100% found this document useful (3 votes)
629 views282 pages

Think Python

This document summarizes the preface of the book "Think Python" by Allen B. Downey. It discusses the origins and development of the book, which started as a Java textbook but was translated to Python. The author's goals were to keep it short, use careful vocabulary, and build concepts gradually. It was released under an open license. Over the years, the author has continued improving the book based on feedback, adding exercises and case studies. Many contributors have helped by submitting corrections and suggestions.

Uploaded by

Nimisha Singh
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
100% found this document useful (3 votes)
629 views282 pages

Think Python

This document summarizes the preface of the book "Think Python" by Allen B. Downey. It discusses the origins and development of the book, which started as a Java textbook but was translated to Python. The author's goals were to keep it short, use careful vocabulary, and build concepts gradually. It was released under an open license. Over the years, the author has continued improving the book based on feedback, adding exercises and case studies. Many contributors have helped by submitting corrections and suggestions.

Uploaded by

Nimisha Singh
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

ThinkPython/Printversion Preface
Chapter0:Preface
Thestrangehistoryofthisbook
(ThissectionwaswrittenbyAllenB.Downey[1]) InJanuary1999,IwaspreparingtoteachanintroductoryprogrammingclassinJava.IhadtaughtitthreetimesandIwasgettingfrustrated.Thefailurerate intheclasswastoohighand,evenforstudentswhosucceeded,theoveralllevelofachievementwastoolow. OneoftheproblemsIsawwasthebooks.Theyweretoobig,withtoomuchunnecessarydetailaboutJava,andnotenoughhighlevelguidanceabouthowto program.Andtheyallsufferedfromthe"trapdooreffect":theywouldstartouteasy,proceedgradually,andthensomewherearoundChapter5thebottom wouldfallout.Thestudentswouldgettoomuchnewmaterial,toofast,andIwouldspendtherestofthesemesterpickingupthepieces. Twoweeksbeforethefirstdayofclass,Idecidedtowritemyownbook. Mygoalswere: Keepitshort.Itisbetterforstudentstoread10pagesthanread50pages. Becarefulwithvocabulary.Itriedtominimizethejargonanddefineeachtermatfirstuse. Buildgradually.Toavoidtrapdoors,Itookthemostdifficulttopicsandsplitthemintoaseriesofsmallsteps. Focusonprogramming,nottheprogramminglanguage.IincludedtheminimumusefulsubsetofJavaandleftouttherest. Ineededatitle,soonawhimIchose HowtoThinkLikeaComputerScientist . Myfirstversionwasrough,butitworked.Studentsdidthereading,andtheyunderstoodenoughthatIcouldspendclasstimeonthehardtopics,the interestingtopicsand(mostimportant)lettingthestudentspractice. IreleasedthebookundertheGNUFreeDocumentationLicense,whichallowsuserstocopy,modify,anddistributethebook. Whathappenednextisthecoolpart.JeffElkner,ahighschoolteacherinVirginia,adoptedmybookandtranslateditintoPython.Hesentmeacopyofhis translation,andIhadtheunusualexperienceoflearningPythonbyreadingmyownbook. JeffandIrevisedthebook,incorporatedacasestudybyChrisMeyers,andin2001wereleased HowtoThinkLikeaComputerScientist:Learningwith Python,alsoundertheGNUFreeDocumentationLicense.AsGreenTeaPress,IpublishedthebookandstartedsellinghardcopiesthroughAmazon.comand collegebookstores.OtherbooksfromGreenTeaPressareavailableatgreenteapress.com(http://www.greenteapress.com/). In2003,IstartedteachingatOlinCollegeandIgottoteachPythonforthefirsttime.ThecontrastwithJavawasstriking.Studentsstruggledless,learned more,workedonmoreinterestingprojects,andgenerallyhadalotmorefun. OverthelastfiveyearsIhavecontinuedtodevelopthebook,correctingerrors,improvingsomeoftheexamplesandaddingmaterial,especiallyexercises.In

en.wikibooks.org/wiki/Think_Python/Print_version

1/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

OverthelastfiveyearsIhavecontinuedtodevelopthebook,correctingerrors,improvingsomeoftheexamplesandaddingmaterial,especiallyexercises.In 2008Istartedworkonamajorrevisionatthesametime,IwascontactedbyaneditoratCambridgeUniversityPresswhowasinterestedinpublishingthe nextedition.Goodtiming! Theresultisthisbook,nowwiththelessgrandiosetitle ThinkPython.Someofthechangesare: Iaddedasectionaboutdebuggingattheendofeachchapter.Thesesectionspresentgeneraltechniquesforfindingandavoidingbugs,andwarnings aboutPythonpitfalls. Iremovedthematerialinthelastfewchaptersabouttheimplementationoflistsandtrees.Istilllovethosetopics,butIthoughttheywereincongruent withtherestofthebook. Iaddedmoreexercises,rangingfromshorttestsofunderstandingtoafewsubstantialprojects. Iaddedaseriesofcasestudieslongerexampleswithexercises,solutions,anddiscussion.SomeofthemarebasedonSwampy,asuiteofPython programsIwroteforuseinmyclasses.Swampy,codeexamples,andsomesolutionsareavailablefromthinkpython.com (http://www.thinkpython.com). Iexpandedthediscussionofprogrammingdevelopmentplansandbasicdesignpatterns. TheuseofPythonismoreidiomatic.Thebookisstillaboutprogramming,notPython,butnowIthinkthebookgetsmoreleveragefromthelanguage. Ihopeyouenjoyworkingwiththisbook,andthatithelpsyoulearntoprogramandthink,atleastalittlebit,likeacomputerscientist. AllenB.Downey NeedhamMA AllenDowneyisanAssociateProfessorofComputerScienceattheFranklinW.OlinCollegeofEngineering.

Acknowledgements
Firstandmostimportantly,IthankJeffElkner,whotranslatedmyJavabookintoPython,whichgotthisprojectstartedandintroducedmetowhathasturned outtobemyfavoritelanguage. IalsothankChrisMeyers,whocontributedseveralsectionsto HowtoThinkLikeaComputerScientist . AndIthanktheFreeSoftwareFoundationfordevelopingtheGNUFreeDocumentationLicense,whichhelpedmakemycollaborationwithJeffandChris possible. IalsothanktheeditorsatLuluwhoworkedon HowtoThinkLikeaComputerScientist . Ithankallthestudentswhoworkedwithearlierversionsofthisbookandallthecontributors(listedbelow)whosentincorrectionsandsuggestions. AndIthankmywife,Lisa,forherworkonthisbook,andGreenTeaPress,andeverythingelse,too.

ContributorList

en.wikibooks.org/wiki/Think_Python/Print_version

Morethan100sharpeyedandthoughtfulreadershavesentinsuggestionsandcorrectionsoverthepastfewyears.Theircontributions,andenthusiasmfor

2/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Morethan100sharpeyedandthoughtfulreadershavesentinsuggestionsandcorrectionsoverthepastfewyears.Theircontributions,andenthusiasmfor thisproject,havebeenahugehelp. Ifyouhaveasuggestionorcorrection,pleasesendemailto f e e d b a c k @ t h i n k p y t h o n . c o m .IfImakeachangebasedonyourfeedback,Iwilladdyoutothecontributor list(unlessyouasktobeomitted). Ifyouincludeatleastpartofthesentencetheerrorappearsin,thatmakesiteasyformetosearch.Pageandsectionnumbersarefine,too,butnotquiteas easytoworkwith.Thanks! LloydHughAllensentinacorrectiontoSection8.4. YvonBouliannesentinacorrectionofasemanticerrorinChapter5. FredBremmersubmittedacorrectioninSection2.1. JonahCohenwrotethePerlscriptstoconverttheLaTeXsourceforthisbookintobeautifulHTML. MichaelConlonsentinagrammarcorrectioninChapter2andanimprovementinstyleinChapter1,andheinitiateddiscussiononthetechnical aspectsofinterpreters. BenoitGirardsentinacorrectiontoahumorousmistakeinSection5.6. CourtneyGleasonandKatherineSmithwrote h o r s e b e t . p y ,whichwasusedasacasestudyinanearlierversionofthebook.Theirprogramcannowbe foundonthewebsite. LeeHarrsubmittedmorecorrectionsthanwehaveroomtolisthere,andindeedheshouldbelistedasoneoftheprincipaleditorsofthetext. JamesKaylinisastudentusingthetext.Hehassubmittednumerouscorrections. DavidKershawfixedthebroken c a t T w i c e functioninSection3.10. EddieLamhassentinnumerouscorrectionstoChapters1,2,and3.HealsofixedtheMakefilesothatitcreatesanindexthefirsttimeitisrunand helpedussetupaversioningscheme. ManYongLeesentinacorrectiontotheexamplecodeinSection2.4. DavidMayopointedoutthattheword"unconsciously"inChapter1neededtobechangedto"subconsciously". ChrisMcAloonsentinseveralcorrectionstoSections3.9and3.10. MatthewJ.Moelterhasbeenalongtimecontributorwhosentinnumerouscorrectionsandsuggestionstothebook. SimonDiconMontfordreportedamissingfunctiondefinitionandseveraltyposinChapter3.Healsofounderrorsinthe i n c r e m e n t functioninChapter13. JohnOuztscorrectedthedefinitionof"returnvalue"inChapter3. KevinParkssentinvaluablecommentsandsuggestionsastohowtoimprovethedistributionofthebook. DavidPoolsentinatypointheglossaryofChapter1,aswellaskindwordsofencouragement. MichaelSchmittsentinacorrectiontothechapteronfilesandexceptions. RobinShawpointedoutanerrorinSection13.1,wherethe p r i n t T i m e functionwasusedinanexamplewithoutbeingdefined. PaulSleighfoundanerrorinChapter7andabuginJonahCohensPerlscriptthatgeneratesHTMLfromLaTeX. CraigT.SnydalistestingthetextinacourseatDrewUniversity.Hehascontributedseveralvaluablesuggestionsandcorrections.
en.wikibooks.org/wiki/Think_Python/Print_version 3/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

IanThomasandhisstudentsareusingthetextinaprogrammingcourse.Theyarethefirstonestotestthechaptersinthelatterhalfofthebook,and theyhavemadenumerouscorrectionsandsuggestions. KeithVerheydensentinacorrectioninChapter3. PeterWinstanleyletusknowaboutalongstandingerrorinourLatininChapter3. ChrisWrobelmadecorrectionstothecodeinthechapteronfileI/Oandexceptions. MosheZadkahasmadeinvaluablecontributionstothisproject.InadditiontowritingthefirstdraftofthechapteronDictionaries,he providedcontinualguidanceintheearlystagesofthebook. ChristophZwerschkesentseveralcorrectionsandpedagogicsuggestions,andexplainedthedifferencebetween gleichand selbe. JamesMayersentusawholeslewofspellingandtypographicalerrors,includingtwointhecontributorlist. HaydenMcAfeecaughtapotentiallyconfusinginconsistencybetweentwoexamples. AngelArnalispartofaninternationalteamoftranslatorsworkingontheSpanishversionofthetext.HehasalsofoundseveralerrorsintheEnglish version. TauhidulHoqueandLexBerezhnycreatedtheillustrationsinChapter1andimprovedmanyoftheotherillustrations. Dr.MicheleAlzettacaughtanerrorinChapter8andsentsomeinterestingpedagogiccommentsandsuggestionsaboutFibonacciandOldMaid. AndyMitchellcaughtatypoinChapter1andabrokenexampleinChapter2. KalinHarveysuggestedaclarificationinChapter7andcaughtsometypos. ChristopherP.SmithcaughtseveraltyposandishelpinguspreparetoupdatethebookforPython2.2. DavidHutchinscaughtatypointheForeword. GregorLinglisteachingPythonatahighschoolinVienna,Austria.HeisworkingonaGermantranslationofthebook,andhecaughtacoupleofbad errorsinChapter5. JuliePeterscaughtatypointhePreface. FlorinOprinasentinanimprovementin m a k e T i m e ,acorrectionin p r i n t T i m e ,andanicetypo. D.J.WebresuggestedaclarificationinChapter3. KenfoundafistfuloferrorsinChapters8,9and11. IvoWevercaughtatypoinChapter5andsuggestedaclarificationinChapter3. CurtisYankosuggestedaclarificationinChapter2. BenLogansentinanumberoftyposandproblemswithtranslatingthebookintoHTML. JasonArmstrongsawthemissingwordinChapter2. LouisCordiernoticedaspotinChapter16wherethecodedidn'tmatchthetext. BrianCainsuggestedseveralclarificationsinChapters2and3. RobBlacksentinapasselofcorrections,includingsomechangesforPython2.2. JeanPhilippeReyatEcoleCentraleParissentanumberofpatches,includingsomeupdatesforPython2.2andotherthoughtfulimprovements. JasonMaderatGeorgeWashingtonUniversitymadeanumberofusefulsuggestionsandcorrections. JanGundtofteBruunremindedusthataerrorisanerror.
en.wikibooks.org/wiki/Think_Python/Print_version 4/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

