Given three rooted binary trees T1 , T2 , and T3 , can you give an algorithm
to compute mast(T1 , T2 , T3 )? What is the running time?
3 2
T1 4 T2 5
1 5 1 4
2 3
5 2
T1 4 T2 5
1 3 1 4
2 3
7. Given a set of trees T = {T1 , T2 , . . . , Tm }, can you prove that the strict
consensus tree of T always exists and is unique?
8. What are the strict consensus tree and the majority-rule consensus tree
of T1 , T2 , and T3 ?
5 5 5
4 4 2
3 2 4
1 2 1 3 1 3
9. Can you compute the R tree for the following three trees?
4 4 2
3 2 4
1 2 1 3 1 3
10. Given two rooted trees T1 and T2 leaf-labeled by the species set S,
the triplet distance is the number of subsets {x, y, z} S such that
T1 |{x, y, z}
= T2 |{x, y, z}. Suppose |S| = n, can you give an O(n2 )-time
algorithm to compute the triplet distance?
11. Given m unrooted degree-3 trees T1 , T2 , . . . , Tm leaf-labeled by S. Can
you propose an ecient algorithm to compute the number of subsets
224 Algorithms in Bioinformatics A Practical Introduction
9.1 Introduction
Before 1900, people only knew that species can evolve through mutations.
Then, in 1917, people discovered evidence of genome rearrangement. Sturte-
vant [276] showed that strains of Drosophila melanogaster coming from the
same or from distinct geographical locations may be dierent in having blocks
of genes rotated by 180. Such a rearrangement is known as reversal. In 1938,
Dobzhansky and Sturtevant [81] studied genes in chromosome 3 of Drosophila
miranda and 16 dierent strains of Drosophila pseudoobscura. They observed
that the 17 strains can be arranged as vertices in a tree where every edge
corresponds to one reversal. Hence, Dobzhansky and Sturtevant proposed
that species can evolve through genome rearrangements. In the 1980s, Jef-
frey Palmer and co-authors [227] studied the evolution of plant organelles by
comparing the gene order of mitochondrial genomes. They pioneered stud-
ies of the shortest (most parsimonious) rearrangement scenarios between two
genomes.
Evidents on genome rearrangements have been observed for higher organ-
isms. Humans and mice are highly similar in DNA sequences (98% in sequence
similarity). Moreover, their DNA segments are swapped. For example, chro-
mosome X in humans can be transformed to chromosome X in mice using
seven reversals.
In this chapter, we will study methods to compute the shortest series of
genome rearrangements to transform one genome to another.
225
226 Algorithms in Bioinformatics A Practical Introduction
Insertion A B C D E F G H I J K L
(a) Transposition
Deletion A B C D G H I E F J K L
(b) (e)
X1 Y1
A B C D E F G H I J K L X2 Y2
Reversal Translocation
A B -H -G -F -E -D -C I J K L X1 Y2
(c) X2 Y1
(f)
A B C D E F G H I J K L Fusion
(d) (h)
FIGURE 9.1: Various rearrangements: (a) insertion, (b) deletion, (c) re-
versal, (d) tandem repeat, (e) transposition, (f) translocation, (g) fusion, and
(h) ssion.
Transposition: Cutting out a DNA segment and inserting it into another lo-
cation (ABCD ACBD). This operation is believed to be rare since
it requires 3 breakpoints.
There are also rearrangements involving more than one chromosome, which
are listed as follows:
2, 4, 3, 5, 8, 7, 6, 1
2, 3, 4, 5, 8, 7, 6, 1
2, 3, 4, 5, 6, 7, 8, 1
8, 7, 6, 5, 4, 3, 2, 1
1, 2, 3, 4, 5, 6, 7, 8
4, 5, 3, 1, 2
1, 3, 5, 4, 2
1, 2, 4, 5, 3
1, 2, 3, 5, 4
1, 2, 3, 4, 5
Umin Umin
(a) (b)
LEMMA 9.1
If has a decreasing strip, there exists a reversal which reduces the number
of breakpoints by at least one, that is, b( ) b() 1.
PROOF Let smin be the decreasing strip in with the minimal element
min . Let smin be the strip containing min 1. smin must be increasing since
it contains some element smaller than min . Also, let min be the reversal
which merges smin and smin .
Depending on whether smin is to the right or to the left of smin , there are
two cases as shown in Figure 9.5. For both cases, the reversal min reduces
b() by 1.
230 Algorithms in Bioinformatics A Practical Introduction
Algorithm 4Approx-Unsigned-Reversal
1: while b() > 0 do
2: if there exists a decreasing strip then
3: we apply a reversal on as stated by Lemma 9.1;
4: else
5: reverse an increasing strip to create a decreasing strip;
6: end if
7: end while
Algorithm 2Approx-Unsigned-Reversal
1: If there exists no decreasing strip in , we reverse any increasing strip
in to create a decreasing strip.
2: while b() > 0 do
3: if min contains a decreasing strip then
4: We reverse by min ; // this reversal reduces b() by at least 1
5: else if max contains a decreasing strip then
6: We reverse by max ; // this reversal reduces b() by at least 1
7: else
8: We reverse by max = min ; // this reversal reduces b() by 2
9: Reverse any increasing strip in to create a decreasing strip.
10: end if
11: end while
LEMMA 9.2
Consider a permutation that has a decreasing strip. Suppose both min
and max contain no decreasing strip. Then, the reversal min = max
removes 2 breakpoints.
PROOF smin must be to the left of smin . Otherwise, after the reversal,
we still maintain a decreasing strip (see Figure 9.5). Similarly, smax must be
to the left of smax .
If smin is to the left (or right) of both smax and smax , after the reversal
max , we still have a decreasing strip smin . Similarly, if smax is to the left (or
right) of both smin and smin , after the reversal min , we still have a decreasing
strip smax .
If smax is in between smin and smin , after the reversal min , smax becomes
a decreasing strip. Similarly, if smin is in between smax and smax , after the
reversal max , smin becomes a decreasing strip.
Hence, the only possible arrangement such that there is no decreasing strip
after performing either min or max is that smin , smax , smin , and smax are
in left to right order.
We claim that there is no element between smin and smax . If there is a
decreasing strip in between, after the reversal max , such a decreasing strip
still remains. If there is an increasing strip in between, after the reversal min ,
such an increasing strip becomes decreasing. Similarly, we can show that there
is no element between smin and smax . Therefore, the reversals min and max
are the same and reversing min = max removes two breakpoints.
Figure 9.7 presents an algorithm based on Lemma 9.2. The algorithm will
232 Algorithms in Bioinformatics A Practical Introduction
Can we get a better upper bound for d()? Before we answer this question,
we rst discuss the Burnt Pancake Problem, which was introduced by Gates1
and Papadimitriou [117]. This problem is dened as follows.
Heydari and Sudborough [144] showed that the number of ips to sort
the pancakes is at most 3(n + 1)/2. Note that the stack of n pancakes can
be modeled as a signed permutation. Each burnt pancake can be modeled
as a signed integer and the ordering of burnt pancakes can be modeled as a
permutation of signed integers. A ip can be modeled as a prex reversal. The
burnt pancake problem is thus equivalent to sorting a signed permutation by
prex reversals. Hence, the reversal distance for sorting a signed permutation
by prex reversal is at most 3(n + 1)/2. Since prex reversal is a kind of
reversal, we conclude that, given a signed permutation ,
3
d() (n + 1).
2
1 This is the only research paper published by Bill Gates when he was studying at Harvard.
234 Algorithms in Bioinformatics A Practical Introduction
0 -2 -1 4 3 5 -8 6 7 9
I0 I5
I1 I6
I2 I7
I3 I8
I4
Note that every point meets exactly two elementary intervals. Hence, the el-
ementary intervals form disjoint cycles. For the example shown in Figure 9.10,
there are four cycles where two cycles are isolated intervals containing no el-
ement. For another example, the identity permutation has n cycles where all
of them are isolated intervals.
An elementary interval Ik is oriented if the signs of k and k + 1 are dierent;
otherwise, it is unoriented. For example, in Figure 9.10, the intervals I0 , I2 ,
I7 , and I8 are oriented. Below lemma states that the reversal of an oriented
interval reduces the number of breakpoints and increases the number of cycles.
LEMMA 9.3
Reversing an oriented interval reduces the number of breakpoints and increases
the number of cycles by one. The new cycle is an isolated interval (interval
contains no element).
Reversal
(a)
Reversal
(b)
Reversal
(c)
LEMMA 9.4
Reversing any interval in modies the number of cycles by +1, 0, or 1.
Case 2: One cycle passing through v and v . In this case, we will either
maintain one cycle or break the cycle into two. Hence, the number of
cycles is either increased by 1 (see Figure 9.12(b)) or does not change
(see Figure 9.12(c)).
236 Algorithms in Bioinformatics A Practical Introduction
(0..4) (7..16)
(4..7)
Based on the previous lemma, we can give a lower bound for the reversal
distance of .
LEMMA 9.5
Given a signed permutation of {0, 1, . . . , n}, d() n c where c is the
number of cycles in .
9.5.2.2 Components
For any i < j, an interval in which is called a component if
1. the interval either (1) starts from i and ends at j or (2) starts from j
and ends at i.
LEMMA 9.6
Two dierent components of a permutation are either disjointed, nested with
dierent endpoints, or overlapping on one element.
Genome Rearrangement 237
For example, in Figure 9.13, (2.. 1) and (5..9) are disjoint, (0..5) and
(5..9) overlap on one element, and (6..7) is nested within (5..9).
When two components overlap on one element, they are said to be linked.
Successive linked components form a chain. A maximal chain is a chain that
cannot be extended. (It may consist of a single component.) The relationship
among components can be represented as a tree T as follows. (See Figure 9.13
for an example.)
LEMMA 9.7
For every elementary interval, its two endpoints belong to the same compo-
nent.
COROLLARY 9.1
For any cycle, the endpoints of the elementary intervals on the cycle belong
to the same component.
THEOREM 9.1
Reversing the oriented interval I of maximal score does not create new unori-
ented components.
PROOF Note that once we perform the reversal for I, the signs of the
elements within the interval I will change. For any elementary interval Ik ,
the orientation of Ik will be changed if either k or k + 1 (but not both) is
within I. In this case, we say Ik intersects with I.
Suppose reversing the oriented interval I introduces a new unoriented com-
ponent C. Then, there exists an oriented interval I , which intersects with I,
belongs to C.
Let T be the total number of oriented intervals in . We denote U and
O be the number of oriented and unoriented intervals, respectively, in
Genome Rearrangement 239
COROLLARY 9.2
Given a signed permutation with c cycles and no unoriented component, the
reversal distance d() = n c. Bergerons algorithm can transform to the
identity permutation using d() reversals.
PROOF Theorem 9.1 guarantees that every iteration must have either
some oriented intervals or only have isolated cycles. Hence, the algorithm
reports a sequence of reversals which transforms to the identity permutation.
We claim that this list of reversals is optimal. Let c be the number of cycles in
. By Lemma 9.3, since every oriented reversal will generate one additional
cycle, after n c oriented reversals, we get n cycles, which is an identity
permutation. This implies d() n c. As d() n c (see Lemma 9.5),
the claim is proved.
For example, in 3 , we should not select (+0, 1). Otherwise, we get zero
oriented intervals and the algorithm stops.
LEMMA 9.8
For an unoriented component C, reversing any interval whose endpoints are
within C will not split or create any cycle. Moreover, it will make C oriented.
(Note that reversing an elementary interval in C, which is a cut operation, is
a special case of this lemma.)
PROOF Assume we reverse the interval (a..b) where both the left point of
a and the right point of b are endpoints within C. Furthermore, we assume the
left point of a and the right point of b are points in the same cycle. Otherwise,
Genome Rearrangement 241
LEMMA 9.9
If a reversal has its two endpoints in dierent components A and B (that is
a merge operation), then only the components on the path from A to B in T
are aected. In particular,
1. If a component C contains either A or B but not both, it will be destroyed
after the reversal.
2. If the lowest common ancestor of A and B in T is a component C, if
A or B is unoriented, then C becomes oriented after the reversal.
3. If the lowest common ancestor of A and B in T is a chain C, a new
component D is created. If A or B is unoriented, D will be oriented.
PROOF For (1), after the reversal, one of the bounding elements of C
will change sign, but not the other. Hence, the component is destroyed.
For (2), suppose A is unoriented. The reversal changes the sign of one
bounding element of A and introduces one oriented interval. This oriented
interval belongs to C since (1) implies that the component A and all com-
ponents in the path between A and C excluding C are destroyed. Hence, C
becomes oriented.
For (3), suppose A and B are included in the components A and B in the
chain C. Without loss of generality, assume A = (a..a ) precedes B = (b..b ).
After the reversal, the components A and B will be destroyed and a new
component D = (a..b ) will be created. Similar to (2), if A is unoriented, the
reversal changes the sign of one bounding element of A, which introduces one
oriented interval in D. Hence, D becomes oriented.
The above lemma implies that merging two unoriented components A and
B destroys or orients components on the path between A and B in T , without
creating new unoriented components.
Before proving the Hannenhalli-Pevzner Theorem, we rst dene the cover
of T . A cover C of T is a collection of paths joining all the unoriented
242 Algorithms in Bioinformatics A Practical Introduction
Figure 9.15 shows the algorithm for computing the signed reversal distance.
The algorithm for generating the sequence of reversals is shown in Figure 9.16.
Below lemma states their time complexity.
LEMMA 9.10
Algorithms Signed Reversal Distance and Sort Signed Reversal run in O(n)
Genome Rearrangement 243
9.7 Exercises
1. Consider the permutation = (1, 8, 9, 4, 3, 2, 5, 6, 7, 11, 10, 12). Using
the 2-approximation algorithm, what is the number of unsigned reversals
required to transform it to an identity permutation? Is this optimal?
(a) What is the set of elementary intervals? Which intervals are ori-
ented?
(b) What are the cycles?
(c) What are the components? Are the components oriented?
(d) Can you compute the optimal sequence of reversals?
10.1 Introduction
Although every cell of an organism has exactly the same genome, dierent
cells express a dierent set of genes to form dierent types of tissues. How
does a cell know what genes are required and when they should express?
In the 1960s, Jacob and Monod [160]uncovered this mystery. They showed
that bacteria make an inhibitor to keep -galactosidase production turned o.
Without the inhibitor, the -galactosidase production will turn on. This is
the rst evidence that certain types of genes provide instruction to control
the expression of other genes.
The process of controlling the expression of genes is known as gene regu-
lation. Gene regulation dictates when, where (in what tissue(s)), and how
much of a particular protein is produced. This decides the development of
cells and their responses to external stimuli. The most direct control mech-
anism is transcription regulation, which controls whether the transcription
process of a gene should be initiated. In eukaryotic cells, RNA-polymerase II
is responsible for the transcription process. However, it is incapable of ini-
tiating transcription on its own. It does so with the assistance of a number
of DNA-binding proteins called transcription factors (TFs). TFs bind the
DNA sequence and interact to form a pre-initiation complex (PIC). RNA-
polymerase II is recruited in the PIC, and then the transcription begins (see
Figure 10.1). The crucial point of the regulation mechanism is the binding of
TFs to DNA. Disruptions in gene regulation are often linked to a failure of TF
binding, either due to mutation of the DNA binding site, or due to mutation
of the TF itself.
The DNA sites that are bound by TFs are called transcription factor binding
sites (TFBS). People observed that the binding sites for the same TF contain
similar DNA sequences of length 520 bp. Such a recurring DNA pattern is
known as a motif. For example, one of the earliest discovered TFs is TATA-
box binding protein (TBP) and its motif is TATAAA.
Although the binding sites are sequence specic, interestingly, not all bases
are found to be equally important for eective binding. While some base po-
sitions can be substituted without aecting the anity of the binding, base
substitution in other positions can completely obliterate the binding. For ex-
247
248 Algorithms in Bioinformatics A Practical Introduction
promoter gene
FIGURE 10.1: The TFs bind the DNA sequence to form a pre-initiation
complex (PIC), which recruits RNA-polymerase II to initiate the transcrip-
tion. Missing of the binding of the TFs may prevent the recruitment of RNA-
polymerase II, which stops the transcription.
ample, for TATAAA, substituting A at the fth position to T may not aect
the binding anity by a lot; however, substituting A at the last position to
T may severely aect the binding.
As identifying the binding motifs of TFs is important for understanding the
regulation mechanism, this chapter focuses on methods of discovering a DNA
motif. We assume a set S of regulatory sequences is given. Our task is to nd
a DNA motif, which is the recurring pattern in S.
FIGURE 10.2: The locations of gene coding and noncoding regions and
the promoter in a DNA strand. The promoter region is present surrounding
the start of (and mostly upstream of) the transcription region. Other elements
such as enhancers may be present far from the transcription start site. (See
color insert after page 270.)
(a)
(b)
(c)
FIGURE 10.3: The ChIP process: (a) A genome with binding of dierent
transcription factors (TFs). (b) After shearing, we partition the genome into
many small fragments. (c) Using the antibody for the square TF, we extract
all DNA segments that are bound by the square TF.
TTGACA
TCGACA Consensus
TTGACA Pattern
TTGAAA
TTGACA
ATGACA
TTGACA Positional alignment position
nucleotide 1 2 3 4 5 6
GTGACA Weight
A 0.1 0 0 1 0.1 0.8
Matrix (PWM)
TTGACT C 0 0.1 0 0 0.9 0.1
TTGACC G 0.1 0 1 0 0 0
T 0.8 0.9 0 0 0 0.1
TTGACA
FIGURE 10.6: The sequence logo for the PWM in Figure 10.5. (See color
insert after page 270.)
Zhou and Liu [319] incorporate pairwise dependencies into the motif model.
Barash et al. [19] use a Bayesian network to model a motif, allowing arbitrary
dependencies between positions. Hong et al. [153] represent the motif using
boosted classiers. Xing et al. [313] represent the motif using a hidden Markov
Dirichlet multinomial model.
Although incorporating position dependencies improves the motif model, it
is also easier to over-t the model. Benos et al. [23] observed that in reality,
the PWM and the consensus sequence usually provide a good approximation.
Hence, this chapter assumes motifs are represented as the PWM and the
consensus motif.
Due to extensive research, many TF motifs are known. There exist biologi-
cal databases of known TF motifs, for example, the TRANSFAC database [309]
and the JASPAR database [255]. The databases usually represent the TF mo-
tifs using the PWM and the consensus motif model.
Input: A set of DNA sequences that are possibly bound by the same tran-
scription factor. Such sequences can be obtained using experimental
techniques described in Section 10.2.
Aim: We aim to search for the common binding pattern called the motif,
which is represented by the consensus sequence or the PWM.
For example, Figure 10.7 shows a set of sequences. The consensus motif is
T T GACA.
GCACGCGGTATCGTTAGCTTGACAATGAAGACCCCCGCTCGACAGGAAT
GCATACTTTGACACTGACTTCGCTTCTTTAATGTTTAATGAAACATGCG
CCCTCTGGAAATTAGTGCGGTCTCACAACCCGAGGAATGACCAAAGTTG
GTATTGAAAGTAAGTAGATGGTGATCCCCATGACACCAAAGATGCTAAG
CAACGCTCAGGCAACGTTGACAGGTGACACGTTGACTGCGGCCTCCTGC
GTCTCTTGACCGCTTAATCCTAAAGGGAGCTATTAGTATCCGCACATGT
GAACAGGAGCGCGAGAAAGCAATTGAAGCGAAGTTGACACCTAATAACT
of the motif is P [i]) equals [P [i], i]. Hence, we dene the likelihood score of
as i=1 [P [i], i]. For example, for the PWM in Figure 10.5 and a sequence
P = T T GACA, the likelihood score is (0.8 0.9 1 1 0.9 0.8).
Consider a sequence S of length n, a PWM of length , and a threshold
. The motif scanning problem is to scan S to nd all length- substrings P
of S such that the likelihood score of P is bigger than .
A standard solution is to scan the sequence S and to compute the likelihood
score of all length- substrings P one by one. This method takes O(n) time.
Here, we describe how to use the sux tree (see Chapter 3) to speed up
the scanning process [207]. Observe that if two length- substrings P and
Q in S share the same length- prex (that is, P [1.. ] = Q[1.. ]), then the
product of the frequencies of the rst characters are the same, that is,
i=1 [P [i], i] = i=1 [Q[i], i]. Sux tree allows us to avoid the redundant
computation.
Let T be the sux tree for the sequence S. For every node v in T whose
path label is v1 , . . . , v = vk , we denote D[v] = ki=1 [vi , i]. Our aim is to
compute D[v] for all nodes v in T of depth . Note that we have the recursive
formula D[v] = D[u] [v, k] where u is the parent of v and v is of depth
k. Hence, by traversing T in the top-down order and applying the recursive
formula for D[v], we can compute D[v] for every node v of depth . Finally,
for every node v of depth where D[v] > , the corresponding path label of
v is the occurrence of the motif .
The time complexity includes the construction time for the sux tree T ,
which is O(n), plus O(c) where c is the number of nodes in T of depth at
most . Note that c is upper bounded by min{n, 4 }.
We can further speed up the process by pruning. For any node v of depth
smaller than , when D[v] < , we dont need to traverse down the tree since
D[u] must be smaller than the threshold for all descendants u of v in T .
As a nal note, since the likelihood score is usually small, people use the
log likelihood score instead in practice. Precisely, for the PWM motif
and a length- pattern P , the log likelihood score is log(i=1 [P [i], i]) =
i=1 log [P [i], i].
4 1 2 3 4 5 40
A 0.2 0.8 0.1 0.7 0.8 A 0.25
C 0 0.1 0.2 0 0.1 C 0.25
G 0.1 0.1 0.1 0.2 0.1 G 0.25
T 0.7 0 0.6 0.1 0 T 0.25
Now, we analyze the running time of the Gibbs motif sampling algorithm.
Let m be the average length of the sequences in S. Each iteration of the Gibbs
motif sampling algorithm is dominated by Step 6, which takes O(m) time.
The number of iterations is approximately linear to the number of sequences
n and a factor T which is expected to grow with increasing m. For typical
protein sequences, T 100. Hence, the approximate running time of the
Gibbs motif sampling algorithm is O(nmT ).
As a nal note, the Gibbs motif sampler gives dierent results for dierent
runs. In practice, the motif is chosen from the best out of a number of runs.
Also, there are various variants of the standard Gibbs sampling approach.
These include AlignACE [250] and BioProspector [193].
Motif Finding 257
10.6.2 MEME
Multiple EM for Motif Elicitation (MEME) [18] is a popular software for
nding motifs. It is based on expectation maximization, which was originally
proposed by Lawrence and Reilly [183]. MEME breaks the input sequences
into a set of length- overlapping substrings X = {X1 , . . . , Xn }. It assumes
X is a mixture of length- substrings where 100% and 100(1 )% of them
are generated from the motif model and the background model, respectively.
Similar to Gibbs sampling, the motif model is represented by a length- PWM
while the background model is represented by a length-1 PWM 0 .
The aim of MEME is to nd the motif model , the background model
0 , and the proportion which best explain the input sequence. Precisely,
let P r(Xi | , 0 , ) be the probability that Xi is generated by the model
(, 0 , ) and P r(X | , 0 , ) = ni=1 P r(Xi | , 0 , ). Our aim is to nd
(, 0 , ) which maximizes P r(X | , 0 , ) or its log likelihood log P r(X |
, 0 , ), which is,
n
n
log P r(Xi | , 0 , ) = (log(P r(Xi |) + (1 )P r(Xi |0 )))
i=1 i=1
Figures 10.10 and 10.11 demonstrate the expectation step and the maximiza-
tion step, respectively.
Figure 10.12 gives the algorithm of MEME. Steps 1 and 2 generate an
initial motif and background. Then, it repeats the expectation step (Step 4)
and the maximization step (Steps 57) to improve the motif until it cannot
be improved or a certain number of iterations has been reached.
258 Algorithms in Bioinformatics A Practical Introduction
TGATATAACGATC
4 1 2 3 4 5 40
X1=TGATA p1
X2= GATAT p2 A 0.2 0.8 0.1 0.7 0.8 A 0.25
X3= ATATA p3 C 0 0.1 0.2 0 0.1 C 0.25
X4= TATAA p4 G 0.1 0.1 0.1 0.2 0.1 G 0.25
X5= ATAAC p5 T 0.7 0 0.6 0.1 0 T 0.25
X6= TAACG p6
X7= AACGA p7 p1 = Pr(TGATA|4)O
X8= ACGAT p8 Pr(TGATA|4)O+Pr(TGATA|40)(1-O)
X9= CGATC p9
= 0.00056O / (0.00056O+0.255(1-O))
p1 TGATA
O =(6 pi)/9
p2 GATAT
p3 ATATA
p4 TATAA 4[T,1]= p1+p4+p6
p5 ATAAC p1+p2++p9
p6 TAACG
p7 AACGA 40[C]= (1-p5)+(1-p6)+(1-p7)+(1-p8)+2(1-p9)
p8 ACGAT 5((1-p1)+(1-p2)++(1-p9))
p9 CGATC
MEME algorithm
Require: A set of X = {X1 , X2 , . . . , Xn } of length- sequences
Ensure: A PWM motif of width .
1: Randomly choose a parameter 0 < < 1 and let Z be a random
subset of X with n sequences.
2: Create a PWM from all patterns in Z and 0 from X Z.
3: while the motif is not good enough do
4: For every Xi X , set
P r(Xi |)
pi =
P r(Xi |) + (1 )P r(Xi |0 )
n
5: = n1 i=1 pi .
6: For every j = 1.. and every x {A, C, G, T },
{pi | Xi [j] = x, i = 1, 2, . . . , n}
[x, j] =
pi
8: end while
We now analyze the running time of MEME. For each iteration of the EM
algorithm, both the expectation and the maximization steps take O(n) time.
The number of iterations is approximately the size of X . Hence, the running
time of the EM algorithm is O(n2 ) time.