AbelDavidandAlexisDinnoremindedusthatthepluralofmatrixismatrices,notmatrixes.Thiserrorwasinthebookforyears,buttworeaders withthesameinitialsreporteditonthesameday.Weird. CharlesThayerencouragedustogetridofthesemicolonswehadputattheendsofsomestatementsandtocleanupouruseofargumentand parameter. RogerSperbergpointedoutatwistedpieceoflogicinChapter3. SamBullpointedoutaconfusingparagraphinChapter2. AndrewCheungpointedouttwoinstancesofusebeforedef. C.CoreyCapelspottedthemissingwordintheThirdTheoremofDebuggingandatypoinChapter4. AlessandrahelpedclearupsomeTurtleconfusion. WimChampagnefoundabrainoinadictionaryexample. DouglasWrightpointedoutaproblemwithfloordivisionin a r c . JaredSpindorfoundsomejetsamattheendofasentence. LinPeihengsentanumberofveryhelpfulsuggestions. RayHagtvedtsentintwoerrorsandanotquiteerror. TorstenHbschpointedoutaninconsistencyinSwampy. IngaPetuhhovcorrectedanexampleinChapter14. ArneBabenhauserheidesentseveralhelpfulcorrections. MarkE.Casidaisisgoodatspottingrepeatedwords. ScottTylerfilledinathatwasmissing.Andthensentinaheapofcorrections. GordonShephardsentinseveralcorrections,allinseparateemails. AndrewTurner s p o t tedanerrorinChapter8. AdamHobartfixedaproblemwithfloordivisionin a r c . DarylHammondandSarahZimmermanpointedoutthatIservedup m a t h . p i tooearly.AndZimspottedatypo. GeorgeSassfoundabuginaDebuggingsection. BrianBinghamsuggestedExercise11.9. LeahEngelbertFentonpointedoutthatIused t u p l e asavariablename,contrarytomyownadvice.Andthenfoundabunchoftyposandausebefore def. JoeFunkespottedatypo. ChaochaoChenfoundaninconsistencyintheFibonacciexample. JeffPaineknowsthedifferencebetweenspaceandspam. LubosPintessentinatypo. GreggLindandAbigailHeithoffsuggestedExercise14.6. MaxHailperinpointedoutachangecominginPython3.0.Maxisoneoftheauthorsoftheextraordinary ConcreteAbstractions,whichyoumightwant toreadwhenyouaredonewiththisbook. ChotipatPornavalaifoundanerrorinanerrormessage.
en.wikibooks.org/wiki/Think_Python/Print_version 5/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

StanislawAntolsentalistofveryhelpfulsuggestions. EricPashmansentanumberofcorrectionsforChapters411. MiguelAzevedofoundsometypos. JianhuaLiusentinalonglistofcorrections. NickKingfoundamissingword. MartinZuthersentalonglistofsuggestions. AdamZimmermanfoundaninconsistencyinmyinstanceofaninstanceandseveralothererrors. RatnakarTiwarisuggestedafootnoteexplainingdegeneratetriangles. AnuragGoelsuggestedanothersolutionfor i s _ a b e c e d a r i a n andsentsomeadditionalcorrections.AndheknowshowtospellJaneAusten. KelliKratzerspottedoneoftheytypos. MarkGriffithspointedoutaconfusingexampleinChapter3. RoydanOngiefoundanerrorinmyNewtonsmethod.

Thefurtherstrangeadventuresofthisbook
InSeptemberof2008,WhiteknightconvertedtheHTMLversionof"ThinkPython"atGreenTeaPress[2]toaWikitextversionatWikibooks[3].Nowanyone canimprovethetext. 1. "Thestrangehistoryofthisbook"(http://www.greenteapress.com/thinkpython/html/book001.html)byAllenB.Downey 2. "ThinkPython"atGreenTeaPress(http://thinkpython.com/) 3. Wikibooks:ThinkPython(http://en.wikibooks.org/wiki/Think_Python)

Thewayoftheprogram
Thegoalofthisbookistoteachyoutothinklikeacomputerscientist.Thiswayofthinkingcombinessomeofthebestfeaturesofmathematics,engineering, andnaturalscience.Likemathematicians,computerscientistsuseformallanguagestodenoteideas(specificallycomputations).Likeengineers,theydesign things,assemblingcomponentsintosystemsandevaluatingtradeoffsamongalternatives.Likescientists,theyobservethebehaviorofcomplexsystems,form hypotheses,andtestpredictions. Thesinglemostimportantskillforacomputerscientistis problemsolving.Problemsolvingmeanstheabilitytoformulateproblems,thinkcreativelyabout solutions,andexpressasolutionclearlyandaccurately.Asitturnsout,theprocessoflearningtoprogramisanexcellentopportunitytopracticeproblem solvingskills.Thatswhythischapteriscalled,Thewayoftheprogram. Ononelevel,youwillbelearningtoprogram,ausefulskillbyitself.Onanotherlevel,youwilluseprogrammingasameanstoanend.Aswegoalong,that endwillbecomeclearer.

ThePythonprogramminglanguage
TheprogramminglanguageyouwilllearnisPython.Pythonisanexampleofa highlevellanguageotherhighlevellanguagesyoumighthaveheardofare C,C++,Perl,andJava.
en.wikibooks.org/wiki/Think_Python/Print_version 6/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Therearealso lowlevellanguages,sometimesreferredtoasmachinelanguagesorassemblylanguages.Looselyspeaking,computerscanonlyexecute programswritteninlowlevellanguages.Soprogramswritteninahighlevellanguagehavetobeprocessedbeforetheycanrun.Thisextraprocessingtakes sometime,whichisasmalldisadvantageofhighlevellanguages. Theadvantagesareenormous.First,itismucheasiertoprograminahighlevellanguage.Programswritteninahighlevellanguagetakelesstimetowrite, theyareshorterandeasiertoread,andtheyaremorelikelytobecorrect.Second,highlevellanguagesare portable,meaningthattheycanrunondifferent kindsofcomputerswithfewornomodifications.Lowlevelprogramscanrunononlyonekindofcomputerandhavetoberewrittentorunonanother. Duetotheseadvantages,almostallprogramsarewritteninhighlevellanguages.Lowlevellanguagesareusedonlyforafewspecializedapplications. Twokindsofprogramsprocesshighlevellanguagesintolowlevellanguages: interpretersand compilers.Aninterpreterreadsahighlevelprogramand executesit,meaningthatitdoeswhattheprogramsays.Itprocessestheprogramalittleatatime,alternatelyreadinglinesandperformingcomputations.

Acompilerreadstheprogramandtranslatesitcompletelybeforetheprogramstartsrunning.Inthiscontext,thehighlevelprogramiscalledthe sourcecode, andthetranslatedprogramiscalledthe objectcodeorthe executable.Onceaprogramiscompiled,youcanexecuteitrepeatedlywithoutfurther translation.

PythonisconsideredaninterpretedlanguagebecausePythonprogramsareexecutedbyaninterpreter.Therearetwowaystousetheinterpreter: interactive modeand scriptmode.Ininteractivemode,youtypePythonprogramsandtheinterpreterprintstheresult:


> > >1+1 2

Thechevron, > > > ,isthe prompttheinterpreterusestoindicatethatitisready.Ifyoutype 1+1 ,theinterpreterreplies 2 . Alternatively,youcanstorecodeinafileandusetheinterpretertoexecutethecontentsofthefile,whichiscalleda script.Byconvention,Pythonscripts havenamesthatendwith . p y .
en.wikibooks.org/wiki/Think_Python/Print_version 7/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Toexecutethescript,youhavetotelltheinterpreterthenameofthefile.InaUNIXcommandwindow,youwouldtype p y t h o nd i n s d a l e . p y .Inotherdevelopment environments,thedetailsofexecutingscriptsaredifferent.YoucanfindinstructionsforyourenvironmentatthePythonWebsite p y t h o n . o r g . Workingininteractivemodeisconvenientfortestingsmallpiecesofcodebecauseyoucantypeandexecutethemimmediately.Butforanythingmorethana fewlines,youshouldsaveyourcodeasascriptsoyoucanmodifyandexecuteitinthefuture.

Whatisaprogram?
A programisasequenceofinstructionsthatspecifieshowtoperformacomputation.Thecomputationmightbesomethingmathematical,suchassolvinga systemofequationsorfindingtherootsofapolynomial,butitcanalsobeasymboliccomputation,suchassearchingandreplacingtextinadocumentor (strangelyenough)compilingaprogram. Thedetailslookdifferentindifferentlanguages,butafewbasicinstructionsappearinjustabouteverylanguage: input: Getdatafromthekeyboard,afile,orsomeotherdevice. output: Displaydataonthescreenorsenddatatoafileorotherdevice. math: Performbasicmathematicaloperationslikeadditionandmultiplication. conditionalexecution: Checkforcertainconditionsandexecutetheappropriatesequenceofstatements. repetition: Performsomeactionrepeatedly,usuallywithsomevariation. Believeitornot,thatsprettymuchallthereistoit.Everyprogramyouveeverused,nomatterhowcomplicated,ismadeupofinstructionsthatlookpretty muchlikethese.Soyoucanthinkofprogrammingastheprocessofbreakingalarge,complextaskintosmallerandsmallersubtasksuntilthesubtasksare simpleenoughtobeperformedwithoneofthesebasicinstructions. Thatmaybealittlevague,butwewillcomebacktothistopicwhenwetalkabout algorithms.

Whatisdebugging?
Programmingiserrorprone.Forwhimsicalreasons,programmingerrorsarecalled bugsandtheprocessoftrackingthemdowniscalled debugging. Threekindsoferrorscanoccurinaprogram:syntaxerrors,runtimeerrors,andsemanticerrors.Itisusefultodistinguishbetweentheminordertotrackthem downmorequickly. Syntaxerrors Pythoncanonlyexecuteaprogramifthesyntaxiscorrectotherwise,theinterpreterdisplaysanerrormessage. Syntaxreferstothestructureofaprogram andtherulesaboutthatstructure.Forexample,parentheseshavetocomeinmatchingpairs,so ( 1+2 ) islegal,but 8 ) isa syntaxerror.
en.wikibooks.org/wiki/Think_Python/Print_version 8/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

InEnglishreaderscantoleratemostsyntaxerrors,whichiswhywecanreadthepoetryofE.E.Cummingswithoutspewingerrormessages.Pythonisnotso forgiving.Ifthereisasinglesyntaxerroranywhereinyourprogram,Pythonwilldisplayanerrormessageandquit,andyouwillnotbeabletorunyour program.Duringthefirstfewweeksofyourprogrammingcareer,youwillprobablyspendalotoftimetrackingdownsyntaxerrors.Asyougainexperience,you willmakefewererrorsandfindthemfaster. Runtimeerrors Thesecondtypeoferrorisaruntimeerror,socalledbecausetheerrordoesnotappearuntilaftertheprogramhasstartedrunning.Theseerrorsarealso called exceptionsbecausetheyusuallyindicatethatsomethingexceptional(andbad)hashappened. Runtimeerrorsarerareinthesimpleprogramsyouwillseeinthefirstfewchapters,soitmightbeawhilebeforeyouencounterone. Semanticerrors Thethirdtypeoferroristhe semanticerror.Ifthereisasemanticerrorinyourprogram,itwillrunsuccessfullyinthesensethatthecomputerwillnot generateanyerrormessages,butitwillnotdotherightthing.Itwilldosomethingelse.Specifically,itwilldowhatyoutoldittodo. Theproblemisthattheprogramyouwroteisnottheprogramyouwantedtowrite.Themeaningoftheprogram(itssemantics)iswrong.Identifyingsemantic errorscanbetrickybecauseitrequiresyoutoworkbackwardbylookingattheoutputoftheprogramandtryingtofigureoutwhatitisdoing. Experimentaldebugging Oneofthemostimportantskillsyouwillacquireisdebugging.Althoughitcanbefrustrating,debuggingisoneofthemostintellectuallyrich,challenging,and interestingpartsofprogramming. Insomeways,debuggingislikedetectivework.Youareconfrontedwithclues,andyouhavetoinfertheprocessesandeventsthatledtotheresultsyousee. Debuggingisalsolikeanexperimentalscience.Onceyouhaveanideaaboutwhatisgoingwrong,youmodifyyourprogramandtryagain.Ifyourhypothesis wascorrect,thenyoucanpredicttheresultofthemodification,andyoutakeastepclosertoaworkingprogram.Ifyourhypothesiswaswrong,youhaveto comeupwithanewone.AsSherlockHolmespointedout,Whenyouhaveeliminatedtheimpossible,whateverremains,howeverimprobable,mustbethe truth.(A.ConanDoyle, TheSignofFour) Forsomepeople,programminganddebuggingarethesamething.Thatis,programmingistheprocessofgraduallydebuggingaprogramuntilitdoeswhat youwant.Theideaisthatyoushouldstartwithaprogramthatdoes somethingandmakesmallmodifications,debuggingthemasyougo,sothatyoualways haveaworkingprogram. Forexample,Linuxisanoperatingsystemthatcontainsthousandsoflinesofcode,butitstartedoutasasimpleprogramLinusTorvaldsusedtoexplorethe Intel80386chip.AccordingtoLarryGreenfield,OneofLinussearlierprojectswasaprogramthatwouldswitchbetweenprintingAAAAandBBBB.Thislater evolvedtoLinux.(TheLinuxUsersGuideBetaVersion1). Laterchapterswillmakemoresuggestionsaboutdebuggingandotherprogrammingpractices.