The previous section discussed statistical approaches for motif nding. This
section describes the combinatorial approaches. The combinatorial approach
nds short patterns (of length ) which are over-represented in the input
sequences, allowing small number (says, d) of mismatches. Pevzner and
Sze [237] proposed to formulate the problem as follows. Given a set S =
{S1 , S2 , . . . , Sm } of m sequences, each of length n. We also have two integer
parameters and d where d < < n. A length- pattern M is said to be an
(, d)-motif in a sequence Si if there exists a length- substring of Si which
has at most d mismatches from M . Our aim is to nd a (, d)-motif M which
occurs in as many sequences in S as possible. Figure 10.13 demonstrates an
example. Note that the problem of identifying (, d)-motifs occurring in a set
S of sequences is NP-hard. Below, we discuss various approaches to resolve
this problem.
tagtactaggtcggactcgcgtcttgccgc
caaggtccggctctcatattcaacggttcg
tacgcgccaaaggcggggctcgcatccggc
acctctgtgacgtctcaggtcgggctctcaa
Pattern-driven algorithm
Require: A set of m sequences S = {S1 , S2 , . . . , Sm }, each of length n
and two integer parameters and d m
Ensure: An (, d)-motif Mopt which minimizes i=1 Score(Si , Mopt )
1: Scoreopt =
2: for every length- pattern M from AA . . . A to T T . . . T do
3: Score = 0
4: for i = 1 to m do
5: if (Si , M ) > d, try another pattern
6: Score = Score + (Si , M )
7: end for
8: if Score < Scoreopt then
9: Mopt = M and Scoreopt = Score
10: end if
11: end for
12: Report Mopt
SpellModel(M, OccM )
1: if M is of length then
2: Report M
3: end if
4: for {a, c, g, t} do
5: #occ = 0, OccM =
6: for every M OccM do
7: for the rst character in every outgoing edge of u(M ) in T do
8: Let Leave be the number of leaves under node u(M )
9: if = then
10: OccM = OccM {M }
11: #occ = #occ + Leave
12: else if the number of mismatches between M and M < d
then
13: OccM = OccM {M }
14: #occ = #occ + Leave
15: end if
16: end for
17: end for
18: if #occ q then
19: SpellModel(M , OccM )
20: end if
21: end for
FIGURE 10.16: The sux tree-based algorithm. Let T be the sux tree
of S. By calling SpellModel(, {}) where is an empty string, we can extract
all (, d)-motifs in S with at least q occurrences.
Motif Finding 265
c t
% # $ a
g
4 5 6 c
g g % $
a
6
gc c
# t
3
t t c tc t tc
$ $ # % $ # % $ #
1 2 1 4 1 3 2 2 4 3
FIGURE 10.17: The gure shows the generalized sux tree for S1 =
aacgt$, S2 = acgc#, and S3 = cct%. The boxes correspond to the leaves
in the sux tree. The normal leaf boxes correspond to S1 ; the leaf boxes
with underlined integers correspond to S2 ; and the leaf boxes with a gray
background correspond to S3 .
observing the motif relative to the background model. The relative entropy
fb,i
is dened as D(M |0 ) = i=1 f
b{a,c,g,t} b,i ln pb , where fb,i is the
frequency of the base b at position i of the motif and pb is the frequency of
the base b in the background model.
ANN-Spec [311] and Weeder [230] use the sequence specicity score, which
tries to maximize the number of sequences containing the motif. In other
words, if a prediction gives multiple sites of the motif in one sequence and
none in the other sequences, it is much less signicant than a prediction which
gives
m a balanced number of sites in each sequence. The score is dened as
i=1 log(1/Ei (M |0 )) where Ei (M |0 ) is the expected number of motif M
occurring in sequence Si according to the background model.
a group of motifs predicted by multiple motif nders such that those motifs
are similar among themselves while dierent from the rest of the predicted
motifs; then, a motif is derived through analyzing the predicted binding sites
of those motifs. In this section, we detail the algorithm of MotifVoter.
|X|2 sim(X)
(sim(x, y) sim(X))2
x,yX
The function w(X) measures the degree of similarity among the candidate
motifs in X. If many candidate motifs in X approximate the real motif, w(X)
is expected to be high. On the other hand, we expect that the complement of
X, that is P X, should have a low w(P X). Thus w(P X) constitutes
the discriminative criterion in the clustering procedure. In other words, if X
is the set of candidate motifs which approximate the real motif, we expect to
have a high A(X) score, where:
w(X)
A(X) =
w(P X)
Note that there may be multiple sets of X with the same A(X) score.
Among those Xs, we would select the one that contains as many motif nders
as possible. The latter constitutes the consensus criterion.
In summary, this stage aims to nd X P which maximizes A(X) while
X contains the candidate motifs predicted by the maximum number of motif
nders. The nave method to identify X is to enumerate all possible Xs
and check if they satisfy the above two criteria. However, this approach is
computationally infeasible. Below, we propose a heuristic to identify X.
The detail of the heuristic algorithm is shown in Figure 10.18. Let P be all
motifs found by the m motif nders, where each motif nder returns n motifs.
Steps 13 compute the pairwise similarity scores for all pairs of motifs. Based
on these similarity scores, the following heuristic is applied to nd X (Steps
49).
270 Algorithms in Bioinformatics A Practical Introduction
Algorithm MotifVoter
Require: A set P of k candidate motifs
Ensure: a PWM motif
1: for each z, y P do
2: compute sim(z, y)
3: end for
4: for each z P do
5: sort p1 , p2 , . . . , pk such that sim(z, pi ) sim(z, pi+1 ); i = 1..k
6: consider sets Xz,j = {z, p1 , . . . , pj }; j = 1, . . . , k
7: compute A(Xz,j ) for all such Xz,j
8: set Q(Xz,j ) = number of motif nders contributing to Xz,j
9: end for
10: set X = Xz,j with the maximum A(Xz,j ) score, if there are two such
Xz,j s, pick the one with the largest Q(Xz,j )
11: extract and align sites of motifs in X
12: construct PWM
Figure 1.8 The structure of a double-stranded DNA. The two strands show a complemen-
tary base-pairing.
C
A
T
G 10
10
DNA DNA
transcription
transcription
Add 5 cap and
poly A tail
AAAAA
RNA splicing
translation
AAAAA
nucleus export
AAAAA
modification translation
modification
cytoplasm cytoplasm
Figure 1.18 This figure shows an array with 9 probes. Each probe is the reverse comple-
ment of some short DNA fragment which forms a fingerprint (that is, unique identifier) of cer-
tain target DNA sequence. When the array is exposed to certain DNA sample, some probes
will light-up if the corresponding target DNA sequences exist in the sample.
Ck1 ( j )
Ck2 ( j )
j
k2+1 h(k1, k2) m
Figure 2.12 The figure shows 5 curves Ck(j) for 0 k 4. The thick black curve corre-
sponds to Env4(j) = max0k4 Ck(j).
C0(j) C0(j)
C2(j) C2(j)
C1(j) C1(j)
C3(j) C3(j)
C4(j) C4(j)
6 m j 6 m j
(a) (b)
Figure 2.13 Possible outcome of overlaying: (a) below, and (b) above.
Regulatory region mRNA
Figure 10.2 The locations of gene coding and noncoding regions and the promoter in a
DNA strand. The promotor region is present surrounding the start of (and mostly upstream
of) the transcript region. Other elements such as enhancer may be present far distant from the
transcription start site.
2
bits
0
1 2 3 4 5 6
5 3
Figure 10.6 The sequence logo for the PWM in Figure 10.5.
E
m3 m1 m2 m3 gene
A = log2 E = C + F1 N1 + F2 N2 + F3 N3
where N1=1, N2=1, N3=2
Figure 10.21 The linear model correlating motifs with gene expression. The ellipses rep-
resent the TFs. We have three TFs and N1, N2, and N3 are the number of occurrences of the
above three TFs in the promoter. A = log2 E is the expression level of the gene. C, F1, F2, and
F3 are the model parameters.
500
450
400
350
y3=76.5 y2=147.13 y1=234.21
300
250 b3=216.21
b1=88.08 b2=159.16
200
150
100
50
0
0
11
22
33
44
55
66
77
88
99
110
121
132
143
154
165
176
187
198
209
220
231
242
Figure 12.9 The figure shows the theoretical spectrum for P = SAG, which includes peaks
for y-ions (in red) and b-ions (in green). The b-ions are drawn lower than the y-ion peaks to
show their relative scarcity.
500
450 405
400
350
300
250 210
200
150
100
50
0
0
11
22
33
44
55
66
77
88
99
110
121
132
143
154
165
176
187
198
209
220
231
242
Figure 12.10 The figure shows an example spectrum for P = SAG. The tandem mass spec-
trum peaks are in black color while the theoretical y-ion peaks are in red color.
500
450
405
400
350
300
250 210
200
150 160
150
100
50
0
0
11
22
33
44
55
66
77
88
99
110
121
132
143
154
165
176
187
198
209
220
231
242
Figure 12.12 The figure shows the same spectrum as Figure 12.10 for P = SAG. The tan-
dem mass spectrum peaks are in black color. The theoretical y-ion and b-ion peaks are in red
and green colors respectively.
7 7
1 2 3 4 5 6 7
1
G1 1 1 0 2 2 0 2 5 4 5 4
G2 1 2 2 0 0 2 0 1 1
G3 1 1 2 2 0 0 0 3 3
G4 2 2 2 0 0 2 0 1 2 3 4 5 6 7
2 1 2 1
G5 1 1 2 2 2 0 0 H1 1 1 0 1 1 0 0
G6 1 1 0 2 0 0 2 H1 1 1 0 0 0 0 1
6 6
H2 1 1 1 0 0 1 0
(a) (b) (c)
H2 1 0 0 0 0 0 0
H3 1 1 1 0 0 0 0
7
1 1 H3 1 1 0 1 0 0 0
5 0 4 H4 1 1 1 0 0 1 0
1 1 H4 0 0 0 0 0 0 0
3 H5 1 1 1 0 0 0 0
00 0 H5 1 1 0 1 1 0 0
2 0 1
0 0 H6 1 1 0 1 0 0 0
6 H6 1 1 0 0 0 0 1
(d) (e)
Figure 13.3 (a) shows a set of G of 5 genotypes. (b) shows the graph GM. (c) shows the
same graph GM after we infer the colors of all edges. The red colored (color 0) edges are in-
phase while the blue colored (color 1) edges are out-of-phase. (d) shows the set of haplotypes
H that can resolve G.
Motif Finding 271
FIGURE 10.19: This table is obtained from [307]. It lists the average
sensitivity (nSN) and precision (nPPV) of each motif nder for Tompa et
al.s benchmark and E. coli datasets. For the E. coli dataset, the results
of some stand-alone motif nders (marked with a dash) were not obtained,
because either these programs are not available or the output does not give
binding sites for us to evaluate the results (e.g., YMF). Motif nders marked
with asterisks (*) are ensemble methods. Note that we are unable to execute
some ensemble methods and we only estimate their upper bound performance.
Motif Finding 273
Yeast Mammal
SSD SSD
AlignACE 1.206 1.530
MotifSampler 1.278 1.132
MEME 1.292 0.750
Weeder 1.314 1.360
ANNSpec 1.344 1.137
MDSscan 1.361 1.036
BioProspector 1.370 1.246
MITRA 1.515 1.470
SPACE 1.539 1.121
Improbizer 1.639 1.475
BEST* 1.159 1.323
WebMotifs* 1.344 -
SCOPE* 1.492 1.247
MotifVoter* 1.919 1.824
FIGURE 10.20: The table (obtained from [307]) lists the average Sum of
Squared Distance (SSD) between the true motif and the predicted motif for
each motif nder, on yeast and mammalian ChIP datasets. Note that the
SSD score is at most 2.
We also evaluate the motif nders using the ChIP-Chip datasets of yeast
[136] and mammals. For mammalian ChIP-Chip datasets, we evaluate the
datasets for nine transcription factors: CREB [316], E2F [242], HNF4/HNF6
[225], MYOD/MYOG [49], NFKB [260], NOTCH [228], and SOX [33].
For ChIP-Chip datasets, though the actual binding sites are unknown, we
are given the PWM motif for each TF. Hence, we use Sum of Squared Distance
(SSD) to evaluate if the predicted PWM motif by each motif nder is similar
to the known PWM motif. Note that SSD is one of the best measurements
for comparing PWMs [203], and is dened as:
T
1
w
SSD(X, Y ) = (2 (px (b) py (b))2 )
w i=1
b=A
where px (b) and py (b) are the probabilities of base b occurring at position
i in motifs X and Y , respectively. Note that 0 SSD(X, Y ) 2 and
SSD(X, X) = 2. The higher the SDD score, the more similar are the two
motifs. Figure 10.20 shows the comparison results.
From the results, among all the individual motif nders, SPACE gives the
best sensitivity and specicity. Moreover, we also observe that motif ensemble
methods can enhance the performance.
274 Algorithms in Bioinformatics A Practical Introduction
where C and F are the best parameters which minimize the value.
Our problem is to nd a set of motifs M which can t well with the ex-
pression level of the genes. Precisely, we would like to nd the set M which
Motif Finding 275
m3 m1 m2 m3 gene
A = log2 E = C + F1 N1 + F2 N2 + F3 N3
where N1=1, N2=1, N3=2
FIGURE 10.21: The linear model correlating motifs with gene expression.
The ellipses represent the TFs. We have three TFs and N1 , N2 , and N3 are
the number of occurrences of the three TFs in the promoter. A = log2 E is
the expression level of the gene. C, F1 , F2 , and F3 are the model parameters.
(See color insert after page 270.)
minimizes (M). This problem is NP-hard. This section resolves two prob-
lems. First, we present a polynomial time algorithm to compute the tness of
a xed set of motifs M, that is, computing the parameters C and F , for all
M, which minimizes (M). Then, we present the algorithm REDUCE
[47] which applies a heuristic algorithm to nd M which minimizes (M).
LEMMA 10.1
Given the expression Ag for a set of genes g G and a set M of motifs, we
can compute C and F for all M to minimize (M) as follows. F for all
M are computed by solving a system of |M| linear equations, for every
M,
(Ag A)(Ng N ) = F ( (Ng N )(Ng N )).
g g
C can be computed by
C =A F N .
M
1
1
where A = |G| ( gG Ag ) and N = |G| ( gG Ng ).
276 Algorithms in Bioinformatics A Practical Introduction
By dierentiating (M) with respect to C, we have g (Ag C F Ng ) =
0. Hence, C = A M F N .
By substituting C into the formula of (M) and dierentiating (M) with
respect to F for every M, we get the linear equation stated in the lemma.
LEMMA 10.2
Given the expression Ag for a set of genes g G and a motif , the following
equations compute C and F which minimizes ({}).
g (Ag A)(Ng N )
F =
g (Ng N )
2
C = A F N
Algorithm REDUCE
Require: The expression level Ag for all g G and the promoter regions
of those genes
Ensure: A set of length- motifs M
1: Initialize N
g = 0
2: Scan the promoter of each gene g. For each observed k-mer , incre-
ment N
g
3: Set M =
4: repeat
5: Using Lemma 10.1, we compute C and F for all M which
minimizes (M).
6: Set Ag = Ag C M F Ng for all g G.
7: For every length- motif
M, compute () =
minC ,F gG (Ag C F Ng )2 by Lemma 10.2.
8: Select which maximizes ().
9: Set M = M {}
10: until the selected motif is not signicant
CCGCAGGTCCAAATA (Rabbit)
CGCA
GACTTGCTTGCATTA (Mouse)
CGCA
TGCA CGCTGCACGTAATTT (Rat)
GCGCTTCGTTATATA (Human)
CGCA GCTCACATCGCAAAT (Chimp)
FIGURE 10.23: The gure shows the homologous sequences and the corre-
sponding phylogenetic tree. The 4-mers which minimize the parsimony score
are also highlighted. The parsimony score in this example is 2.
0 if s is a substring of the homologous sequence in u
Wu [s] =
+ otherwise.
min Wr [t]
length substring t
Motif Finding 279
By back-tracing, we can identify the set of -mers, one from each input se-
quence, that give the best parsimony score.
We now analyze the time complexity. For every leaf u in T , Wu [s] is com-
puted for all -mers s. Since there are 4 -mers and n leaves, processing
all leaves takes O(n4 + m) where m is the total length of all homologous
sequences.
For every internal node u in T , Wu [s] is computed for all -mers s. Since
there are 4 possible -mers s, we need to ll in 4 dierent Wu [s] entries. If u
has degu children, each entry takes O(degu 4 ) time. Since the total number
of children
for all internal nodes u in T is O(n), processing all internal nodes
takes O( u degu 42 ) = O(n42 ) time. In total, the running time of the
algorithm is O(42 n + m) time.
10.12 Exercises
1. The accessment result of dierent motif nders can be found in
http://bio.cs.washington.edu/assessment/assessment result.html.
Can you nd a motif nder which is consistently better than the other
motif nders?
2. Suppose the following set of sites are known to be bound by the tran-
scription factor NFkB:
AGGAAATG, GGAAATGCCG, AGGAAATG, GGAATTCC, GAAATG, GGAAAACC,
ATGGAAATGAT, GGAAATCCCG, GGAAATTCCA, GGAAATTCCC, GGAAATTCCG.
Can you align them by packing spaces to the beginning and the end of
each sequence? Then, can you report the corresponding logo? (Sequence
logo can be found in http://weblogo.berkeley.edu/logo.cgi.)
3. For each of the following cases, design a positional weight matrix that
gives a high score for the motif.
(a) The motif equals TATAAT.
(b) The motif has ve nucleotides where the rst position equals A and
the third position equals either C or G.
(c) The motif is either TATAAT or CATCGT.
4. Consider a DNA sequence S[1..n]. A gapped motif M consists of an
1 -mer and an 2 -mer separated by a gap of size g. We would like to
nd all gapped motifs M which occur at least q times in S with at most
d mismatches. Can you propose an algorithm to nd all these gapped
280 Algorithms in Bioinformatics A Practical Introduction
x y
g1 1 5
g2 4 1
g3 2 2
Using the model in Section 10.11.1, can you compute ({x}) and ({y})?
Indicate if the motifs x and y are activators or inhibitors. Also, among x
and y, which motif is better to explain the expression level of the genes?
10. Consider a set of aligned orthogonal sequences S1 , . . . , Sn , each of length
m. Suppose we also have the corresponding phylogenetic tree. Can you
propose an algorithm to identify a length- region i..i + 1 such that
the parsimony score for S1 [i..i+ 1], . . . , Sn [i..i+ 1] is the minimum
parsimony score? What is the running time of your algorithm?
Chapter 11
RNA Secondary Structure
Prediction
11.1 Introduction
Due to the advance in sequencing technologies, many RNA sequences have
been discovered. However, only a few of their structures have been deduced.
On the other hand, the chemical and biological properties of many RNAs (like
tRNAs) can be determined primarily by their secondary structures. Therefore,
determining the secondary structures of RNAs is becoming one of the most
important topics in bioinformatics.
Below we list a number of applications of RNA secondary structures.
281
282 Algorithms in Bioinformatics A Practical Introduction
c u u g
u c
g g c
u a a c
u a g
c a a c
a a g a
a g a
g g
(a) (b)
Stacked pair: A stacked pair is a loop closed by two base pairs that
are adjacent to each other. In other words, a stacked pair is formed by
two base pairs (i, j) and (i + 1, j 1). Figure 11.2b shows an example
of a stacked pair.
(a) (b)
Bulge: A bulge consists of two base pairs like the internal loop. How-
ever, only one side of the bulge has unpaired bases. The other side must
have two base pairs adjacent to each other, as shown in Figure 11.3b.
c
c c
a u u a
u a a a
g a a a u a u
aa cg gga u Stacked Pair
g u
g uu gc cc
a a c g g g
a u Bulge
stacking pair
c a uc g a a c g u c c u c a a g a c a g c u c u c u
(.(.(..).(....)))(.((..)).)
caucgaacguccucaagacagcucucu
(c)
structure with various loop types. Besides, we sometimes like to represent the
RNA nucleotide sequence as a line and all the base pairs as arcs on top of the
line (see Figure 11.4(b)). We also like to represent the loops by parentheses
(see Figure 11.4(c)).
The rest of this chapter is organized as follows. Section 11.2 gives a brief
description of how to obtain RNA secondary structures experimentally. Sec-
tions 11.3 to 11.7 describe approaches to predicting RNA secondary structures
computationally.
Physical methods:
The basic idea behind physical methods is to infer the structure based
on the distance measurements among atoms. Crystal X-ray diraction
is a physical method which gives the highest resolution. It reveals the
distance information based on X-ray diraction. For example, the struc-
ture of tRNA is obtained using this approach [176]. However, the use
of this method is limited since it is dicult to obtain crystals of RNA
molecules which are suitable for X-ray diraction. Another physical
method is Nuclear Magnetic Resonance (NMR), which can provide de-
tailed local conformation based on the magnetic properties of hydrogen
nuclei. However, NMR can only resolve structures of small size.
Chemical/enzymatic methods:
Enzymatic and chemical probes [93] which modify RNA under some
specic constraints can be used to analyze RNA structure. By compar-
ing the properties of the RNA before and after applying the probes, we
can obtain some RNA structure information.
Note that the RNA structure information extracted is usually limited
as some segments of an RNA polymer are inaccessible to the probes.
Another issue is the experimental temperatures for various chemical
or enzymatic digestions. An RNA polymer may unfold due to a high
experimental temperature. Caution is required in interpreting the ex-
perimental results.
Mutational analysis:
This method introduces a specic mutation to the RNA sequence. Then,
286 Algorithms in Bioinformatics A Practical Introduction
the binding abilities between the mutated sequence and some proteins
are tested [280]. If the binding abilities of the mutated sequence are
dierent from that of the original sequence, we claim that the mutated
RNA sequence has structural changes. Such information helps us to
deduce the secondary structure.
ACCAGAAACUGGU
FIGURE 11.5: The secondary structure for the RNA sequence
ACCAGAAACUGGU which maximizes the number of base pairs.
i and j do not form a base pair: In this case, there exists i k < j such that
no base pair crosses k. Hence, V (i, j) = maxik<j {V (i, k)+V (k+1, j)}.
Our aim is to compute V (1, n), which is the maximum number of base pairs
in S[1..n]. To compute V (1, n), Nussinov and Jacobson applied dynamic
programming to ll in the table V . Observe that the value V (i, j) depends
on the values V (i, k), V (k, j), and V (i + 1, j 1) for i k < j. To ensure all
dependent values are available when we ll in an entry in V , the algorithm lls
RNA Secondary Structure Prediction 289
Nussinov algorithm
1: for i = 1 to n do
2: V (i, i) = V (i + 1, i) = 0
3: end for
4: for d = 1 to n 1 do
5: for i = 1 to n d do
6: j = i + d;
7: V (i, j) = max{V (i + 1, j 1) + (S[i], S[j]), maxik<j {V (i, k) +
V (k + 1, j)}}
8: end for
9: end for
10: Report V (1..n);
FIGURE 11.6: The Nussinov algorithm for computing the maximum num-
ber of base pairs for an RNA sequence S.
1 2 3 4 5 6 7
1 0 0 0 0 1 1 2
2 0 0 0 0 1 1 2
3 0 0 0 1 1 2
4 0 0 0 1 2
5 0 0 1 1
6 0 0 0
7 0 0
FIGURE 11.7: Consider S[1..7] =ACCAGCU. The gure shows the dynamic
programming table V .
For example, consider S[1..7] =ACCAGCU. Figure 11.7 shows the correspond-
ing dynamic programming table V . The maximum number of base pairs for
S is V (1, 7) = 2.
eS(i, j): This function gives the free energy of a stacked pair consisting
of base pairs (i, j) and (i + 1, j 1). Since no free base is included, this is
the only loop which can stabilize the RNA secondary structure. Thus,
its energy is negative.
eH(i, j): This function gives the free energy of the hairpin closed by
the base pair (i, j). Biologically, the bigger the hairpin loop, the more
unstable is the structure. Therefore, eH(i, j) is more positive if |j i+1|
is big.
V (i, j): The energy of the optimal secondary structure for S[i..j] given
that (i, j) is a base pair.
V BI(i, j): The energy of the optimal secondary structure for S[i..j]
given that (i, j) closes a bulge or an internal loop.
RNA Secondary Structure Prediction 291
V M (i, j): The energy of the optimal secondary structure for S[i..j] given
that (i, j) closes a multi-loop.
Note that the energy of the optimal secondary structure for S[1..n] equals
W (n). To compute W (), it depends on V (). To compute V (), it depends
on V BI() and V M (). Below, we describe the detail of the four recursive
equations.
W (j) is the free energy for the optimal secondary structure for S[1..j].
When j = 0, S[1..j] is a null sequence; thus, we set W (j) = 0. For j > 0, we
have two cases: either (1) S[j] is a free base or (2) there exists i such that
(S[i], S[j]) forms a base pair. For case (1), W (j) = W (j 1). For case (2),
W (j) = min1i<j (V (i, j) + W (i 1)). Thus, we have the following recursive
equations.
W (0) = 0
W (j) = min{W (j 1), min1i<j (V (i, j) + W (i 1))} for j > 0.
V (i, j) is the free energy of the optimal secondary structure for S[i..j] with
(i, j) forms a base pair. When i j, S[i..j] is a null sequence and we cannot
form any base pair; thus, we set V (i, j) = +. When i < j, the base pair
(i, j) should close one of the four loop types: hairpin, stacked pair, internal
loop, and multi-loop. Thus the free energy V (i, j) should be the minimum
of eH(i, j), eS(i, j) + V (i + 1, j 1), V BI(i, j), and V M (i, j). We have the
following equations.
For i j, V (i, j) = +
For i < j,
eH(i, j) Hairpin loop;
eS(i, j) + V (i + 1, j 1) Stacking loop;
V (i, j) = min
V BI(i, j)
Bulge/Internal loops;
V M (i, j) Multi-loop.
V BI(i, j) is the free energy of the optimal secondary structure for S[i..j]
with the base pair (i, j) closes a bulge or an internal loop. The bulge or the
internal loop is formed by (i, j) together with some other base pair (i , j )
where i < i < j < j. The energy of this loop is eL(i, j, i , j ). The energy of
the best secondary structure for S[i..j] with (i, j) and (i , j ) forms an internal
loop is eL(i, j, i , j ) + V (i , j ). By trying all possible (i , j ) pairs, the optimal
energy can be found as follows.
V BI(i, j) = mini<i <j <j {eL(i, j, i , j ) + V (i , j )}.
V M (i, j) is the free energy of the optimal secondary structure for S[i..j]
with the base pair (i, j) closes a multi-loop. The multi-loop is formed by (i, j)
together with k base pairs (i1 , j1 ), . . . , (ik , jk ) where k > 1 and i < i1 < j1 <
i2 < j2 < . . . < ik < jk < j. (See Figure 11.8 for an example.) Similar to the
calculation of V BI(i, j), we get the following equation.