Formalandnaturallanguages
en.wikibooks.org/wiki/Think_Python/Print_version 9/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Naturallanguagesarethelanguagespeoplespeak,suchasEnglish,Spanish,andFrench.Theywerenotdesignedbypeople(althoughpeopletrytoimpose someorderonthem)theyevolvednaturally. Formallanguagesarelanguagesthataredesignedbypeopleforspecificapplications.Forexample,thenotationthatmathematiciansuseisaformal languagethatisparticularlygoodatdenotingrelationshipsamongnumbersandsymbols.Chemistsuseaformallanguagetorepresentthechemicalstructure ofmolecules.Andmostimportantly: Programminglanguagesareformallanguagesthathavebeendesignedtoexpresscomputations. Formallanguagestendtohavestrictrulesaboutsyntax.Forexample,3+3=6isasyntacticallycorrectmathematicalstatement,but3+=3$6isnot. H2O isasyntacticallycorrectchemicalformula,but 2Zzisnot. Syntaxrulescomeintwoflavors,pertainingto tokensandstructure.Tokensarethebasicelementsofthelanguage,suchaswords,numbers,andchemical elements.Oneoftheproblemswith3+=3$6isthat $ isnotalegaltokeninmathematics(atleastasfarasIknow).Similarly, 2Zzisnotlegalbecause thereisnoelementwiththeabbreviation Zz. Thesecondtypeofsyntaxerrorpertainstothestructureofastatementthatis,thewaythetokensarearranged.Thestatement3+=3$6isillegalbecause eventhough+and=arelegaltokens,youcanthaveonerightaftertheother.Similarly,inachemicalformulathesubscriptcomesaftertheelementname, notbefore. Exercise1 WriteawellstructuredEnglishsentencewithinvalidtokensinit.Thenwriteanothersentencewithallvalidtokensbutwithinvalidstructure. WhenyoureadasentenceinEnglishorastatementinaformallanguage,youhavetofigureoutwhatthestructureofthesentenceis(althoughinanatural languageyoudothissubconsciously).Thisprocessiscalled parsing. Forexample,whenyouhearthesentence,Thepennydropped,youunderstandthatthepennyisthesubjectanddroppedisthepredicate.Onceyouhave parsedasentence,youcanfigureoutwhatitmeans,orthesemanticsofthesentence.Assumingthatyouknowwhatapennyisandwhatitmeanstodrop, youwillunderstandthegeneralimplicationofthissentence. Althoughformalandnaturallanguageshavemanyfeaturesincommontokens,structure,syntax,andsemanticstherearesomedifferences: ambiguity: Naturallanguagesarefullofambiguity,whichpeopledealwithbyusingcontextualcluesandotherinformation.Formallanguagesaredesignedtobe nearlyorcompletelyunambiguous,whichmeansthatanystatementhasexactlyonemeaning,regardlessofcontext. redundancy: Inordertomakeupforambiguityandreducemisunderstandings,naturallanguagesemploylotsofredundancy.Asaresult,theyareoftenverbose. Formallanguagesarelessredundantandmoreconcise. literalness: Naturallanguagesarefullofidiomandmetaphor.IfIsay,Thepennydropped,thereisprobablynopennyandnothingdropping[1].Formallanguages meanexactlywhattheysay.
en.wikibooks.org/wiki/Think_Python/Print_version 10/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Peoplewhogrowupspeakinganaturallanguageeveryoneoftenhaveahardtimeadjustingtoformallanguages.Insomeways,thedifferencebetween formalandnaturallanguageislikethedifferencebetweenpoetryandprose,butmoreso: Poetry: Wordsareusedfortheirsoundsaswellasfortheirmeaning,andthewholepoemtogethercreatesaneffectoremotionalresponse.Ambiguityisnot onlycommonbutoftendeliberate. Prose: Theliteralmeaningofwordsismoreimportant,andthestructurecontributesmoremeaning.Proseismoreamenabletoanalysisthanpoetrybutstill oftenambiguous. Programs: Themeaningofacomputerprogramisunambiguousandliteral,andcanbeunderstoodentirelybyanalysisofthetokensandstructure. Herearesomesuggestionsforreadingprograms(andotherformallanguages).First,rememberthatformallanguagesaremuchmoredensethannatural languages,soittakeslongertoreadthem.Also,thestructureisveryimportant,soitisusuallynotagoodideatoreadfromtoptobottom,lefttoright. Instead,learntoparsetheprograminyourhead,identifyingthetokensandinterpretingthestructure.Finally,thedetailsmatter.Smallerrorsinspellingand punctuation,whichyoucangetawaywithinnaturallanguages,canmakeabigdifferenceinaformallanguage.

Thefirstprogram
Traditionally,thefirstprogramyouwriteinanewlanguageiscalledHello,World!becauseallitdoesisdisplaythewords,Hello,World!InPython,itlooks likethis:
p r i n t' H e l l o ,W o r l d ! '

Thisisanexampleofa printstatement[2],whichdoesntactuallyprintanythingonpaper.Itdisplaysavalueonthescreen.Inthiscase,theresultisthe words


H e l l o ,W o r l d !

Thequotationmarksintheprogrammarkthebeginningandendofthetexttobedisplayedtheydontappearintheresult. SomepeoplejudgethequalityofaprogramminglanguagebythesimplicityoftheHello,World!program.Bythisstandard,Pythondoesaboutaswellas possible.

Debugging
Itisagoodideatoreadthisbookinfrontofacomputersoyoucantryouttheexamplesasyougo.Youcanrunmostoftheexamplesininteractivemode, butifyouputthecodeintoascript,itiseasiertotryoutvariations.

en.wikibooks.org/wiki/Think_Python/Print_version

Wheneveryouareexperimentingwithanewfeature,youshouldtrytomakemistakes.Forexample,intheHello,world!program,whathappensifyouleave

11/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Wheneveryouareexperimentingwithanewfeature,youshouldtrytomakemistakes.Forexample,intheHello,world!program,whathappensifyouleave outoneofthequotationmarks?Whatifyouleaveoutboth?Whatifyouspell p r i n t wrong? Thiskindofexperimenthelpsyourememberwhatyoureaditalsohelpswithdebugging,becauseyougettoknowwhattheerrormessagesmean.Itisbetter tomakemistakesnowandonpurposethanlaterandaccidentally. Programming,andespeciallydebugging,sometimesbringsoutstrongemotions.Ifyouarestrugglingwithadifficultbug,youmightfeelangry,despondentor embarrassed. Thereisevidencethatpeoplenaturallyrespondtocomputersasiftheywerepeople[3].Whentheyworkwell,wethinkofthemasteammates,andwhenthey areobstinateorrude,werespondtothemthesamewaywerespondtorude,obstinatepeople. Preparingforthesereactionsmighthelpyoudealwiththem.Oneapproachistothinkofthecomputerasanemployeewithcertainstrengths,likespeedand precision,andparticularweaknesses,likelackofempathyandinabilitytograspthebigpicture. Yourjobistobeagoodmanager:findwaystotakeadvantageofthestrengthsandmitigatetheweaknesses.Andfindwaystouseyouremotionstoengage withtheproblem,withoutlettingyourreactionsinterferewithyourabilitytoworkeffectively. Learningtodebugcanbefrustrating,butitisavaluableskillthatisusefulformanyactivitiesbeyondprogramming.Attheendofeachchapterthereisa debuggingsection,likethisone,withmythoughtsaboutdebugging.Ihopetheyhelp!

Glossary
problemsolving: Theprocessofformulatingaproblem,findingasolution,andexpressingthesolution. highlevellanguage: AprogramminglanguagelikePythonthatisdesignedtobeeasyforhumanstoreadandwrite. lowlevellanguage: Aprogramminglanguagethatisdesignedtobeeasyforacomputertoexecutealsocalledmachinelanguageorassemblylanguage. portability: Apropertyofaprogramthatcanrunonmorethanonekindofcomputer. interpret: Toexecuteaprograminahighlevellanguagebytranslatingitonelineatatime. compile: Totranslateaprogramwritteninahighlevellanguageintoalowlevellanguageallatonce,inpreparationforlaterexecution. sourcecode: Aprograminahighlevellanguagebeforebeingcompiled. objectcode: Theoutputofthecompilerafterittranslatestheprogram. executable: Anothernameforobjectcodethatisreadytobeexecuted.
en.wikibooks.org/wiki/Think_Python/Print_version 12/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

prompt: Charactersdisplayedbytheinterpretertoindicatethatitisreadytotakeinputfromtheuser. script: Aprogramstoredinafile(usuallyonethatwillbeinterpreted). interactivemode: AwayofusingthePythoninterpreterbytypingcommandsandexpressionsattheprompt. scriptmode: AwayofusingthePythoninterpretertoreadandexecutestatementsinascript. program: Asetofinstructionsthatspecifiesacomputation. algorithm: Ageneralprocessforsolvingacategoryofproblems. bug: Anerrorinaprogram. debugging: Theprocessoffindingandremovinganyofthethreekindsofprogrammingerrors. syntax: Thestructureofaprogram. syntaxerror: Anerrorinaprogramthatmakesitimpossibletoparse(andthereforeimpossibletointerpret). exception: Anerrorthatisdetectedwhiletheprogramisrunning. semantics: Themeaningofaprogram. semanticerror: Anerrorinaprogramthatmakesitdosomethingotherthanwhattheprogrammerintended. naturallanguage: Anyoneofthelanguagesthatpeoplespeakthatevolvednaturally. formallanguage: Anyoneofthelanguagesthatpeoplehavedesignedforspecificpurposes,suchasrepresentingmathematicalideasorcomputerprogramsall programminglanguagesareformallanguages. token: Oneofthebasicelementsofthesyntacticstructureofaprogram,analogoustoawordinanaturallanguage. parse: Toexamineaprogramandanalyzethesyntacticstructure.
en.wikibooks.org/wiki/Think_Python/Print_version 13/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

printstatement: AninstructionthatcausesthePythoninterpretertodisplayavalueonthescreen.

Exercises
Exercise2 UseawebbrowsertogotothePythonwebsite,http://python.org/.ThispagecontainsinformationaboutPythonandlinkstoPythonrelatedpages,andit givesyoutheabilitytosearchthePythondocumentation.Forexample,ifyouenter p r i n t inthesearchwindow,thefirstlinkthatappearsisthedocumentation ofthe p r i n t statement.Atthispoint,notallofitwillmakesensetoyou,butitisgoodtoknowwhereitis. Exercise3 StartthePythoninterpreterandtype'h e l p ( ) 'tostarttheonlinehelputility.Oryoucantype h e l p ( ' p r i n t ' ) togetinformationaboutthe'p r i n t 'statement. Ifthis exampledoesntwork,youmayneedtoinstalladditionalPythondocumentationorsetanenvironmentvariablethedetailsdependonyouroperatingsystem andversionofPython. Exercise4 StartthePythoninterpreteranduseitasacalculator.Pythonssyntaxformathoperationsisalmostthesameasstandardmathematicalnotation.For example,thesymbols'+ ',''and'/ 'denoteaddition,subtractionanddivision,asyouwouldexpect.Thesymbolformultiplicationis'* '. Ifyouruna10kilometer racein43minutes30seconds,whatisyouraveragetimepermile?Whatisyouraveragespeedinmilesperhour?(Hint:thereare1.61kilometersinamile).

References
1. Thisidiommeansthatsomeonerealizedsomethingafteraperiodofconfusion. 2. InPython3.0, p r i n t isafunction,notastatement,sothesyntaxis p r i n t ( H e l l o ,W o r l d ! ) .Wewillgettofunctionssoon! 3. SeeReevesandNass, TheMediaEquation:HowPeopleTreatComputers,Television,andNewMediaLikeRealPeopleandPlaces.

Variables,expressionsandstatements
Valuesandtypes
A valueisoneofthebasicthingsaprogramworkswith,likealetteroranumber.Thevalueswehaveseensofarare 1 , 2 ,and ' H e l l o ,W o r l d ! ' . Thesevaluesbelongtodifferent types: 2 isaninteger,and ' H e l l o ,W o r l d ! ' isa string,socalledbecauseitcontainsastringofletters.You(andthe interpreter)canidentifystringsbecausetheyareenclosedinquotationmarks. Theprintstatementalsoworksforintegers.

en.wikibooks.org/wiki/Think_Python/Print_version

14/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >p r i n t4 4

Ifyouarenotsurewhattypeavaluehas,theinterpretercantellyou.
> > >t y p e ( ' H e l l o ,W o r l d ! ' ) < t y p e' s t r ' > > > >t y p e ( 1 7 ) < t y p e' i n t ' >

Notsurprisingly,stringsbelongtothetype s t r andintegersbelongtothetype i n t .Lessobviously,numberswithadecimalpointbelongtoatypecalled f l o a t , becausethesenumbersarerepresentedinaformatcalled floatingpoint.


> > >t y p e ( 3 . 2 ) < t y p e' f l o a t ' >

Whataboutvalueslike ' 1 7 ' and ' 3 . 2 ' ?Theylooklikenumbers,buttheyareinquotationmarkslikestrings.


> > >t y p e ( ' 1 7 ' ) < t y p e' s t r ' > > > >t y p e ( ' 3 . 2 ' ) < t y p e' s t r ' >

They'restrings. Whenyoutypealargeinteger,youmightbetemptedtousecommasbetweengroupsofthreedigits,asin 1 , 0 0 0 , 0 0 0 .ThisisnotalegalintegerinPython,butit islegal:


> > >p r i n t1 , 0 0 0 , 0 0 0 100

Well,thatsnotwhatweexpectedatall!Pythoninterprets 1 , 0 0 0 , 0 0 0 asacommaseparatedsequenceofintegers,whichitprintswithspacesbetween. Thisisthefirstexamplewehaveseenofasemanticerror:thecoderunswithoutproducinganerrormessage,butitdoesn'tdotherightthing.

Variables
Oneofthemostpowerfulfeaturesofaprogramminglanguageistheabilitytomanipulate variables.Avariableisanamethatreferstoavalue. An assignmentstatementcreatesnewvariablesandgivesthemvalues:

en.wikibooks.org/wiki/Think_Python/Print_version

15/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >m e s s a g e=' A n dn o wf o rs o m e t h i n gc o m p l e t e l yd i f f e r e n t ' > > >n=1 7 > > >p i=3 . 1 4 1 5 9 2 6 5 3 5 8 9 7 9 3 1

Thisexamplemakesthreeassignments.Thefirstassignsastringtoanewvariablenamed m e s s a g e thesecondgivestheinteger 1 7 to n thethirdassignsthe (approximate)valueofto p i . Acommonwaytorepresentvariablesonpaperistowritethenamewithanarrowpointingtothevariablesvalue.Thiskindoffigureiscalleda statediagram becauseitshowswhatstateeachofthevariablesisin(thinkofitasthevariablesstateofmind).Thisdiagramshowstheresultofthepreviousexample:


m e s s a g e n p i ' A n dn o wf o rs o m e t h i n gc o m p l e t e l yd i f f e r e n t ' 1 7 3 . 1 4 1 5 9 2 6 5 3 5 8 9 7 9 3 1

Todisplaythevalueofavariable,youcanuseaprintstatement:
> > >p r i n tn 1 7 > > >p r i n tp i 3 . 1 4 1 5 9 2 6 5 3 5 9

Thetypeofavariableisthetypeofthevalueitrefersto.
> > >t y p e ( m e s s a g e ) < t y p e' s t r ' > > > >t y p e ( n ) < t y p e' i n t ' > > > >t y p e ( p i ) < t y p e' f l o a t ' >

Exercise1 Ifyoutypeanintegerwithaleadingzero,youmightgetaconfusingerror:
> > >z i p c o d e=0 2 4 9 2 ^ S y n t a x E r r o r :i n v a l i dt o k e n

Othernumberseemtowork,buttheresultsarebizarre:

en.wikibooks.org/wiki/Think_Python/Print_version

16/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >z i p c o d e=0 2 1 3 2 > > >p r i n tz i p c o d e 1 1 1 4

Canyoufigureoutwhatisgoingon?Hint:printthevalues 0 1 , 0 1 0 , 0 1 0 0 and 0 1 0 0 0 .

Variablenamesandkeywords
Programmersgenerallychoosenamesfortheirvariablesthataremeaningfultheydocumentwhatthevariableisusedfor. Variablenamescanbearbitrarilylong.Theycancontainbothlettersandnumbers,buttheyhavetobeginwithaletter.Itislegaltouseuppercaseletters,but itisagoodideatobeginvariablenameswithalowercaseletter(you'llseewhylater). Theunderscorecharacter(_ )canappearinaname.Itisoftenusedinnameswithmultiplewords,suchas m y _ n a m e or a i r s p e e d _ o f _ u n l a d e n _ s w a l l o w . Ifyougiveavariableanillegalname,yougetasyntaxerror:
> > >7 6 t r o m b o n e s=' b i gp a r a d e ' S y n t a x E r r o r :i n v a l i ds y n t a x > > >m o r e @=1 0 0 0 0 0 0 S y n t a x E r r o r :i n v a l i ds y n t a x > > >c l a s s=' A d v a n c e dT h e o r e t i c a lZ y m u r g y ' S y n t a x E r r o r :i n v a l i ds y n t a x
7 6 t r o m b o n e s isillegalbecauseitdoesnotbeginwithaletter. m o r e @ isillegalbecauseitcontainsanillegalcharacter, @ .Butwhat'swrongwith c l a s s ?

Itturnsoutthat c l a s s isoneofPython's keywords.Theinterpreteruseskeywordstorecognizethestructureoftheprogram,andtheycannotbeusedas variablenames. Pythonhas31keywords:


a n d a s d e l e l i f f r o m n o t g l o b a lo r i f w h i l e w i t h

a s s e r t e l s e b r e a k c l a s s

p a s s y i e l d

e x c e p ti m p o r tp r i n t e x e c i n r a i s e r e t u r n

c o n t i n u ef i n a l l yi s d e f f o r

l a m b d at r y

Youmightwanttokeepthislisthandy.Iftheinterpretercomplainsaboutoneofyourvariablenamesandyoudon'tknowwhy,seeifitisonthislist.
en.wikibooks.org/wiki/Think_Python/Print_version 17/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

IfyouwriteyourcodeinatexteditorthatunderstandsPython,youmayfindthatitmakesiteasyforyoutospotsuchkeywordclashesbydisplayingkeywords inadifferentcolortoordinaryvariables.Thisfeatureiscalled syntaxhighlighting,andmostprogrammersfinditindispensable.Thisbookusessyntax highlightingforitsexamplecode,sointhefollowingexample:


o k _ v a r i a b l e=4 2 y i e l d=4 2

youcanseethat y i e l d hasbeenrecognizedasakeywordandnotasanordinaryvariable,sinceitiscoloredorange.

Statements
AstatementisaunitofcodethatthePythoninterpretercanexecute.Wehaveseentwokindsofstatements:printandassignment. Whenyoutypeastatementininteractivemode,theinterpreterexecutesitanddisplaystheresult,ifthereisone. Ascriptusuallycontainsasequenceofstatements.Ifthereismorethanonestatement,theresultsappearoneatatimeasthestatementsexecute. Forexample,thescript
p r i n t1 x=2 p r i n tx

producestheoutput
1 2

Theassignmentstatementproducesnooutput.

Operatorsandoperands
Operatorsarespecialsymbolsthatrepresentcomputationslikeadditionandmultiplication.Thevaluestheoperatorisappliedtoarecalled operands. Theoperators + , , * , / and * * performaddition,subtraction,multiplication,divisionandexponentiation,asinthefollowingexamples:
2 0 + 3 2 h o u r 1 h o u r * 6 0 + m i n u t e m i n u t e / 6 0 5 * * 2 ( 5 + 9 ) * ( 1 5 7 )

Insomeotherlanguages, ^ isusedforexponentiation,butinPythonitisabitwiseoperatorcalledXOR.Iwontcoverbitwiseoperatorsinthisbook,butyou canreadaboutthemat w i k i . p y t h o n . o r g / m o i n / B i t w i s e O p e r a t o r s .


en.wikibooks.org/wiki/Think_Python/Print_version 18/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thedivisionoperatormightnotdowhatyouexpect:
> > >m i n u t e=5 9 > > >m i n u t e / 6 0 0

Thevalueof m i n u t e is59,andinconventionalarithmetic59dividedby60is0.98333,not0.ThereasonforthediscrepancyisthatPythonisperforming floor division. [1] Whenbothoftheoperandsareintegers,theresultisalsoanintegerfloordivisionchopsoffthefractionpart,sointhisexampleitroundsdowntozero. Ifeitheroftheoperandsisafloatingpointnumber,Pythonperformsfloatingpointdivision,andtheresultisa f l o a t :


> > >m i n u t e / 6 0 . 0 0 . 9 8 3 3 3 3 3 3 3 3 3 3 3 3 3 2 8

Expressions
An expressionisacombinationofvalues,variables,andoperators.Avalueallbyitselfisconsideredanexpression,andsoisavariable,sothefollowingare alllegalexpressions(assumingthatthevariable x hasbeenassignedavalue):
1 7 x x+1 7

Ifyoutypeanexpressionininteractivemode,theinterpreter evaluatesitanddisplaystheresult:
> > >1+1 2

Butinascript,anexpressionallbyitselfdoesntdoanything!Thisisacommonsourceofconfusionforbeginners. Exercise2 TypethefollowingstatementsinthePythoninterpretertoseewhattheydo:


5 x=5 x+1

en.wikibooks.org/wiki/Think_Python/Print_version

19/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Nowputthesamestatementsintoascriptandrunit.Whatistheoutput?Modifythescriptbytransformingeachexpressionintoaprintstatementandthen runitagain.

Orderofoperations
Whenmorethanoneoperatorappearsinanexpression,theorderofevaluationdependsonthe rulesofprecedence.Formathematicaloperators,Python followsmathematicalconvention.Theacronym PEMDAS isausefulwaytoremembertherules: P arentheseshavethehighestprecedenceandcanbeusedtoforceanexpressiontoevaluateintheorderyouwant.Sinceexpressionsinparentheses areevaluatedfirst, 2*( 3 1 ) is4,and ( 1 + 1 ) * * ( 5 2 ) is8.Youcanalsouseparenthesestomakeanexpressioneasiertoread,asin ( m i n u t e*1 0 0 )/6 0 ,even ifitdoesn'tchangetheresult. E xponentiationhasthenexthighestprecedence,so 2 * * 1 + 1 is3,not4,and 3 * 1 * * 3 is3,not27. Multiplicationand Divisionhavethesameprecedence,whichishigherthan Additionand S ubtraction,whichalsohavethesameprecedence.So 2 * 3 1 is 5,not4,and 6 + 4 / 2 is8,not5. Operatorswiththesameprecedenceareevaluatedfromlefttoright.Sointheexpression d e g r e e s/2*p i ,thedivisionhappensfirstandtheresultis multipliedby p i .Todivideby2,youcanreordertheoperandsoruseparentheses.