292 Algorithms in Bioinformatics A Practical Introduction
V M (i, j) =
k
mini<i1 <j1 <...<ik <jk <j {eM (i, j, i1 , j1 , . . . , ik , jk ) + h=1 V (ih , jh )}
V (i, j): It is an array with n2 entries and each entry requires nding
the minimum of four terms, eH(i, j), eS(i, j) + V (i + 1, j 1),V BI(i, j),
and V M (i, j). Since each entry can be lled in O(1) time, this matrix
can be computed in O(n2 ) time.
V BI(i, j): It is an array with n2 entries and each entry requires nding
the minimum of n2 terms: eL(i, j, i , j ) + V (i , j ) for i < i < j < j,
in which i and j both vary from 1 to n at most. So, each term needs
O(n2 ) time. As a result, it costs O(n4 ) time in total.
V M (i, j): It is an array with n2 entries and each entry requires nding
the minimum of exponential number of terms: eM (i, j, i1 , j1 , . . . , ik , jk )+
k
h=1 V (i , j ) where i < i1 < j1 < . . . < ik < jk < j. So in total, it
costs exponential time.
i i1 j1 i2 j2 ik jk j
FIGURE 11.8: Structure for a multi-loop.
Given the above assumption, the RNA structure prediction algorithm can
be speeded up by introducing a new recursive equation W M (i, j). W M (i, j)
is dened to be the energy of the optimal secondary structure of S[i..j] that
constitutes the substructure of a multi-loop structure. In other words, inside
the multi-loop substructure, every free base is given a score c while every base
pair belonging to the multi-loop substructure is given a score b. Thus, we
have the following equation.
W M (i, j 1) + c, j is free base;
W M (i + 1, j) + c, i is free base;
W M (i, j) = min V (i, j) + b, (i, j) is a pair;
min {W M (i, r 1) + W M (r, j)}, i and j are not free
i<rj
and (i, j) is not a pair;
Given W M (i, j), V M (i, j) equals the sum of the multi-loop penalty, a, and
the energies of the two parts W M (i + 1, r 1) and W M (r, j 1) for some
i + 1 < r j 1. Thus, we have
V M (i, j) = W M (i + 1, j 1) + a
After the changes, the optimal secondary structure can be computed by ll-
ing in ve dynamic programming tables: W (i), V (i, j), V BI(i, j), V M (i, j),
and W M (i, j).
Now, we analyze the time complexity. The time complexity for lling tables
W (i), V (i, j), and V BI(i, j) is the same as the analysis in Section 11.6.1. They
run in O(n2 ), O(n2 ), and O(n4 ) time, respectively.
294 Algorithms in Bioinformatics A Practical Introduction
For the table W M (i, j), it has n2 entries and each entry can be computed
by nding the minimum of four terms: W M (i, j 1) + c, W M (i + 1, j) + c,
V (i, j) + b, and the minimum of W M (i, k 1) + W M (k, j) for i < k j .
The rst three terms can be computed in O(1) time while the last term takes
O(n) time. In total, lling table W M (i, j) takes O(n3 ) time.
For the table V M (i, j), it also has n2 entries and each entry can be evaluated
by nding the minimum of the n terms W M (i + 1, k 1) + W M (k, j 1) + a
for i + 1 < k j 1. Thus, lling table V M (i, j) also takes O(n3 ) time.
In conclusion, the modied algorithm runs in O(n4 ) time.
LEMMA 11.1
Consider i < i < j < j. Let n1 = i i 1, n2 = j j 1 and l = n1 + n2 .
For n1 > e and n2 > e, we have eL(i, j, i , j ) eL(i + 1, j 1, i , j ) =
size(l) size(l 2) + stacking(i, j) stacking(i + 1, j 1)
RNA Secondary Structure Prediction 295
Based on the assumptions, V BI(i, j) for all i < j can be found in O(n3 )
time as follows.
We dene new recursive equations V BI and V BI . V BI (i, j, l) equals the
minimal energy of an internal loop of size l closed by a pair (i, j). V BI (i, j, l)
also equals the minimal energy of an internal loop of size l closed by a pair
(i, j). Moreover, V BI requires the number of the bases between i and i and
the number of the bases between j and j , excluding i,i ,j and j , are both
more than a constant e. Formally, V BI and V BI are dened as follows.
V BI (i, j, l) V BI (i + 1, j 1, l) =
size(l) size(l 2) + stacking(i, j) + stacking(i + 1, j 1)
V BI (i, j, l) =
V BI (i + 1, j 1, l) + size(l) size(j 2) + stacking(i, j)
stacking(i + 1, j 1)
min
min1de V (i + d, j l d) + eL(i, j, i + d, j l + d 2)
min1de V (i + l + d, j d) + eL(i, j, i + l d + 2, j d)
The last two entries of the above equation handle the cases where this mini-
mum is obtained by an internal loop, in which d is less than a constant e.
Now, we analyze the time complexity. The dynamic programming tables
for V BI and V BI have O(n3 ) entries. Each entry in V BI and V BI can
be computed in O(e) and O(1) time, respectively. Thus, both tables can be
lled in using O(en3 ) time. Given V BI , the table V BI can be lled in using
O(n2 ) time.
Together with lling in the tables W, V, V M, W M , the time required to
predict a secondary structure without a pseudoknot is O(n3 ).
296 Algorithms in Bioinformatics A Practical Introduction
Each endpoint i appears in Mi0 ,k0 once. Each base pair (i, j) in Mi0 ,k0
satises either i0 i < j0 < j j0 or j0 i < j0 < j k0 .
If the pairs (i, j) and (i , j ) in Mi0 ,k0 satisfy i < i < j0 or j0 i < i ,
then j > j .
The rst part of the denition divides the sequence S[i0 ..k0 ] into three seg-
ments: S[i0 ..j0 ], S[j0 ..j0 ], and S[j0 ..k0 ]. For each base pair in Mi0 ,k0 , one of its
RNA Secondary Structure Prediction 297
jc 0
k0
i0 jc0
j0 k0
i0 j0
(a) (b)
i0 j0 i0 j0 i0 j0
(c) (d) (e)
FIGURE 11.9: An illustration of a simple pseudoknot. Figures (a) and
(b) are simple pseudoknots while the rest are not.
ends must be in S[j0 ..j0 ] while the other end is either in S[i0 ..j0 ] or S[j0 ..k0 ].
The second part of the denition implies that the base pairs cannot intersect
with each other. Figure 11.9(a) shows an example of a simple pseudoknot
while Figure 11.9(b) shows an alternative view of the same pseudoknot. Fig-
ure 11.9(ce) are some examples that are not simple pseudoknots.
With the denition of a simple pseudoknot, an RNA secondary structure
with simple pseudoknots is dened as below. A set of base pairs M is called an
RNA secondary structure with simple pseudoknots if M = M M1 . . . Mt
for some non-negative integer t such that
i
j
k
i0
doknots that maximizes the number of base pairs. The algorithm requires
two recursive equations where V (i, j) is dened to be the optimal score of an
RNA secondary structure with simple pseudoknots for the sequence S[i..j] and
Vpseudo (i, j) is dened to be the optimal score for S[i..j] with the assumption
that S[i..j] forms a simple pseudoknot.
For V (i, j), there are three cases: (1) S[i..j] is a simple pseudoknot, (2)
(i, j) forms a base pair, or (3) S[i..j] can be decomposed into two compounds.
Therefore, we have the following recursive equation.
Vpseudo (i, j)
V (i, j) = max V (i + 1, j 1) + (S[i], S[j])
maxi<kj {V (i, k 1) + V (k, j)}
where V (i, i) = 0 for all i. Also, (S[i], S[j]) = 1 if {S[i], S[j]} = {a, u} or
{c, g}; otherwise, (S[i], S[j]) = .
For Vpseudo (i0 , k0 ), its value can also be computed using a dynamic pro-
gramming algorithm. Prior to describe the algorithm, we rst give some
notations. Recall that, in a simple pseudoknot of S[i0 ..k0 ], the sequence is
partitioned into three segments S[i0 ..j0 ], S[j0 ..j0 ], and S[j0 ..k0 ] for some un-
known positions j0 and j0 . We denote the three segments as left, middle, and
right segments, respectively (see Figure 11.9(a,b) for an illustration). Any
tuple (i, j, k) is called a triplet if i0 i j0 , j0 < j j0 , and j0 < k k0 .
A base pair (x, y) is said to be below the triplet (i, j, k) if (x i and y j)
or (x j and y k). A base pair (x, y) is said to be on the triplet (i, j, k)
if (x, y) = (i, j) or (x, y) = (j, k). Figure 11.10 is an example illustrating the
concept below. All the base pairs in solid lines are below the triplet (i, j, k).
For a triplet (i, j, k), it should satisfy either one of the following relations:
(1) (i, j) is a base pair, (2) (j, k) is a base pair, or (3) both (i, j) and (j, k)
are not base pairs. Below, we dene three variables, based on the above three
relationships, which are useful for computing Vpseudo (i0 , k0 ).
VL (i, j, k) is the maximum number of base pairs below the triplet (i, j, k)
in a pseudoknot for S[i0 ..k0 ] given that (i, j) is a base pair;
RNA Secondary Structure Prediction 299
VR (i, j, k) is the maximum number of base pairs below the triplet (i, j, k)
in a pseudoknot for S[i0 ..k0 ] given that (j, k) is a base pair; and
VM (i, j, k) is the maximum number of base pairs below the triplet (i, j, k)
in a pseudoknot for S[i0 ..k0 ] given that both (i, j) and (j, k) are not base
pairs.
Note that max{VL (i, j, k), VR (i, j, k), VM (i, j, k)} is the maximum number
of base pairs below the triplet (i, j, k) in a pseudoknot for S[i0 ..k0 ]. Then
Vpseudo (i0 , j0 ) can be calculated as follows.
Vpseudo (i0 , k0 ) = max {VL (i, j, k), VM (i, j, k), VR (i, j, k)}
i0 i<j<kk0
VL (i 1, j, k), VM (i 1, j, k),
VM (i, j, k) = max VL (i, j + 1, k), VM (i, j + 1, k), VR (i, j + 1, k),
VM (i, j, k 1), VR (i, j, k 1)
Here we provide an intuitive explanation for the formula above. For both
VL (i, j, k) and VR (i, j, k), the rst term represents the base pair on the triplet
(i, j, k) while the second term represents the number of base pairs below
(i, j, k). For VM (i, j, k), since there is no base pair on the triplet (i, j, k),
the formula only consists of the number of base pairs below the triplet. Note
that the two variables, VR (i 1, j, k) and VL (i, j, k 1), do not appear in the
formula for VM (i, j, k). This is because VM (i, j, k) indicates that both (i, j)
and (j, k) are not base pairs.
To compute VL (i, j, k), VR (i, j, k), VM (i, j, k), some base values are required.
VR (i0 1, j, j + 1) = (S[j], S[j + 1]) j (1)
VR (i0 1, j, j) = 0 j (2)
VL (i, j, j) = (S[i], S[j]) i0 i < j (3)
VL (i0 1, j, k) = 0 k = j + 1 k = j (4)
300 Algorithms in Bioinformatics A Practical Introduction
VM (i0 1, j, k) = 0 k = j + 1 k = j (5)
The base case (3) can be explained by Figure 11.11(a). The base cases (1)
and (2) can be explained by Figures 11.11(b) and (c), respectively. The base
cases (4) and (5) are trivial since they are out of range.
11.8 Exercises
1. Consider the following phenylalanyl-tRNA sequence:
RNA Secondary Structure Prediction 301
GCGGAUUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAUCUGGAGGUCCUGUGUUCGAUCCACAGAAUUCGCACCA
Can you predict the secondary structure of this sequence using the
Zuker MFOLD algorithm (http://mfold.bioinfo.rpi.edu/, with default
setting)? How many structures does MFOLD predict? Is there any
structure which looks similar to the cloverleaf structure?
2. Given an RNA sequence R[1..n], suppose R forms a secondary struc-
ture by maximizing the number of base pairs with the assumption that
there are no pseudoknots and no multi-loop. Propose the most ecient
algorithm to predict the RNA secondary structure. What is the time
complexity?
3. Consider an RNA sequence S[1..n]. The Nussinov algorithm computes
an RNA secondary structure of S without pseudoknots by maximizing
the number of base pairs. However, it does not consider the fact that
all hairpin loops in an RNA secondary structure have minimum length
(that is, if (i, j) is a base pair of a hairpin loop, j i 1 ).
(a) Can you give an ecient algorithm to compute the maximum num-
ber of base pairs with this additional requirement? What is the
running time?
(b) Can you describe an ecient algorithm to recover the correspond-
ing secondary structure? (Store the optimal structure using paren-
thesis representation in an array A[1..n]. For example, if = 3 and
S =ACGUUUUACGU, then the output is A =((((...)))).)
4. Consider an RNA sequence S[1..n]. Suppose the only allowed base pairs
are (A, U ), (U, A), (C, G), and (G, C). A secondary structure of S is
called a thin secondary structure if it satises the following criteria:
There exist t disjoint intervals [i1 ..j1 ], [i2 ..j2 ], . . . , [it ..jt ] such that,
for every interval [ik ..jk ], there is no base pair connecting a base in
the interval and a base outside the interval.