Stringoperations
Ingeneral,youcannotperformmathematicaloperationsonstrings,evenifthestringslooklikenumbers,sothefollowingareillegal:
' 2 ' ' 1 ' ' e g g s ' / ' e a s y ' ' t h i r d ' * ' ac h a r m '

The + operatorworkswithstrings,butitmightnotdowhatyouexpect:itperforms concatenation,whichmeansjoiningthestringsbylinkingthemendtoend. Forexample:


f i r s t=' t h r o a t ' s e c o n d=' w a r b l e r ' p r i n tf i r s t+s e c o n d

Theoutputofthisprogramis t h r o a t w a r b l e r . The * operatoralsoworksonstringsitperformsrepetition.Forexample, S p a m * 3 is ' S p a m S p a m S p a m ' .Ifoneoftheoperandsisastring,theotherhastobean integer. Thisuseof + and * makessensebyanalogywithadditionandmultiplication.Justas 4 * 3 isequivalentto 4 + 4 + 4 ,weexpect ' S p a m ' * 3 tobethesameas ' S p a m ' + ' S p a m ' + ' S p a m ' ,anditis.Ontheotherhand,thereisasignificantwayinwhichstringconcatenationandrepetitionaredifferentfromintegeradditionand multiplication.Canyouthinkofapropertythatadditionhasthatstringconcatenationdoesnot?

Comments
en.wikibooks.org/wiki/Think_Python/Print_version 20/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Asprogramsgetbiggerandmorecomplicated,theygetmoredifficulttoread.Formallanguagesaredense,anditisoftendifficulttolookatapieceofcode andfigureoutwhatitisdoing,orwhy. Forthisreason,itisagoodideatoaddnotestoyourprogramstoexplaininnaturallanguagewhattheprogramisdoing.Thesenotesarecalled comments, andtheystartwiththe # symbol:


#c o m p u t et h ep e r c e n t a g eo ft h eh o u rt h a th a se l a p s e d p e r c e n t a g e=( m i n u t e*1 0 0 )/6 0

Inthiscase,thecommentappearsonalinebyitself.Youcanalsoputcommentsattheendofaline:
p e r c e n t a g e=( m i n u t e*1 0 0 )/6 0 #p e r c e n t a g eo fa nh o u r

Everythingfromthe # totheendofthelineisignoredithasnoeffectontheprogram. Commentsaremostusefulwhentheydocumentnonobviousfeaturesofthecode.Itisreasonabletoassumethatthereadercanfigureout what thecode doesitismuchmoreusefultoexplain why. Thiscommentisredundantwiththecodeanduseless:


v=5 #a s s i g n5t ov

Thiscommentcontainsusefulinformationthatisnotinthecode:
v=5 #v e l o c i t yi nm e t e r s / s e c o n d .

Goodvariablenamescanreducetheneedforcomments,butlongnamescanmakecomplexexpressionshardtoread,sothereisatradeoff.

Debugging
Atthispointthesyntaxerroryouaremostlikelytomakeisanillegalvariablename,like c l a s s and y i e l d ,whicharekeywords,or o d d ~ j o b and U S $ ,whichcontain illegalcharacters. Ifyouputaspaceinavariablename,Pythonthinksitistwooperandswithoutanoperator:
> > >b a dn a m e=5 S y n t a x E r r o r :i n v a l i ds y n t a x

Forsyntaxerrors,theerrormessagesdonthelpmuch.Themostcommonmessagesare S y n t a x E r r o r :i n v a l i ds y n t a x and S y n t a x E r r o r :i n v a l i dt o k e n ,neitherofwhich isveryinformative.


en.wikibooks.org/wiki/Think_Python/Print_version 21/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theruntimeerroryouaremostlikelytomakeisausebeforedefthatis,tryingtouseavariablebeforeyouhaveassignedavalue.Thiscanhappenifyou spellavariablenamewrong:
> > >p r i n c i p a l=3 2 7 . 6 8 > > >i n t e r e s t=p r i n c i p l e*r a t e N a m e E r r o r :n a m e' p r i n c i p l e 'i sn o td e f i n e d

Variablesnamesarecasesensitive,so L a T e X isnotthesameas l a t e x . Atthispointthemostlikelycauseofasemanticerroristheorderofoperations.Forexample,toevaluate1/2,youmightbetemptedtowrite


> > >1 . 0/2 . 0*p i

Butthedivisionhappensfirst,soyouwouldget/2,whichisnotthesamething!ThereisnowayforPythontoknowwhatyoumeanttowrite,sointhis caseyoudontgetanerrormessageyoujustgetthewronganswer.

Glossary
value: Oneofthebasicunitsofdata,likeanumberorstring,thataprogrammanipulates. type: Acategoryofvalues.Thetypeswehaveseensofarareintegers(type i n t ),floatingpointnumbers(type f l o a t ),andstrings(type s t r ). integer: Atypethatrepresentswholenumbers. floatingpoint: Atypethatrepresentsnumberswithfractionalparts. string: Atypethatrepresentssequencesofcharacters. variable: Anamethatreferstoavalue. statement: Asectionofcodethatrepresentsacommandoraction.Sofar,thestatementswehaveseenareassignmentsandprintstatements. assignment: Astatementthatassignsavaluetoavariable. statediagram: Agraphicalrepresentationofasetofvariablesandthevaluestheyreferto. keyword:
en.wikibooks.org/wiki/Think_Python/Print_version 22/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Areservedwordthatisusedbythecompilertoparseaprogramyoucannotusekeywordslike i f , d e f ,and w h i l e asvariablenames. operator: Aspecialsymbolthatrepresentsasimplecomputationlikeaddition,multiplication,orstringconcatenation. operand: Oneofthevaluesonwhichanoperatoroperates. floordivision: Theoperationthatdividestwonumbersandchopsoffthefractionpart. expression: Acombinationofvariables,operators,andvaluesthatrepresentsasingleresultvalue. evaluate: Tosimplifyanexpressionbyperformingtheoperationsinordertoyieldasinglevalue. rulesofprecedence: Thesetofrulesgoverningtheorderinwhichexpressionsinvolvingmultipleoperatorsandoperandsareevaluated. concatenate: Tojointwooperandsendtoend. comment: Informationinaprogramthatismeantforotherprogrammers(oranyonereadingthesourcecode)andhasnoeffectontheexecutionoftheprogram.

Exercises
Exercise3 Assumethatweexecutethefollowingassignmentstatements:
w i d t h=1 7 h e i g h t=1 2 . 0 d e l i m i t e r=' . '

Foreachofthefollowingexpressions,writethevalueoftheexpressionandthetype(ofthevalueoftheexpression).
w i d t h / 2 w i d t h / 2 . 0 h e i g h t / 3 1+2*5 d e l i m i t e r*5

UsethePythoninterpretertocheckyouranswers.

en.wikibooks.org/wiki/Think_Python/Print_version

23/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise4 PracticeusingthePythoninterpreterasacalculator: Thevolumeofaspherewithradius'r'is'4/3'r3. Whatisthevolumeofaspherewithradius5?Hint:392.6iswrong! Supposethecoverpriceofabookis$24.95,butbookstoresgeta 40%discount.Shippingcosts$3forthefirstcopyand75centsforeachadditionalcopy.Whatisthetotalwholesalecostfor60copies? IfIleavemyhouseat6:52amandrun1mileataneasypace (8:15permile),then3milesattempo(7:12permile)and1mileateasypaceagain,whattimedoIgethomeforbreakfast?

Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.

Functions
Functioncalls
Inthecontextofprogramming,a functionisanamedsequenceofstatementsthatperformsacomputation.Whenyoudefineafunction,youspecifythe nameandthesequenceofstatements.Later,youcan"call"thefunctionbyname.Wehavealreadyseenoneexampleofa functioncall :

> > >t y p e ( 3 2 ) < t y p e' i n t ' >

Thenameofthefunctionistype.Theexpressioninparenthesesiscalledthe argumentofthefunction.Theresult,forthisfunction,isthetypeofthe argument. Itiscommontosaythatafunction"takes"anargumentand"returns"aresult.Theresultiscalledthe returnvalue.

Typeconversionfunctions
Pythonprovidesbuiltinfunctionsthatconvertvaluesfromonetypetoanother.Theintfunctiontakesanyvalueandconvertsittoaninteger,ifitcan,or complainsotherwise:

en.wikibooks.org/wiki/Think_Python/Print_version

24/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >i n t ( ' 3 2 ' ) 3 2 > > >i n t ( ' H e l l o ' ) V a l u e E r r o r :i n v a l i dl i t e r a lf o ri n t ( ) :H e l l o

intcanconvertfloatingpointvaluestointegers,butitdoesn'troundoffitchopsoffthefractionpart:
> > >i n t ( 3 . 9 9 9 9 9 ) 3 > > >i n t ( 2 . 3 ) 2

floatconvertsintegersandstringstofloatingpointnumbers:
> > >f l o a t ( 3 2 ) 3 2 . 0 > > >f l o a t ( ' 3 . 1 4 1 5 9 ' ) 3 . 1 4 1 5 9

Finally,strconvertsitsargumenttoastring:
> > >s t r ( 3 2 ) ' 3 2 ' > > >s t r ( 3 . 1 4 1 5 9 ) ' 3 . 1 4 1 5 9 '

Mathfunctions
Pythonhasamathmodulethatprovidesmostofthefamiliarmathematicalfunctions.A moduleisafilethatcontainsacollectionofrelatedfunctions. Beforewecanusethemodule,wehavetoimportit:
> > >i m p o r tm a t h

Thisstatementcreatesa moduleobjectnamedmath.Ifyouprintthemoduleobject,yougetsomeinformationaboutit:

> > >p r i n tm a t h < m o d u l e' m a t h 'f r o m' / u s r / l i b / p y t h o n 2 . 5 / l i b d y n l o a d / m a t h . s o ' >


en.wikibooks.org/wiki/Think_Python/Print_version 25/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Themoduleobjectcontainsthefunctionsandvariablesdefinedinthemodule.Toaccessoneofthefunctions,youhavetospecifythenameofthemodule andthenameofthefunction,separatedbyadot(alsoknownasaperiod).Thisformatiscalled dotnotation.

> > >r a t i o=s i g n a l _ p o w e r/n o i s e _ p o w e r > > >d e c i b e l s=1 0*m a t h . l o g 1 0 ( r a t i o ) > > >r a d i a n s=0 . 7 > > >h e i g h t=m a t h . s i n ( r a d i a n s )

Thefirstexamplecomputesthelogarithmbase10ofthesignaltonoiseratio.Themathmodulealsoprovidesafunctioncalledlogthatcomputeslogarithms basee. Thesecondexamplefindsthesineofradians.Thenameofthevariableisahintthatsinandtheothertrigonometricfunctions(cos,tan,etc.)takearguments inradians.Toconvertfromdegreestoradians,divideby360andmultiplyby2:

> > >d e g r e e s=4 5 > > >r a d i a n s=d e g r e e s/3 6 0 . 0*2*m a t h . p i > > >m a t h . s i n ( r a d i a n s ) 0 . 7 0 7 1 0 6 7 8 1 1 8 7

Theexpressionmath.pigetsthevariablepifromthemathmodule.Thevalueofthisvariableisanapproximationof,accuratetoabout15digits. Ifyouknowyourtrigonometry,youcancheckthepreviousresultbycomparingittothesquarerootoftwodividedbytwo:

> > >m a t h . s q r t ( 2 )/2 . 0 0 . 7 0 7 1 0 6 7 8 1 1 8 7

Composition
Sofar,wehavelookedattheelementsofaprogramvariables,expressions,andstatementsinisolation,withouttalkingabouthowtocombinethem. Oneofthemostusefulfeaturesofprogramminglanguagesistheirabilitytotakesmallbuildingblocksand composethem.Forexample,theargumentofa functioncanbeanykindofexpression,includingarithmeticoperators:
en.wikibooks.org/wiki/Think_Python/Print_version 26/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

x=m a t h . s i n ( d e g r e e s/3 6 0 . 0*2*m a t h . p i )

Andevenfunctioncalls:

x=m a t h . e x p ( m a t h . l o g ( x + 1 ) )

Almostanywhereyoucanputavalue,youcanputanarbitraryexpression,withoneexception:theleftsideofanassignmentstatementhastobeavariable name.Anyotherexpressionontheleftsideisasyntaxerror.
> > >m i n u t e s=h o u r s*6 0 > > >h o u r s*6 0=m i n u t e s S y n t a x E r r o r :c a n ' ta s s i g nt oo p e r a t o r #r i g h t #w r o n g !

Addingnewfunctions
Sofar,wehaveonlybeenusingthefunctionsthatcomewithPython,butitisalsopossibletoaddnewfunctions.A functiondefinitionspecifiesthenameof anewfunctionandthesequenceofstatementsthatexecutewhenthefunctioniscalled. Hereisanexample:
d e fp r i n t _ l y r i c s ( ) : p r i n t" I ' mal u m b e r j a c k ,a n dI ' mo k a y . " p r i n t" Is l e e pa l ln i g h ta n dIw o r ka l ld a y . "

defisakeywordthatindicatesthatthisisafunctiondefinition.Thenameofthefunctionis p r i n t _ l y r i c s .Therulesforfunctionnamesarethesameasfor variablenames:letters,numbersandsomepunctuationmarksarelegal,butthefirstcharactercan'tbeanumber.Youcan'tuseakeywordasthenameofa function,andyoushouldavoidhavingavariableandafunctionwiththesamename. Theemptyparenthesesafterthenameindicatethatthisfunctiondoesn'ttakeanyarguments. Thefirstlineofthefunctiondefinitioniscalledthe headertherestiscalledthe body.Theheaderhastoendwithacolonandthebodyhastobeindented. Byconvention,theindentationisalwaysfourspaces(seeSection).Thebodycancontainanynumberofstatements. Thestringsintheprintstatementsareenclosedindoublequotes.Singlequotesanddoublequotesdothesamethingmostpeopleusesinglequotesexcept incaseslikethiswhereasinglequote(whichisalsoanapostrophe)appearsinthestring. Ifyoutypeafunctiondefinitionininteractivemode,theinterpreterprintsellipses(... )toletyouknowthatthedefinitionisn'tcomplete:
> > >d e fp r i n t _ l y r i c s ( ) : . . . p r i n t" I ' mal u m b e r j a c k ,a n dI ' mo k a y . "
en.wikibooks.org/wiki/Think_Python/Print_version 27/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

. . . . . .

p r i n t" Is l e e pa l ln i g h ta n dIw o r ka l ld a y . "

Toendthefunction,youhavetoenteranemptyline(thisisnotnecessaryinascript). Definingafunctioncreatesavariablewiththesamename.
> > >p r i n tp r i n t _ l y r i c s < f u n c t i o np r i n t _ l y r i c sa t0 x b 7 e 9 9 e 9 c > > > >p r i n tt y p e ( p r i n t _ l y r i c s ) < t y p e' f u n c t i o n ' >

Thevalueof p r i n t _ l y r i c s isa functionobject,whichhastype ' f u n c t i o n ' . Thesyntaxforcallingthenewfunctionisthesameasforbuiltinfunctions:

> > >p r i n t _ l y r i c s ( ) I ' mal u m b e r j a c k ,a n dI ' mo k a y . Is l e e pa l ln i g h ta n dIw o r ka l ld a y .

Onceyouhavedefinedafunction,youcanuseitinsideanotherfunction.Forexample,torepeatthepreviousrefrain,wecouldwriteafunctioncalled r e p e a t _ l y r i c s :

d e fr e p e a t _ l y r i c s ( ) : p r i n t _ l y r i c s ( ) p r i n t _ l y r i c s ( )

Andthencall r e p e a t _ l y r i c s :

> > >r e p e a t _ l y r i c s ( ) I ' mal u m b e r j a c k ,a n dI ' mo k a y . Is l e e pa l ln i g h ta n dIw o r ka l ld a y . I ' mal u m b e r j a c k ,a n dI ' mo k a y . Is l e e pa l ln i g h ta n dIw o r ka l ld a y .

Butthat'snotreallyhowthesonggoes.
en.wikibooks.org/wiki/Think_Python/Print_version 28/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Definitionsanduses
Pullingtogetherthecodefragmentsfromtheprevioussection,thewholeprogramlookslikethis:

d e fp r i n t _ l y r i c s ( ) : p r i n t" I ' mal u m b e r j a c k ,a n dI ' mo k a y . " p r i n t" Is l e e pa l ln i g h ta n dIw o r ka l ld a y . " d e fr e p e a t _ l y r i c s ( ) : p r i n t _ l y r i c s ( ) p r i n t _ l y r i c s ( ) r e p e a t _ l y r i c s ( )

Thisprogramcontainstwofunctiondefinitions: p r i n t _ l y r i c s and r e p e a t _ l y r i c s .Functiondefinitionsgetexecutedjustlikeotherstatements,buttheeffectisto createfunctionobjects.Thestatementsinsidethefunctiondonotgetexecuteduntilthefunctioniscalled,andthefunctiondefinitiongeneratesnooutput. Asyoumightexpect,youhavetocreateafunctionbeforeyoucanexecuteit.Inotherwords,thefunctiondefinitionhastobeexecutedbeforethefirsttimeit iscalled.

Exercise1
Movethelastlineofthisprogramtothetop,sothefunctioncallappearsbeforethedefinitions.Runtheprogramandseewhaterrormessageyouget.

Exercise2
Movethefunctioncallbacktothebottomandmovethedefinitionof p r i n t _ l y r i c s afterthedefinitionof r e p e a t _ l y r i c s .Whathappenswhenyourunthisprogram?

Flowofexecution
Inordertoensurethatafunctionisdefinedbeforeitsfirstuse,youhavetoknowtheorderinwhichstatementsareexecuted,whichiscalledthe flowof execution. Executionalwaysbeginsatthefirststatementoftheprogram.Statementsareexecutedoneatatime,inorderfromtoptobottom. Functiondefinitionsdonotaltertheflowofexecutionoftheprogram,butrememberthatstatementsinsidethefunctionarenotexecuteduntilthefunctionis called. Afunctioncallislikeadetourintheflowofexecution.Insteadofgoingtothenextstatement,theflowjumpstothebodyofthefunction,executesallthe statementsthere,andthencomesbacktopickupwhereitleftoff.
en.wikibooks.org/wiki/Think_Python/Print_version 29/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thatsoundssimpleenough,untilyourememberthatonefunctioncancallanother.Whileinthemiddleofonefunction,theprogrammighthavetoexecute thestatementsinanotherfunction.Butwhileexecutingthatnewfunction,theprogrammighthavetoexecuteyetanotherfunction! Fortunately,Pythonisgoodatkeepingtrackofwhereitis,soeachtimeafunctioncompletes,theprogrampicksupwhereitleftoffinthefunctionthatcalled it.Whenitgetstotheendoftheprogram,itterminates. What'sthemoralofthissordidtale?Whenyoureadaprogram,youdon'talwayswanttoreadfromtoptobottom.Sometimesitmakesmoresenseifyou followtheflowofexecution.

Parametersandarguments
Someofthebuiltinfunctionswehaveseenrequirearguments.Forexample,whenyoucallmath.sinyoupassanumberasanargument.Somefunctions takemorethanoneargument:math.powtakestwo,thebaseandtheexponent. Insidethefunction,theargumentsareassignedtovariablescalled parameters.Hereisanexampleofauserdefinedfunctionthattakesanargument:

d e fp r i n t _ t w i c e ( b r u c e ) : p r i n tb r u c e p r i n tb r u c e

Thisfunctionassignstheargumenttoaparameternamedbruce.Whenthefunctioniscalled,itprintsthevalueoftheparameter(whateveritis)twice. Thisfunctionworkswithanyvaluethatcanbeprinted.

> > >p r i n t _ t w i c e ( ' S p a m ' ) S p a m S p a m > > >p r i n t _ t w i c e ( 1 7 ) 1 7 1 7 > > >p r i n t _ t w i c e ( m a t h . p i ) 3 . 1 4 1 5 9 2 6 5 3 5 9 3 . 1 4 1 5 9 2 6 5 3 5 9

Thesamerulesofcompositionthatapplytobuiltinfunctionsalsoapplytouserdefinedfunctions,sowecanuseanykindofexpressionasanargumentfor p r i n t _ t w i c e :
en.wikibooks.org/wiki/Think_Python/Print_version 30/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >p r i n t _ t w i c e ( ' S p a m' * 4 ) S p a mS p a mS p a mS p a m S p a mS p a mS p a mS p a m > > >p r i n t _ t w i c e ( m a t h . c o s ( m a t h . p i ) ) 1 . 0 1 . 0

Theargumentisevaluatedbeforethefunctioniscalled,sointheexamplestheexpressions ' S p a m' * 4 andmath.cos(math.pi)areonlyevaluatedonce. Youcanalsouseavariableasanargument:

> > >m i c h a e l=' E r i c ,t h eh a l fab e e . ' > > >p r i n t _ t w i c e ( m i c h a e l ) E r i c ,t h eh a l fab e e . E r i c ,t h eh a l fab e e .

Thenameofthevariablewepassasanargument(michael)hasnothingtodowiththenameoftheparameter(bruce).Itdoesn'tmatterwhatthevaluewas calledbackhome(inthecaller)herein p r i n t _ t w i c e ,wecalleverybodybruce.

Variablesandparametersarelocal
Whenyoucreateavariableinsideafunction,itis local ,whichmeansthatitonlyexistsinsidethefunction.Forexample:

d e fc a t _ t w i c e ( p a r t 1 ,p a r t 2 ) : c a t=p a r t 1+p a r t 2 p r i n t _ t w i c e ( c a t )

Thisfunctiontakestwoarguments,concatenatesthem,andprintstheresulttwice.Hereisanexamplethatusesit:

> > >l i n e 1=' B i n gt i d d l e' > > >l i n e 2=' t i d d l eb a n g . ' > > >c a t _ t w i c e ( l i n e 1 ,l i n e 2 )
en.wikibooks.org/wiki/Think_Python/Print_version 31/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

B i n gt i d d l et i d d l eb a n g . B i n gt i d d l et i d d l eb a n g .

When c a t _ t w i c e terminates,thevariablecatisdestroyed.Ifwetrytoprintit,wegetanexception:

> > >p r i n tc a t N a m e E r r o r :n a m e' c a t 'i sn o td e f i n e d

Parametersarealsolocal.Forexample,outside p r i n t _ t w i c e ,thereisnosuchthingasbruce.

Stackdiagrams
Tokeeptrackofwhichvariablescanbeusedwhere,itissometimesusefultodrawa stackdiagram.Likestatediagrams,stackdiagramsshowthevalueof eachvariable,buttheyalsoshowthefunctioneachvariablebelongsto. Eachfunctionisrepresentedbya frame.Aframeisaboxwiththenameofafunctionbesideitandtheparametersandvariablesofthefunctioninsideit.The stackdiagramforthepreviousexamplelookslikethis: File:Book004.pngTheframesarearrangedinastackthatindicateswhichfunctioncalledwhich,andsoon.Inthisexample, p r i n t _ t w i c e wascalledby c a t _ t w i c e ,and c a t _ t w i c e wascalledby _ _ m a i n _ _ ,whichisaspecialnameforthetopmostframe.Whenyoucreateavariableoutsideofanyfunction, itbelongsto _ _ m a i n _ _ . Eachparameterreferstothesamevalueasitscorrespondingargument.So,part1hasthesamevalueasline1,part2hasthesamevalueasline2,andbruce hasthesamevalueascat. Ifanerroroccursduringafunctioncall,Pythonprintsthenameofthefunction,andthenameofthefunctionthatcalledit,andthenameofthefunctionthat called that ,allthewaybackto _ _ m a i n _ _ . Forexample,ifyoutrytoaccesscatfromwithin
p r i n t _ t w i c e ,yougetaNameError:

T r a c e b a c k( i n n e r m o s tl a s t ) :
en.wikibooks.org/wiki/Think_Python/Print_version 32/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

F i l e" t e s t . p y " ,l i n e1 3 ,i n_ _ m a i n _ _ c a t _ t w i c e ( l i n e 1 ,l i n e 2 ) F i l e" t e s t . p y " ,l i n e5 ,i nc a t _ t w i c e p r i n t _ t w i c e ( c a t ) F i l e" t e s t . p y " ,l i n e9 ,i np r i n t _ t w i c e p r i n tc a t N a m e E r r o r :n a m e' c a t 'i sn o td e f i n e d

Thislistoffunctionsiscalleda traceback.Ittellsyouwhatprogramfiletheerroroccurredin,andwhatline,andwhatfunctionswereexecutingatthetime.It alsoshowsthelineofcodethatcausedtheerror. Theorderofthefunctionsinthetracebackisthesameastheorderoftheframesinthestackdiagram.Thefunctionthatiscurrentlyrunningisatthebottom.