Every interval [ik ..jk ] forms a pseudoknot. Moreover, the pseudo-
knot can be broken by removing one base pair in the interval.
Finally, the base pairs outside all the intervals do not form any
pseudoknots.
Our aim is to nd a thin secondary structure maximizing the total num-
ber of base pairs. Can you propose an ecient algorithm to compute
such an RNA secondary structure of S? What is the time complexity?
5. Given an RNA sequence S[1..n], we would like to form a secondary struc-
ture which maximizes the number of tri-stacking pairs. A tri-stacking
pair is a stacking pair of length three, that is, it is formed by 3 consec-
utive base pairs (i, j), (i + 1, j 1), and (i + 2, j 2) for some i, j. For
302 Algorithms in Bioinformatics A Practical Introduction
x y
x-k
y+k
FIGURE 11.12: Hairpin stem
(a) Give an ecient algorithm that reports the longest hairpin stem
S[i..j] in S (that is, the hairpin stem S[i..j] which maximizes (j
i + 1)). State the time complexity of the algorithm.
(b) A region S[i..j] is called a d-mismatch hairpin stem if the corre-
sponding stem contains at most d base pairs which are not com-
plementary. Give an ecient algorithm that reports the longest
d-mismatch hairpin stem S[i..j] in S. State the time complexity of
the algorithm.
7. Given an RNA sequence R[1..n]. Let S be the set of base pairs. Note
that S may contain pseudoknots and every base can only pair with
exactly one other base. A subset Q S is said to be a chain if, for any
(p1 , q1 ), (p2 , q2 ) Q, we have either p1 < q1 < p2 < q2 or p2 < q2 <
p1 < q1 . Can you propose an ecient algorithm to identify the size of
RNA Secondary Structure Prediction 303
12.1 Introduction
A protein is a long chain of amino acids, known as a polypeptide. The
sequence of amino acids in each protein is unique and plays a major role in
determining its 3D conformation, its charge distribution, and ultimately its
function. Thus, knowing this sequence is pertinent to further investigation
of a proteins functions and its involvement in biological processes. However,
sequencing the complete protein is still dicult. It is currently only possible
to sequence peptide fragments of length 10 in a high-throughput manner.
Nevertheless, peptide sequencing is already very useful and nds many appli-
cations.
High-throughput peptide sequencing is based on the observation that amino
acids have dierent masses. The sequence of a peptide can be deduced through
measuring the masses. The enabling technology for measuring the mass of
peptides is the mass spectrometer. Mass spectrometry (MS) is the technique
used to separate the components of a sample according to their masses,1 com-
monly expressed in Daltons (Da).2 Figure 12.1 shows a simple hypothetical
MS spectrum derived from a sample with three components (assuming no
noise). Each component produces a peak in the MS spectrum at its mass
value. The height of a peak indicates the relative abundance of its compo-
nent. Depending on the equipment used, the error of the mass measurement
ranges from 0.01 to 0.5 Da.
In this chapter, we rst discuss how an experimental mass spectrum of a
peptide is obtained. Then, we detail the computational methods for obtaining
the peptide sequences from the mass spectrum de novo or through database
search.
1 In reality, the mass spectrometer separates the components according to their mass charge
ratios instead of their masses. Moreover, we assume the majority of the components have
unit charge. We use the term mass for simplicity.
2 1 Dalton is the mass of a hydrogen atom.
305
306 Algorithms in Bioinformatics A Practical Introduction
intensity
mass/charge
Note that the protein is not cut at the rst R, because the next residue is P.
Given the mixture of peptides, the second step separates those peptides.
This step rst uses High Performance Liquid Chromatography (HPLC) to
separate the mixture by the polarity of the compounds. Then, the mixture
is further separated by mass spectrometry according to the masses of the
compounds. Each peptide of a specic mass corresponds to a peak in the
spectrum (see Figure 12.3).
The peptide of a particular mass is selected and further fragmented at
random positions along the peptide backbone. Usually, fragmentation is per-
formed by Collision Induced Dissociation (CID). The peptide is passed into a
collision chamber containing a pressurized inert gas (e.g., argon).4 The high
3 Protease is an enzyme which breaks peptide bonds between amino acids of proteins.
4 An inert gas avoids any chemical reaction.
Peptide Sequencing 307
B. Computational Part:
1. De novo sequencing, or
2. Protein database search.
Intensity
Mass/Charge
Select One Peptide
FIGURE 12.3: Spectrum of peaks after HPLC and MS. Each represents
one peptide.
308 Algorithms in Bioinformatics A Practical Introduction
a b c
H O H O
NH2 C C N C C OH
R H R
x y z
FIGURE 12.4: Ions resulting from a peptide with 2 amino acids.
pressure causes the peptide ions to collide with the argon atoms, thus breaking
the bonds along the peptide backbone.
Since most of the bonds are broken along the peptide backbone, the peptide
can be broken at three locations: CC, CN, and NC bonds. Figure 12.4
shows how a peptide with two amino acids is fragmented. The resulting
fragment ions with the N-terminus are the a-ions, b-ions, and c-ions, while
the ions with the C-terminus are the x-ions, y-ions, and z-ions.
Since the peptide CN bond is easier to be broken during fragmentation,
the most abundant ions are y-ions and b-ions, with the abundance of y-ions
a bit bigger than that of b-ions. The other ions are less abundant.
After fragmentation in the collision chamber, the fragment mixture is passed
to the mass spectrometer to obtain the tandem mass spectrum5 (also called
the MS/MS spectrum) of the peptide. In the mass spectrum, the fragment
ions are separated according to their mass (represented horizontally) and their
relative abundance (or intensity) are indicated by the heights (see Figure 12.5).
We let M (r) be the intensity of the peak of mass r in the spectrum M .
Ideally, the tandem mass spectrum contains only peaks corresponding to
the various ions of the peptide. In real life, the spectrum contains many noise
peaks while it may miss peaks of some ions. Figure 12.6 shows an example of
a real tandem mass spectrum. The spectrum contains both signal peaks and
noise peaks.
5 The mass spectrum is called the tandem mass spectrum because it is obtained through
CTVFTEPREFK
fragmentation
CTVFT EPREFK
a w(a) a w(a)
A 71.08 M 131.19
C 103.14 N 114.1
D 115.09 P 97.12
E 129.12 Q 128.13
F 147.18 R 156.19
G 57.05 S 87.08
H 137.14 T 101.1
I 113.16 V 99.13
K 128.17 W 186.21
L 113.16 Y 163.18
6 An amino acid residue is an amino acid after the removal of a water molecule.
Peptide Sequencing 311
Below we describe the theoretical spectrum of the peptide P . For the sake
of simplicity and illustration, the following assumptions are made: (1) frag-
mentation only occurs at a CN bond (hence resulting in b- and y-ions),
(2) each peptide molecule is fragmented at most one time, (3) each fragment
has unit charge, and (4) the probability of fragmentation at each position on
the peptide is uniform.
For i = 1, 2, . . . , k 1, the breaking of the CN bond between the i-th and
the (i + 1)-th residues results in the C-terminal ion and the N-terminal ion.
The N-terminal ion is a b-ion for a1 . . . ai . Because a b-ion has an extra H,
the mass of the b-ion is bi = w(a1 . . . ai ) + 1. The C-terminal ion is a y-ion for
ai+1 . . . ak . Because a y-ion has three extra H ions and one extra O ion, the
mass of the y-ion is yi+1 = w(ai+1 . . . an )+19. Note that bi +yi+1 = w(P )+20.
For example, for a peptide P = SAG, w(P ) = w(S) + w(A) + w(G) =
87.08 + 71.08 + 57.05 = 215.21. Its b-ions and y-ions are as follows.
FIGURE 12.9: The gure shows the theoretical spectrum for P = SAG,
which includes peaks for y-ions (in red) and b-ions (in green). The b-ions are
drawn lower than the y-ion peaks to show their relative scarcity. (See color
insert after page 270.)
The above mass spectrum model is a simplied model. We can enrich the
spectrum with peaks of other types of N-terminal and C-terminal ions. For
an N-terminal peptide, in addition to b-ions, the other abundant ions are
a, a N H3 , a H2 O, b H2 O, b N H3 ions. For a C-terminal peptide, in
addition to y-ions, the other abundant ions are y H2 O, y N H3 ions. We
can enrich the theoretical spectrum of P with peaks of those abundant ions
(see Exercise 2).
Furthermore, we can enrich the model by peaks of the following ions: (a) the
isotopic ions, (b) multiply charged ions, and (c) ions generated by multiple
fragmentations.
405
210
FIGURE 12.10: The gure shows an example spectrum for P = SAG.
The tandem mass spectrum peaks are black while the theoretical y-ion peaks
are red. (See color insert after page 270.)
where fM (r) isthe sum of intensity of peaks whose mass is between r and
r + , that is, {M (x) | |x r| }.
Figure 12.11 shows the algorithm which computes V (r) based on the recur-
sive formula. Then, the peptide sequence P can be recovered by back-tracing.
Below is the time analysis. For each 0 r W + , V (r) can be computed
in O(|A|) time. Hence, the V table can be lled in using O(|A|W ) time.
Back-tracing takes O(W ) time. In total, the algorithm in Figure 12.11 runs
in O(|A|W ) time.
405
210
150 160
FIGURE 12.12: The gure shows the same spectrum as Figure 12.10 for
P = SAG. The tandem mass spectrum peaks are black. The theoretical y-ion
and b-ion peaks are red and green, respectively. (See color insert after page
270.)
m/z
y7 b1 y6 b2 y5 b3 m y4 b4 y3 b5 y2 b6
FIGURE 12.13: (bi , yi+1 ), for all i = 1, . . . , k 1, forms a set of nested
intervals. Note that all nested intervals cover the mass m = 12 (W + 20) where
W is the mass of the peptide. Also, when some b-ions and y-ions have the
same mass, it is possible that the two intervals have the same endpoints.
are nested. Figure 12.13 shows an example of the nested intervals which are
separated by the same mid-point m.
For the b-ion and y-ion peaks corresponding to the outermost intervals,
they are formed by breaking the prex a1 . . . ai and the sux aj . . . ak of the
peptide P where i + (k j + 1) = . Let score (M, a1 . . . ai , aj . . . ak ) be the
sum of the intensities of all b-ion and y-ion peaks formed by breaking the
peptide P between ax and ax+1 for x {1, . . . , i} {j 1, . . . , k 1}. We
have the following recursive equation.
score (M, a1 . . . ai , aj . . . ak )
score (M, a1 . . . ai1 , aj . . . ak ) + fM (bi , yj ) if bi yj
=
score (M, a1 . . . ai , aj+1 . . . ak ) + fM (yj , bi ) otherwise
LEMMA 12.1
"
maxaA {V (r w(a), s) + fM (r + 1, s + 19)}, r s
V (r, s) = max
maxaA {V (r, s w(a)) + fM (s + 19, r + 1)}, r < s
Algorithm Sandwich
Require: A mass spectrum M , a weight W , and an error bound
Ensure: A peptide P such that score(M, P ) is maximized and |w(P )
W|
1: Let a = maxaA w(a)
2: Initialize all V (r, s) = ; Let V (0, 0) = 0
3: for r = 1 to (W/2 + a) do
4: for s = r a to min{r + a, W r} do
5: for a A such that r + s + w(a) < W do
6: if r < s then
7: V (r, s) = max{V (r, s), V (r w(a), s) + fM (r + 1, s + 19)}
8: else
9: V (r, s) = max{V (r, s), V (r, s w(a)) + fM (s + 19, r + 1)}
10: end if
11: end for
12: end for
13: end for
14: Identify the best V (r, s) among all r, s, a satisfying |r s| < a and
|r+s+w(a)W | < . Through back-tracing, we can recover a peptide
P = P aP where w(P ) = r and w(P ) = s.
Utilizing the recursive formula for V in Lemma 12.1, Figure 12.14 shows the
algorithm for computing the peptide P such that score(M, P ) is maximized
and |w(P ) W | . Note that the algorithm does not ll in V (r, s) for
all 0 r, s W/2. We only need to ll in V (r, s) for |r s| a where
a = maxaA w(a) (why? See Exercise 5). Each entry can be computed in
O(|A|) time. The time complexity of this algorithm is O(|A| W a).
This algorithm was implemented in Peaks [202]. Although the algorithm
we described only handles b-ions and y-ions, the algorithm can be generalized
to handle other abundant N-terminal and C-terminal ions.
E L R C
A P
S K
D T
V L
T W
FIGURE 12.15: An example spectrum graph which consists of a start
vertex and an end vertex. There are multiple paths from the start vertex to
the end vertex. The highlighted one (ASPKT) is the correct path.
Assume (1) the mass spectrometer is innitely accurate and (2) the frag-
mentation process breaks the fragment at every possible position. Then,
G(M ) contains a path from vstart to vend which corresponds to the entire
peptide. However, in reality, neither of the two assumptions holds. First, the
accuracy of the measurement of the mass spectrometer has an error . To
resolve it, G(M ) contains an edge between two vertices u and v of label a if
|v u w(a)| < . Second, the fragmentation process may be incomplete. To
account for it, we include an edge in G(M ) between two vertices u and v if
|v u| equals the mass of a dipeptide or a tripeptide.
There may be multiple paths from vstart to vend in the spectrum graph
G(M ). Sherenga assigns a score to every path such that the score of each path
measures how well the path (and hence, one corresponding peptide sequence)
matches with the spectrum M . Then, Sherenga reports the path with the
highest score.