Fruitfulfunctionsandvoidfunctions
Someofthefunctionsweareusing,suchasthemathfunctions,yieldresultsforlackofabettername,Icallthem fruitful functions.Otherfunctions,like p r i n t _ t w i c e ,performanactionbutdon'treturnavalue.Theyarecalled voidfunctions. Whenyoucallafruitfulfunction,youalmostalwayswanttodosomethingwiththeresultforexample,youmightassignittoavariableoruseitaspartofan expression:

x=m a t h . c o s ( r a d i a n s ) g o l d e n=( m a t h . s q r t ( 5 )+1 )/2

Whenyoucallafunctionininteractivemode,Pythondisplaystheresult:

> > >m a t h . s q r t ( 5 ) 2 . 2 3 6 0 6 7 9 7 7 4 9 9 7 8 9 8

Butinascript,ifyoucallafruitfulfunctionallbyitself,thereturnvalueislostforever!

m a t h . s q r t ( 5 )

en.wikibooks.org/wiki/Think_Python/Print_version

33/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thisscriptcomputesthesquarerootof5,butsinceitdoesn'tstoreordisplaytheresult,itisnotveryuseful. Voidfunctionsmightdisplaysomethingonthescreenorhavesomeothereffect,buttheydon'thaveareturnvalue.Ifyoutrytoassigntheresulttoavariable, yougetaspecialvaluecalledNone.

> > >r e s u l t=p r i n t _ t w i c e ( ' B i n g ' ) B i n g B i n g > > >p r i n tr e s u l t N o n e

ThevalueNoneisnotthesameasthestring ' N o n e ' .Itisaspecialvaluethathasitsowntype:

> > >p r i n tt y p e ( N o n e ) < t y p e' N o n e T y p e ' >

Thefunctionswehavewrittensofarareallvoid.Wewillstartwritingfruitfulfunctionsinafewchapters.

Whyfunctions?
Itmaynotbeclearwhyitisworththetroubletodivideaprogramintofunctions.Thereareseveralreasons: Creatinganewfunctiongivesyouanopportunitytonameagroupofstatements,whichmakesyourprogrameasiertoreadanddebug. Functionscanmakeaprogramsmallerbyeliminatingrepetitivecode.Later,ifyoumakeachange,youonlyhavetomakeitinoneplace. Dividingalongprogramintofunctionsallowsyoutodebugthepartsoneatatimeandthenassemblethemintoaworkingwhole. Welldesignedfunctionsareoftenusefulformanyprograms.Onceyouwriteanddebugone,youcanreuseit.

Debugging
Ifyouareusingatexteditortowriteyourscripts,youmightrunintoproblemswithspacesandtabs.Thebestwaytoavoidtheseproblemsistousespaces exclusively(notabs).MosttexteditorsthatknowaboutPythondothisbydefault,butsomedon't. Tabsandspacesareusuallyinvisible,whichmakesthemhardtodebug,sotrytofindaneditorthatmanagesindentationforyou.

en.wikibooks.org/wiki/Think_Python/Print_version

34/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Also,don'tforgettosaveyourprogrambeforeyourunit.Somedevelopmentenvironmentsdothisautomatically,butsomedon't.Inthatcasetheprogramyou arelookingatinthetexteditorisnotthesameastheprogramyouarerunning. Debuggingcantakealongtimeifyoukeeprunningthesame,incorrect,programoverandover! Makesurethatthecodeyouarelookingatisthecodeyouarerunning.Ifyou'renotsure,putsomethinglike p r i n t' h e l l o ' atthebeginningoftheprogramand runitagain.Ifyoudon'tsee h e l l o ,you'renotrunningtherightprogram!

Glossary
function:Anamedsequenceofstatementsthatperformssome usefuloperation.Functionsmayormaynottakeargumentsandmayormaynotproducearesult. functiondefinition:Astatementthatcreatesanewfunction, specifyingitsname,parameters,andthestatementsitexecutes. functionobject:Avaluecreatedbyafunctiondefinition. Thenameofthefunctionisavariablethatreferstoafunctionobject. header:Thefirstlineofafunctiondefinition. body:Thesequenceofstatementsinsideafunctiondefinition. parameter:Anameusedinsideafunctiontorefertothevalue passedasanargument. functioncall:Astatementthatexecutesafunction.It consistsofthefunctionnamefollowedbyanargumentlist. argument:Avalueprovidedtoafunctionwhenthefunctioniscalled. Thisvalueisassignedtothecorrespondingparameterinthefunction. localvariable:Avariabledefinedinsideafunction.Alocal variablecanonlybeusedinsideitsfunction.
en.wikibooks.org/wiki/Think_Python/Print_version 35/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

returnvalue:Theresultofafunction.Ifafunctioncall isusedasanexpression,thereturnvalueisthevalueoftheexpression. fruitfulfunction:Afunctionthatreturnsavalue. voidfunction:Afunctionthatdoesn'treturnavalue. module:Afilethatcontainsa collectionofrelatedfunctionsandotherdefinitions. importstatement:Astatementthatreadsamodulefileandcreates amoduleobject. moduleobject:Avaluecreatedbyanimportstatement thatprovidesaccesstothevaluesdefinedinamodule. dotnotation:Thesyntaxforcallingafunctioninanother modulebyspecifyingthemodulenamefollowedbyadot(period)andthefunctionname. composition:Usinganexpressionaspartofalargerexpression, orastatementaspartofalargerstatement. flowofexecution:Theorderinwhichstatementsareexecutedduring aprogramrun. stackdiagram:Agraphicalrepresentationofastackoffunctions, theirvariables,andthevaluestheyreferto. frame:Aboxinastackdiagramthatrepresentsafunctioncall. Itcontainsthelocalvariablesandparametersofthefunction. traceback:Alistofthefunctionsthatareexecuting, printedwhenanexceptionoccurs.

Exercises
en.wikibooks.org/wiki/Think_Python/Print_version 36/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise3
Pythonprovidesabuiltinfunctioncalledlenthat returnsthelengthofastring,sothevalueof l e n ( ' a l l e n ' ) is5. Writeafunctionnamed r i g h t _ j u s t i f y thattakesastringnamedsasaparameterandprintsthestringwithenoughleadingspacessothatthelastletterofthe stringisincolumn70ofthedisplay.
' ' > > >r i g h t _ j u s t i f y ( ' a l l e n ' ) a l l e n ' '

Exercise4
Afunctionobjectisavalueyoucanassigntoavariableorpassasanargument.Forexample, d o _ t w i c e isafunctionthattakesafunctionobjectasan argumentandcallsittwice:

' ' d e fd o _ t w i c e ( f ) : f ( ) f ( ) ' '

Heresanexamplethatuses d o _ t w i c e tocallafunctionnamed p r i n t _ s p a m twice.

' ' d e fp r i n t _ s p a m ( ) : p r i n t' s p a m ' d o _ t w i c e ( p r i n t _ s p a m ) ' '

1. Typethisexampleintoascriptandtestit. 2. Modify d o _ t w i c e sothatittakestwoarguments,afunctionobjectandavalue,andcallsthefunctiontwice,passingthevalueasanargument. 3. Writeamoregeneralversionof p r i n t _ s p a m ,called p r i n t _ t w i c e ,thattakesastringasaparameterandprintsittwice. 4. Usethemodifiedversionof d o _ t w i c e tocall p r i n t _ t w i c e twice,passing ' s p a m ' asanargument. 5. Defineanewfunctioncalled d o _ f o u r thattakesafunctionobjectandavalueandcallsthefunctionfourtimes,passingthevalueasaparameter.There shouldbeonlytwostatementsinthebodyofthisfunction,notfour. Youcanseemysolutionatthinkpython.com/code/do_four.py.
en.wikibooks.org/wiki/Think_Python/Print_version 37/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise5
Thisexercise' canbedoneusingonlythestatementsandotherfeatureswehavelearnedsofar. 1. Writeafunctionthatdrawsagridlikethefollowing:
' ' +----+----+ | | | | | | | | | | | | +----+----+ | | | | | | | | | | | | +----+----+ ' '

Hint:toprintmorethanonevalueonaline,youcanprintacommaseparatedsequence:
' ' p r i n t' + ' ,' '' '

Ifthesequenceendswithacomma,Pythonleavesthelineunfinished,sothevalueprintednextappearsonthesameline.
' ' p r i n t' + ' ,p r i n t' '' '

Theoutputofthesestatementsis ' +' . Aprintstatementallbyitselfendsthecurrentlineandgoestothenextline. 1. Usethepreviousfunctiontodrawasimilargridwithfourrowsandfourcolumns. Youcanseemysolutionatthinkpython.com/code/grid.py. Wewillseeexceptionstothisrulelater.BasedonanexerciseinOualline, PracticalCProgramming,ThirdEdition,OReilly(1997)

Casestudy:interfacedesign
TurtleWorld

en.wikibooks.org/wiki/Think_Python/Print_version

Toaccompanythisbook,IhavewrittenasuiteofmodulescalledSwampy.OneofthesemodulesisTurtleWorld,whichprovidesasetoffunctionsfordrawing 38/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Toaccompanythisbook,IhavewrittenasuiteofmodulescalledSwampy.OneofthesemodulesisTurtleWorld,whichprovidesasetoffunctionsfordrawing linesbysteeringturtlesaroundthescreen. YoucandownloadSwampyfrom t h i n k p y t h o n . c o m / s w a m p y( h t t p : / / t h i n k p y t h o n . c o m / s w a m p y ) followtheinstructionstheretoinstallSwampyonyoursystem. Moveintothedirectorythatcontains T u r t l e W o r l d . p y ,createafilenamed p o l y g o n . p y andtypeinthefollowingcode:


f r o mT u r t l e W o r l di m p o r t* w o r l d=T u r t l e W o r l d ( ) b o b=T u r t l e ( ) p r i n tb o b w a i t _ f o r _ u s e r ( )

Thefirstlineisavariationofthe i m p o r t statementwesawbeforeinsteadofcreatingamoduleobject,itimportsthefunctionsfromthemoduledirectly,soyou canaccessthemwithoutusingdotnotation. ThenextlinescreateaTurtleWorldassignedto w o r l d andaTurtleassignedto b o b .Printing b o b yieldssomethinglike:


< T u r t l e W o r l d . T u r t l ei n s t a n c ea t0 x b 7 b f b f 4 c >

Thismeansthat b o b referstoan instanceofaTurtleasdefinedinmodule T u r t l e W o r l d .Inthiscontext,"instance"meansamemberofasetthisTurtleisoneof thesetofpossibleTurtles.


w a i t _ f o r _ u s e r tellsTurtleWorldtowaitfortheusertodosomething,althoughinthiscasethere'snotmuchfortheusertodoexceptclosethewindow.

TurtleWorldprovidesseveralturtlesteeringfunctions: f d and b k forforwardandbackward,and l t and r t forleftandrightturns.Also,eachTurtleisholdinga pen,whichiseitherdownorupifthepenisdown,theTurtleleavesatrailwhenitmoves.Thefunctions p u and p d standforpenupandpendown. Todrawarightangle,addtheselinestotheprogram(aftercreating b o b andbeforecalling w a i t _ f o r _ u s e r ):
f d ( b o b ,1 0 0 ) r t ( b o b ) f d ( b o b ,1 0 0 )

Thefirstlinetells b o b totake100stepsforward.Thesecondlinetellshimtoturnright. Whenyourunthisprogram,youshouldsee b o b moveeastandthensouth,leavingtwolinesegmentsbehind. Nowmodifytheprogramtodrawasquare.Dontturnthepageuntilyou'vegotitworking!

Simplerepetition
en.wikibooks.org/wiki/Think_Python/Print_version 39/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Chancesareyouwrotesomethinglikethis(leavingoutthecodethatcreatesTurtleWorldandwaitsfortheuser):
f d ( b o b ,1 0 0 ) l t ( b o b ) f d ( b o b ,1 0 0 ) l t ( b o b ) f d ( b o b ,1 0 0 ) l t ( b o b ) f d ( b o b ,1 0 0 )

Wecandothesamethingmoreconciselywitha f o r statement.Addthisexampleto p o l y g o n . p y andrunitagain:

f o rii nr a n g e ( 4 ) : p r i n t' H e l l o ! '

Youshouldseesomethinglikethis:
H e l l o ! H e l l o ! H e l l o ! H e l l o !

Thisisthesimplestuseofthe f o r statementwewillseemorelater.Butthatshouldbeenoughtoletyourewriteyoursquaredrawingprogram.Dontturnthe pageuntilyoudo. Hereisa f o r statementthatdrawsasquare:


f o rii nr a n g e ( 4 ) : f d ( b o b ,1 0 0 ) l t ( b o b )

Thesyntaxofa f o r statementissimilartoafunctiondefinition.Ithasaheaderthatendswithacolonandanindentedbody.Thebodycancontainany numberofstatements. A f o r statementissometimescalleda loopbecausetheflowofexecutionrunsthroughthebodyandthenloopsbacktothetop.Inthiscase,itrunsthebody fourtimes.


en.wikibooks.org/wiki/Think_Python/Print_version 40/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thisversionisactuallyalittledifferentfromtheprevioussquaredrawingcodebecauseitmakesanotherleftturnafterdrawingthelastsideofthesquare.The extraturntakesalittlemoretime,butitsimplifiesthecodeifwedothesamethingeverytimethroughtheloop.Thisversionalsohastheeffectofleavingthe turtlebackinthestartingposition,facinginthestartingdirection.