Below, we describe the scoring function of Sherenga. Assume that the
spectrometer produces noise uniformly and randomly with probability qR .
Furthermore, we assume qb is the probability that the b-ion peak exists in
M given the b-ion appears in the theoretical spectrum. Similarly, we assume
qy is the probability that the y-ion peak exists in M given the y-ion appears
in the theoretical spectrum. The probabilities qR , qb , qy can be determined
empirically.
Peptide Sequencing 319
For every vertex of mass v in the spectrum graph G(M ), the score of v,
score(v), is dened as the sum of two log-odd ratio scoreb (v) and scorey (v)
where
"
log qqRb if v + 1 exists in M
scoreb (v) = 1qb
log 1qR otherwise
" q
log qRy if W v + 19 exists in M
scorey (v) = 1qy
log 1qR otherwise
| |
( M (r)).
||
r
Step 4 selects the top 500 t sequences with the highest preliminary scores
and reranks them by the matching score which is dened as follows. For each
of the top 500 t sequences P , SEQUEST creates a theoretical spectrum Mth
containing the following peaks:
peaks for all y-ions and b-ions of P . They are assigned intensity 50.
peaks for 1 of y-ions and b-ions of P . They are assigned intensity 25.
peaks for a-ions and natural loss of water and ammonia of P . They are
assigned intensity 10.
12.8 Exercises
1. Can you take an experimental spectrum and try PepNovo, SEQUEST?
2. Consider the sequence SAGT P V . Can you show its theoretical spec-
trum? In the spectrum, show the peaks for b-ion, a-ion, (b-H2 O)-ion,
y-ion, and (y-N H3 )-ion.
3. Consider a protein sequence ST ACKP CHGCKCCT V RP T CRGS. Af-
ter the digestion of trypsin, what is the set of peptides?
4. Given a spectrum M , Section 12.4.1 describes a dynamic programming
algorithm which nds a peptide P maximizing the sum of intensities
of the peaks corresponding to the y-ions of P . Can you modify the
algorithm so that it reports a peptide P which maximizes the sum of
intensities of the peaks corresponding to the y-ions, (y-H2 O)-ions, and
(y-N H3 )-ions of P .
5. For the sandwich algorithm in Figure 12.14, can you explain why we
only need to ll in entries V (r, s) for |r s| a?
6. Consider a spectrum M with a set of peaks {88.08, 130.12, 175.19, 201.2,
232.24, 258.25, 303.32}. Suppose qR = 0.1, qb = 0.8, and qy = 0.9. Also,
the weight of the peptide is 413.44. Can you construct the spectrum
graph G(M )? Can you predict the peptide sequence from G(M )?
Chapter 13
Population Genetics
13.1 Introduction
As stated in Chapter 1, although our genomes are highly similar (approxi-
mately 99.9% identical), genetic variations (polymorphism) exist in dierent
individuals. Those variations give dierent skin colors, dierent outlooks,
and also dierent genetic diseases. This chapter discusses various strategies
to study the dierences in the human population.
323
324 Algorithms in Bioinformatics A Practical Introduction
i j
Individual 1: ...ACGTCATG...
...ACGCCATG...
Individual 2: ...ACGCCATG...
...ACGCCATG...
Individual 3: ...ACGTCATG...
...ACGTCATG...
Individual 4: ...ACGTCATG...
...ACGTCATG...
Given a set of individuals, we can compute the frequencies of the two alleles
of the SNP. The allele with the lower frequency is called the minor allele. For
the example in Figure 13.1, loci i is an SNP with two alleles T and C. The
allele frequency of T is 5/8 while the allele frequency of C is 3/8. In this case,
C is the minor allele and the minor allele frequency is 3/8.
SNPs are expected to make up 90% of all human genetic variations. SNPs
with a minor allele frequency of 1% occur every 100 to 300 bases along
the human genome, on average. Two thirds of the SNPs substitute cytosine
(C) with thymine (T). Through the collaborative eort of many countries,
we already have identied the set of common SNPs in the human population.
(Please visit the webpage of the HapMap project http://www.hapmap.org/ for
more details.)
For the above example of 10 individuals, it can easily be veried that they
satisfy this simple relationship.
Population Genetics 325
--------A-------C-------- --------A-------T--------
--------C-------T-------- --------C-------C--------
1. Random mating: We assume the mating between male and female in-
dividuals is a random process.
Suppose the locus i is diallelic and has two possible alleles A and a. Let pA
and pa be the major and minor allele frequencies. Under the HWE assump-
tions, the two alleles at locus i are independent. Hence, the expected frequen-
cies of the three dierent genotypes are: e(AA) = pA pA , e(aa) = pa pa ,
and e(Aa) = 2pA pa . If the genotype frequencies for AA, aa, and Aa are
similar to the expected frequencies e(AA), e(aa), and e(Aa), respectively, we
say the genotype frequencies satisfy HWE.
Let n be the size of the population. Let nA and na be the number of
occurrences of the alleles A and a, respectively, at locus i. Let nAA , naa ,
and nAa be the number of occurrences of the genotypes AA, aa, and Aa,
respectively, at locus i. We have the following table.
Population Genetics 327
AA aa Aa total
allele A 2nAA 0 nAa nA
allele a 0 2naa nAa na
2nAA 2naa 2nAa n
For a xed nA and na , we observe that the number of heterozygous geno-
types nAa determines the numbers of homozygous genotypes naa and nAA .
Precisely, nAA = (nA nAa )/2 and naa = (na nAa )/2.
To determine if the genotype frequencies satisfy HWE, we ask the following
question: For a xed number of alleles nA and na , what is the probability that
the number of heterozygous genotypes equal nAa ? Below, we apply the Fisher
exact test to determine such probability, which is denoted as P r(nAa | nA , na ).
Note that
2n the number of combinations where there are nA s A in the popu-
(2n)!
lation is nA = nA !na ! and the number of combinations where there are nAa s
nAa
heterozygous genotypes is nAa2!nAAn!!naa ! . Hence, we have
nA !na ! 2nAa n!
P r(nAa | nA , na ) = nA nAa na nAa
(2n)! nAa ! 2 ! 2 !
13.3.1 D and D
Consider two loci where locus 1 has two possible alleles A and a (pa +pA = 1)
while locus 2 has two possible alleles B and b (pb + pB = 1). If loci 1 and 2 are
independent, we have pAB = pA pB , pAb = pA pb , paB = pa pB , and pab = pa pb .
We dene the linkage disequilibrium coecient D = pAB pA pB . D is
in the range 0.25 to 0.25. Also, it is easily shown that D = pab pa pb =
pA pb pAb = pa pB paB (see Exercise 9). If linkage disequilibrium (LD) is
present (i.e., A and B have some dependence), then D is non-zero.
D is highly dependent on the allele frequency and is not good for measuring
the strength of LD. Therefore, a normalized measurement is dened: D =
D/Dmax where Dmax is the maximum possible value for D given pA and pB .
Precisely, Dmax = max{pAB pA pB } = min{pA , pB } pA pB . When |D | = 0,
the two loci are independent. When |D | = 1, we call it the complete LD.
For example, consider a set of allele pairs AB, Ab, aB, Ab, ab, ab, ab. We
have pAB = 17 , pA = 37 , and pB = 27 . Hence, D = 17 37 72 = 49
1
.
Dmax = 7 7 7 = 49 . Hence, D = D/Dmax = 8 .
2 32 8 1
13.3.2 r2
2
r2 measures the correlation of two loci. We dene r2 = pA pD a pB pb
. When
2
r = 1, the two loci are completely dependent, that is, we can deduce the
allele on loci 2 given the allele on loci 1, and vice versa. We call it the perfect
LD.
For example, consider the set of allele pairs AB, Ab, aB, Ab, ab, ab, ab again.
pAB = 1/7, pA = 3/7, pB = 2/7, and D = 1/49. Hence, r2 = (1/49)2 /(3/7
4/7 2/7 5/7) = 1/120.
000
1 2 3 1 2
100 010
G1 2 2 0
3
G2 0 1 2 H1 H3 011 H2 H1
G3 2 2 2
H2 H3
LEMMA 13.1
A set of haplotypes H admits a perfect phylogeny if and only if there are no
two columns i and j containing all four pairs 00, 01, 10, and 11.
7 7
1 2 3 4 5 6 7
1
G1 1 1 0 2 2 0 2 5 4 5 4
G2 1 2 2 0 0 2 0 1 1
G3 1 1 2 2 0 0 0 3 3
G4 2 2 2 0 0 2 0 1 2 3 4 5 6 7
2 1 2 1
G5 1 1 2 2 2 0 0 H1 1 1 0 1 1 0 0
G6 1 1 0 2 0 0 2 H1 1 1 0 0 0 0 1
6 6
H2 1 1 1 0 0 1 0
(a) (b) (c)
H2 1 0 0 0 0 0 0
H3 1 1 1 0 0 0 0
7
1 1 H3 1 1 0 1 0 0 0
5 0 4 H4 1 1 1 0 0 1 0
1 1 H4 0 0 0 0 0 0 0
3 H5 1 1 1 0 0 0 0
00 0 H5 1 1 0 1 1 0 0
2 0 1
0 0 H6 1 1 0 1 0 0 0
6 H6 1 1 0 0 0 0 1
(d) (e)
FIGURE 13.3: (a) A set G of six genotypes. (b) The graph GM . (c)
The graph GM with all the in-phase and out-of-phase edges colored. The red
colored (color 0) edges are in-phase while the blue colored (color 1) edges are
out-of-phase. Note that, for this example, there are only out-of-phase edges.
(d) The same graph GM after we infer the colors of those uncolored edges in
(c). Note that the colors of every triangle satisfy Lemma 13.2. (e) The set of
haplotypes H that can resolve G. (See color insert after page 270.)
Population Genetics 333
Note that if there exists a pair of columns c and c which is both in-phase
and out-of-phase, the pair of columns contains 00, 01, 10, and 11. This violates
the 4-gamete test and thus, M has no solution to the PPH problem. Below,
we assume none of the column pairs in M is both in-phase and out-of-phase.
We now study how to determine if G has a solution to the PPH problem.
We rst dene a graph GM whose nodes represent the columns in G and a
pair of columns (c, c ) forms an edge if 22 appears in the pair of columns (c, c )
in G. (See Figure 13.3(b).) For every edge (c, c ) in GM , we color (c, c ) red
(or 0) and blue (or 1) if (c, c ) are in-phase and out-of-phase, respectively;
otherwise, the edge has no color. (See Figure 13.3(c).) We observe that when
(c, c ) is colored, there is only one way to resolve 22 appearing in the pair of
columns (c, c ) as follows.
If the pair of columns c and c is in-phase (red color), then for every row
r in G which is 22, the haplotypes in rows 2r and 2r 1 of H must be
either 11 or 00; otherwise, it violates the 4-gamete test.
If the pair of columns c and c is out-of-phase (blue color), then for every
row r in G which is 22, the haplotypes in rows 2r and 2r 1 of H must
be either 10 or 01; otherwise, it violates the 4-gamete test.
For the uncolored edges, we can infer their colors. If the inferred colors
have no conict with the colored edges, Bafna et al. showed that G has a
solution to the PPH problem. The lemma below formally states the necessary
and sucient condition to determine if G has a solution to the PPH problem.
LEMMA 13.2
Consider a matrix M where none of the column pairs is both in-phase and
out-of-phase. There is a solution to the PPH problem for M if and only if we
can infer the colors of all edges in GM such that for any triangle (i, j, k) in
GM where G(r, i) = G(r, j) = G(r, k) = 2 for some row r, either 0 or 2 edges
of the triangle are colored blue.
Algorithm PPH
Require: The n m ternary matrix M representing the genotypes. We
require that none of the character pairs in M is both in-phase and
out-of-phase.
Ensure: A 2n m binary matrix H representing the haplotypes, if it
exists.
1: Create a graph GM whose nodes represent the columns in G and a
pair of columns (c, c ) forming an edge if 22 appears in the pair of
columns (c, c ) in G.
2: For every edge (c, c ) in GM , (c, c ) is colored red and blue if (c, c )
are in-phase and out-of-phase, respectively; otherwise, the edge has
no color.
3: The colors for all the uncolored edges in GM are inferred based on
Lemma 13.2.
4: We compute the matrix H so that every column pair satises the
in-phase (red) and the out-of-phase (blue) constraints in GM .
FIGURE 13.4: Algorithm by Bafna et al. [16] for solving the PPH problem.
the algorithm. Each edge in GM can be generated and colored in O(n) time.
Since there are m2 edges in GM , Steps 1 and 2 take O(nm2 ) time. Step 3 can
be solved in O(m2 ) time. Step 4 takes O(nm) time.
For example, consider the genotype G2 = 0221. Since there are two het-
erozygous loci, we have 22 = 4 possible haplotypes: H2 = {h1 = 0001, h2 =
0011, h3 = 0101, h4 = 0111}. The set of all haplotype pairs that resolve 0221
is S2 = {h1 h4 , h2 h3 }.
We denote H = {h1 , h2 , . . . , hm } = ni=1 Hi as the set of all possible haplo-
types that can resolve G. Our aim is to estimate the frequencies Fj of hj for
hj H. Note that F1 + F2 + . . . + Fm = 1.
Given the frequency F = {F1 , F2 , . . . , Fm }, the probability of generating
genotype Gi , for i = 1, 2, . . . , m, can be computed using the following formula.
P r(Gi |F ) = Fx Fy
hx hy resolve Gi
Excoer and Slatkin [99] proposed nding the frequencies F which maxi-
mize the overall probability product of all P (Gi ), that is, the following func-
tion
L(F ) = P r(G|F ) = ni=1 P r(Gi |F )
In principle, F can be identied by solving the equation for L(F ). However,
there is no close form. Instead, the expectation maximization (EM) method
is used. The EM algorithm tries to iteratively improve the estimation of the
(t) (t)
haplotype frequency F (t) = {F1 , . . . , Fm } for t = 0, 1, . . . by performing two
steps: the expectation step and the maximization step.
Assume we have an initial estimation of the haplotype frequency F (0) =
(0) (0)
{F1 , . . . , Fm }. For the t-th iteration where t = 0, 1, . . ., the expectation
step (E-step) tries to estimate, for every Gi and for every pair of haplotypes
hx hy that resolves Gi , the haplotype pair frequency P (hx hy |Gi , F (t) ). Given
F (t) , we have
P r(hx hy |F (t) )
P r(hx hy |Gi , F (t) ) =
resolves Gi P r(ha hb |F
(t) )
ha hb
(t) (t)
Fx Fy
= (t) (t)
ha hb resolves Gi Fa Fb
1
n
Fx(t+1) = (hx , hx hy )P r(hx hy |Gi , F (t) )
2n i=1
hx hy resolves Gi
(1)
F2 = 2n P r(h1 h2 |G3 , F
1 (0)
) = 1
12
(1)
F3 = 2n [P r(h1 h3 |G2 , F
1 (0)
) + P r(h3 h4 |G3 , F (0) )] = 3
12
(1)
F4 = 2n P r(h3 h4 |G3 , F
1 (0)
) = 1
12
The above demonstration means that a genotype is likely to use some haplo-
types h which are the same or similar to some frequently observed haplotypes
H. Formally, Stephens and Donnelly [272] derived an equation to approx-
imate the probability P r(h|H). For any haplotype H, let F be the
haplotype frequency of in the population. Note that H F = 1. Sup-
pose the population size is n. Let be the scaled mutation rate and P be the
substitution matrix (see Section 2.6). We have
s
n
P r(h|H) = F (P s )h (13.1)
n+ n+
H s=0
represent the rest of the SNPs. This section studies two methods for tag SNP
selection.
For r8 ..r11 , r8 and r11 are selected as the tag SNPs. If r8 = 0 and
r11 = 0, we predict r8 ..r11 = 0010. If r8 = 0 and r11 = 1, we predict
r8 ..r11 = 0111. If r8 = 1 and r11 = 1, we predict r8 ..r11 = 1101. Such a
pair of tag SNPs can predict correctly all six haplotypes.
example, in the block r1 ..r3 of Figure 13.5, we have the following haplotypes:
three 010, two 101 and one 100. To distinguish 80% of these haplotypes, we
need one tag SNP, that is, r1 . To distinguish 100% of these haplotypes, we
need at least two tag SNPs, that is, r1 and r3 . If = 80%, f (r1 ..r3 ) = 1.
If = 100%, f (r1 ..r3 ) = 2. Computing f (ri ..rj ) is NP-complete as it is
equivalent to the minimum test set problem [115]. Moreover, since the pro-
gram generally will compute f (ri ..rj ) when f (ri ..rj ) is small, we can compute
f (ri ..rj ) by enumerating all possible tag SNP sets.
We use dynamic programming to compute the minimum number of tag
SNPs. We denote S(i) as the minimum number of tag SNPs which can dis-
tinguish at least % of the haplotypes in r1 ..ri . Note that S(i) satises the
following recursive equation.
S(0) = 0
S(i) = min{S(j 1) + f (rj ..ri ) | 1 j i}
In practice, there may exist several block partitions that give the minimum
number of tag SNPs. We also want to minimize the number of blocks. Let
C(i) be the minimum number of blocks so that the number of tag SNPs is
S(i). We have
C(0) = 0
C(i) = min{C(j 1) + 1 | 1 j i, S(i) = S(j 1) + f (rj ..ri )}
13.5.2 IdSelect
Carlson et al. [51] suggested another method, IdSelect, for selecting tag
SNPs. Among a set S of all SNPs exceeding a specied minor allele frequency
(MAF) threshold, the objective is to select a subset T of SNPs S such that
for any SNP i in S, there exists an SNP j in T so that r2 (i, j) > th for some
threshold th. IdSelect is a greedy algorithm. It is shown in Figure 13.6.
A disadvantage of IdSelect is that it tends to include many rare SNPs as
the tag SNPs. Since rare SNPs are harder to link with other SNPs, it is not
very nature.
Algorithm IdSelect
Require: A set S of SNPs that are above the MAF threshold.
Ensure: A subset T S such that for every SNP i in S, there exists an
SNP j in T such that r2 (i, j) > th.
1: Let T =
2: while S is not empty do
3: Select s S which maximizes the size of the set {s S | r2 (s, s ) >
th}.
4: T = T {s}.
5: S = S {s} {s S | r2 (s, s ) > th}.
6: end while
7: Report T
Allele a Allele A
Lung cancer samples 60 20
Control samples 10 70
FIGURE 13.7: The table shows an experiment for 80 lung cancer patients
and 80 normal patients. From the relative risk and the odds ratio, patients
with allele a have higher risk of suering from lung cancer.
0 1 2
case n0,case n1,case n2,case
control n0,ctl n1,ctl n2,ctl
(a)
Allele a Allele A
case p = 2n0,case + n2,case q = 2n1,case + n2,case
control r = 2n0,ctl + n2,ctl s = 2n1,ctl + n2,ctl
(b)
FIGURE 13.8: (a) Genotype frequencies for case and control samples. (b)
Allele frequencies for case and control samples.
p/(p + q)
RR =
r/(r + s)
The relative risk is always greater than or equal to zero. If RR < 1, allele
a has a higher chance of occurring in the control samples. If RR = 1, allele
a has an equal chance of occurring in the case and the control samples. If
RR > 1, allele a has a higher chance of occurring in the case samples.
The odds ratio (OR) is dened as the ratio of the odds of the allele a
occurring in the case samples versus the odds of the allele a occurring in the
342 Algorithms in Bioinformatics A Practical Introduction
Hence, we have
n n
yi n0 1 xi = 0 (13.2)
i=1 i=1
Hence, we have
xi yi 0 xi 1 x2i = 0 (13.3)
i=1..n i=1..n i=1..n
0 = y 1 x (13.5)
where x = n1 i=1..n xi and y = n1 i=1..n yi .
Note that 1
= 0 means that the SNP is associated with the phenotype.
To test if 1
= 0, we apply an
F-test. We let2 yi = 10 + 1 xi . Let the mean
square error (MSE) be n2 1
(y i y i ) = 2 and let the
i=1..n n2 i=1..n2 i
mean square error of regression (MSR) be i=1..n (yi y ) . Then, MSE MSR
MSR
follows the F-distribution. If MSE > F1,n2,0.95 , we reject the hypothesis
that 1 = 0.
For example, consider a set of n = 16 samples. Figure 13.9 shows the
genotypes
and the phenotypic scores of those 16 samples. We have x =
i=1..n xi = 0.8125 and y = i=1..n yi = 2.55625. By Equations 13.4 and
13.5, we have 0 = 2.2415 and 1 = 0.3874. Hence, the best t linear equation
is y = 2.2415+0.3874x+. Note that M SR = 1.266338 and M SE = 0.040931.
MSR
We have MSE = 30.03819, which is bigger than F1,14,0.95 = 4.6. Hence, we
accept 1
= 0 and we expect the phenotypic score is associated with the
genotype.
P rcase
= 0 + 1 X.
1 P rcase
13.7 Exercises
1. Can you prove Lemma 13.2?
Genotype AA Aa aa
Actual 100 50 50
4. Can you deduce the haplotypes for the following four genotypes using
Clarks algorithm?
G1 = 122101
G2 = 210101
G3 = 022121
G4 = 201121
G1 : 1012
G2 : 2220
G3 : 1020
G4 : 2210
6. Can you deduce the haplotypes for the following three genotypes using
the EM algorithm? We assume that the initial haplotype frequencies
are uniform and we only execute the EM algorithm for one round.
G1 = 122
G2 = 210
G3 = 212
7. Consider the following genotype matrix M . Can you detail the steps
of Bafna et al.s method to solve the perfect phylogeny haplotyping
problem?
M 1 2 3 4 5 6
G1 1 1 0 2 2 0
G2 1 2 2 0 0 2
G3 1 1 2 2 0 0
G4 2 2 2 0 0 2
G5 1 1 2 2 2 0
8. Consider the following genotype matrix M . Can you detail the steps
of Bafna et al.s method to solve the perfect phylogeny haplotyping
problem?
M 1 2 3 4
G1 0 2 1 1
G2 2 0 1 1
G3 2 2 1 1
G4 0 0 1 2
G5 0 0 2 1
G6 0 0 2 2
Suppose there is an additional row G7 = (2, 2, 2, 1). Can you detail the
steps of Bafna et al.s method to solve the perfect phylogeny haplotyping
problem?
9. Consider loci 1 and 2. Suppose the allele for locus 1 is either A or
a and the allele for locus 2 is either B or b. Suppose A and B are
associated such that (1) pAB = pA pB + D1 , (2) pAb = pA pb D2 ,
(3) paB = pa pB D3 , and (4) pab = pa pb + D4 . Can you show that
D1 = D2 = D3 = D4 ?
10. Consider the following two SNPs.
SNP1: Case 40 A, 160 C, Control 20 A, 180 C,
SNP2: Case 20 A, 180 C, Control 10 A, 190 C.
Can you compute the relative risk and the odds ratio for the two SNPs?
Which SNP has a higher risk?
Population Genetics 347
Can you perform associated study for the SNP using logistic regression?
References
349
350 References
[78] Z. Ding, V. Filkov, and D. Guseld. A linear-time algorithm for the per-
fect phylogeny haplotyping (PPH) problem. Journal of Computational
Biology, 13(2):522553, 2006.
[79] C. B. Do and K. Katoh. Protein multiple sequence alignment. Func-
tional Proteomics, pages 379413, 2008.
[80] C. B. Do, M. S. P. Mahabhashyam, M. Brudno, and S. Batzoglou. Prob-
Cons: Probabilistic consistency-based multiple sequence alignment.
Genome Research, 15(2):330340, 2005.
[81] T. Dobzhansky and A. H. Sturtevant. Inversions in the chromosomes
of drosophila pseudoobscura. Genetics, 23:2864, 1928.
[82] R. F. Doolittle, M. Hunkapiller, L. E. Hood, S. Devare, K. Robbins,
S. Aaronson, and H. Antoniades. Simian sarcoma virus, onc gene v-sis,
is derived from the gene (or genes) encoding a platelet-derived growth
factor. Science, 221:275277, 1983.
[83] W. F. Doolittle. Phylogenetic classication and the universal tree. Sci-
ence, 284(5423):21242128, 1999.
[84] T. A. Down and T. J. P. Hubbard. NestedMICA: Sensitive inference of
over-represented motifs in nucleic acid sequence. Nucleic Acids Res, 33
(5):14451453, 2005.
[85] I. Dubchak, A. Poliakov, A. Kislyuk, and M. Brudno. Multiple whole-
genome alignments without a reference organism. Genome Research, 19
(4):682689, 2009.
[86] L. Duret and S. Abdeddaim. Multiple alignment for structural, func-
tional or phylogenetic analyses of homologous sequences. In D. Higgins
and W. Taylor, editors, Bioinformatics sequence structure and data-
banks, 2000.
[87] S. R. Eddy and R. Durbin. RNA sequence analysis using covariance
models. Nucleic Acids Research, 22:20792088, 1994.
[88] R. C. Edgar. MUSCLE: A multiple sequence alignment method with
reduced time and space complexity. BMC Bioinformatics, 5:113, 2004.
[89] R. C. Edgar. MUSCLE: Multiple sequence alignment with high accuracy
and high throughput. Nucleic Acids Research, 32:17921797, 2004.
[90] R. C. Edgar and S. Batzoglou. Multiple sequence alignment. Current
Opinion in Structural Biology, 16:368373, 2006.
[91] R. C. Edgar and K. Sjoander. COACH: Prole-prole alignment of
protein families using hidden markov models. Bioinformatics, 20(8):
13091318, 2004.
356 References
[292] M. Tompa. An exact method for nding short motifs in sequences, with
application to the ribosome binding site problem. In Proceedings of the
Seventh International Conference on Intelligent Systems on Molecular
Biology, pages 262271, 1999.
375
376 Index
translation, 13, 15
translation start site, 15
translation stop site, 15
translocation, 12, 225
transposition, 99, 225
triangle inequality, 179
trie, 57
triphosphate nucleotide, 5
triplet, 219
triplet distance, 213, 223
tRNA, 10, 15, 16
turn, 4
two-hit requirement, 116, 121
WebMotifs, 267
Weeder, 267, 268
whole genome alignment problem, 87
WINNOWER, 266
wobble base pair, 282
x-ion, 308
y-ion, 308
z-ion, 308
ZUKER algorithm, 290