Exercises
ThefollowingisaseriesofexercisesusingTurtleWorld.Theyaremeanttobefun,buttheyhaveapoint,too.Whileyouareworkingonthem,thinkabout whatthepointis. Thefollowingsectionshavesolutionstotheexercises,sodontlookuntilyouhavefinished(oratleasttried). Writeafunctioncalled s q u a r e thattakesaparameter named t ,whichisaturtle.Itshouldusetheturtletodrawasquare.Writeafunctioncallthatpasses b o b asanargumentto s q u a r e ,andthenruntheprogram again. Addanotherparameter,named l e n g t h ,to s q u a r e . Modifythebodysolengthofthesidesis l e n g t h ,andthenmodifythefunctioncalltoprovideasecondargument.Runtheprogramagain.Testyourprogram witharangeofvaluesfor l e n g t h . Thefunctions l t and r t make90degreeturnsby default,butyoucanprovideasecondargumentthatspecifiesthenumberofdegrees.Forexample, l t ( b o b ,4 5 ) turns b o b 45degreestotheleft.Makeacopyof s q u a r e andchangethenameto p o l y g o n .Addanotherparameternamed n andmodifythebodysoitdrawsannsidedregularpolygon.Hint:Theanglesofann sidedregularpolygonare360.0/ ndegrees.

Writeafunctioncalled c i r c l e thattakesaturtle, t , andradius, r ,asparametersandthatdrawsanapproximatecirclebyinvoking p o l y g o n withanappropriatelengthandnumberofsides.Testyourfunctionwitha rangeofvaluesof r .

Hint:figureoutthecircumferenceofthecircleandmakesurethat l e n g t h*n=c i r c u m f e r e n c e . Anotherhint:if b o b istooslowforyou,youcanspeedhimupbychanging b o b . d e l a y ,whichisthetimebetweenmoves,inseconds. b o b . d e l a y=0 . 0 1 oughttoget himmoving. Makeamoregeneralversionof c i r c l e called a r c
en.wikibooks.org/wiki/Think_Python/Print_version 41/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

thattakesanadditionalparameter a n g l e ,whichdetermineswhatfractionofacircletodraw. a n g l e isinunitsofdegrees,sowhen a n g l e = 3 6 0 , a r c shoulddrawa completecircle.

Encapsulation
Thefirstexerciseasksyoutoputyoursquaredrawingcodeintoafunctiondefinitionandthencallthefunction,passingtheturtleasaparameter.Hereisa solution:
d e fs q u a r e ( t ) : f o rii nr a n g e ( 4 ) : f d ( t ,1 0 0 ) l t ( t ) s q u a r e ( b o b )

Theinnermoststatements, f d and l t areindentedtwicetoshowthattheyareinsidethe f o r loop,whichisinsidethefunctiondefinition.Thenextline, s q u a r e ( b o b ) ,isflushwiththeleftmargin,sothatistheendofboththe f o r loopandthefunctiondefinition. Insidethefunction, t referstothesameturtle b o b refersto,so l t ( t ) hasthesameeffectas l t ( b o b ) .Sowhynotcalltheparameter b o b ?Theideaisthat t canbe anyturtle,notjust b o b ,soyoucouldcreateasecondturtleandpassitasanargumentto s q u a r e :
r a y=T u r t l e ( ) s q u a r e ( r a y )

Wrappingapieceofcodeupinafunctioniscalled encapsulation.Oneofthebenefitsofencapsulationisthatitattachesanametothecode,whichserves asakindofdocumentation.Anotheradvantageisthatifyoureusethecode,itismoreconcisetocallafunctiontwicethantocopyandpastethebody!

Generalization
Thenextstepistoadda l e n g t h parameterto s q u a r e .Hereisasolution:
d e fs q u a r e ( t ,l e n g t h ) : f o rii nr a n g e ( 4 ) : f d ( t ,l e n g t h ) l t ( t ) s q u a r e ( b o b ,1 0 0 )

Addingaparametertoafunctioniscalled generalizationbecauseitmakesthefunctionmoregeneral:inthepreviousversion,thesquareisalwaysthesame sizeinthisversionitcanbeanysize. Thenextstepisalsoageneralization.Insteadofdrawingsquares, p o l y g o n drawsregularpolygonswithanynumberofsides.Hereisasolution:


en.wikibooks.org/wiki/Think_Python/Print_version 42/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fp o l y g o n ( t ,n ,l e n g t h ) : a n g l e=3 6 0 . 0/n f o rii nr a n g e ( n ) : f d ( t ,l e n g t h ) l t ( t ,a n g l e ) p o l y g o n ( b o b ,7 ,7 0 )

Thisdrawsa7sidedpolygonwithsidelength70.Ifyouhavemorethanafewnumericarguments,itiseasytoforgetwhattheyare,orwhatordertheyshould bein.Itislegal,andsometimeshelpful,toincludethenamesoftheparametersintheargumentlist:
p o l y g o n ( b o b ,n = 7 ,l e n g t h = 7 0 )

Thesearecalled keywordargumentsbecausetheyincludetheparameternamesaskeywords(nottobeconfusedwithPythonkeywordslike w h i l e and d e f ). Thissyntaxmakestheprogrammorereadable.Itisalsoareminderabouthowargumentsandparameterswork:whenyoucallafunction,theargumentsare assignedtotheparameters.

Interfacedesign
Thenextstepistowrite c i r c l e ,whichtakesaradius, r ,asaparameter.Hereisasimplesolutionthatuses p o l y g o n todrawa50sidedpolygon:
d e fc i r c l e ( t ,r ) : c i r c u m f e r e n c e=2*m a t h . p i*r n=5 0 l e n g t h=c i r c u m f e r e n c e/n p o l y g o n ( t ,n ,l e n g t h )

Thefirstlinecomputesthecircumferenceofacirclewithradius r usingtheformula2 r.Sinceweuse m a t h . p i ,wehavetoimport m a t h .Byconvention, i m p o r t statementsareusuallyatthebeginningofthescript.


n isthenumberoflinesegmentsinourapproximationofacircle,so l e n g t h isthelengthofeachsegment.Thus, p o l y g o n drawsa50sidespolygonthat

approximatesacirclewithradius r . Onelimitationofthissolutionisthat n isaconstant,whichmeansthatforverybigcircles,thelinesegmentsaretoolong,andforsmallcircles,wewastetime drawingverysmallsegments.Onesolutionwouldbetogeneralizethefunctionbytaking n asaparameter.Thiswouldgivetheuser(whoevercalls c i r c l e )more control,buttheinterfacewouldbelessclean. The interfaceofafunctionisasummaryofhowitisused:whataretheparameters?Whatdoesthefunctiondo?Andwhatisthereturnvalue?Aninterfaceis cleanifitisassimpleaspossible,butnotsimpler.(Einstein) Inthisexample, r belongsintheinterfacebecauseitspecifiesthecircletobedrawn. n islessappropriatebecauseitpertainstothedetailsof howthecircle shouldberendered.
en.wikibooks.org/wiki/Think_Python/Print_version 43/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Ratherthanclutteruptheinterface,itisbettertochooseanappropriatevalueof n dependingon c i r c u m f e r e n c e :
d e fc i r c l e ( t ,r ) : c i r c u m f e r e n c e=2*m a t h . p i*r n=i n t ( c i r c u m f e r e n c e/3 )+1 l e n g t h=c i r c u m f e r e n c e/n p o l y g o n ( t ,n ,l e n g t h )

Nowthenumberofsegmentsis(approximately) c i r c u m f e r e n c e / 3 ,sothelengthofeachsegmentis(approximately)3,whichissmallenoughthatthecircleslook good,butbigenoughtobeefficient,andappropriateforanysizecircle.

Refactoring
WhenIwrote c i r c l e ,Iwasabletoreuse p o l y g o n becauseamanysidedpolygonisagoodapproximationofacircle.But a r c isnotascooperativewecantuse p o l y g o n or c i r c l e todrawanarc. Onealternativeistostartwithacopyof p o l y g o n andtransformitinto a r c .Theresultmightlooklikethis:
d e fa r c ( t ,r ,a n g l e ) : a r c _ l e n g t h=r*m a t h . r a d i a n s ( a n g l e ) n=i n t ( a r c _ l e n g t h/3 )+1 s t e p _ l e n g t h=a r c _ l e n g t h/n s t e p _ a n g l e=f l o a t ( a n g l e )/n f o rii nr a n g e ( n ) : f d ( t ,s t e p _ l e n g t h ) l t ( t ,s t e p _ a n g l e )

Thesecondhalfofthisfunctionlookslike p o l y g o n ,butwecantreuse p o l y g o n withoutchangingtheinterface.Wecouldgeneralize p o l y g o n totakeanangleasa thirdargument,butthen p o l y g o n wouldnolongerbeanappropriatename!Instead,letscallthemoregeneralfunction p o l y l i n e :


d e fp o l y l i n e ( t ,n ,l e n g t h ,a n g l e ) : f o rii nr a n g e ( n ) : f d ( t ,l e n g t h ) l t ( t ,a n g l e )

Nowwecanrewrite p o l y g o n and a r c touse p o l y l i n e :


d e fp o l y g o n ( t ,n ,l e n g t h ) : a n g l e=3 6 0 . 0/n p o l y l i n e ( t ,n ,l e n g t h ,a n g l e ) d e fa r c ( t ,r ,a n g l e ) :
en.wikibooks.org/wiki/Think_Python/Print_version 44/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

a r c _ l e n g t h=r*m a t h . r a d i a n s ( a n g l e ) n=i n t ( a r c _ l e n g t h/3 )+1 s t e p _ l e n g t h=a r c _ l e n g t h/n s t e p _ a n g l e=f l o a t ( a n g l e )/n p o l y l i n e ( t ,n ,s t e p _ l e n g t h ,s t e p _ a n g l e )

Finally,wecanrewrite c i r c l e touse a r c :
d e fc i r c l e ( t ,r ) : a r c ( t ,r ,3 6 0 )

Thisprocessrearrangingaprogramtoimprovefunctioninterfacesandfacilitatecodereuseiscalled refactoring.Inthiscase,wenoticedthattherewas similarcodein a r c and p o l y g o n ,sowefactoreditoutinto p o l y l i n e . Ifwehadplannedahead,wemighthavewritten p o l y l i n e firstandavoidedrefactoring,butoftenyoudontknowenoughatthebeginningofaprojecttodesign alltheinterfaces.Onceyoustartcoding,youunderstandtheproblembetter.Sometimesrefactoringisasignthatyouhavelearnedsomething.

Adevelopmentplan
A developmentplanisaprocessforwritingprograms.Theprocessweusedinthiscasestudyisencapsulationandgeneralization.Thestepsofthisprocess are: Startbywritingasmallprogramwithnofunctiondefinitions. Onceyougettheprogramworking,encapsulateitinafunction andgiveitaname. Generalizethefunctionbyaddingappropriateparameters. Repeatsteps13untilyouhaveasetofworkingfunctions. Copyandpasteworkingcodetoavoidretyping(andredebugging). Lookforopportunitiestoimprovetheprogrambyrefactoring. Forexample,ifyouhavesimilarcodeinseveralplaces,considerfactoringitintoanappropriatelygeneralfunction. Thisprocesshassomedrawbackswewillseealternativeslaterbutitcanbeusefulifyoudontknowaheadoftimehowtodividetheprograminto functions.Thisapproachletsyoudesignasyougoalong.

docstring

en.wikibooks.org/wiki/Think_Python/Print_version

45/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

A docstringisastringatthebeginningofafunctionthatexplainstheinterface(docisshortfordocumentation).Hereisanexample:
d e fp o l y l i n e ( t ,l e n g t h ,n ,a n g l e ) : " " " D r a wnl i n es e g m e n t sw i t ht h eg i v e nl e n g t ha n d a n g l e( i nd e g r e e s )b e t w e e nt h e m . ti sat u r t l e . " " " f o rii nr a n g e ( n ) : f d ( t ,l e n g t h ) l t ( t ,a n g l e )

Thisdocstringisatriplequotedstring,alsoknownasamultilinestringbecausethetriplequotesallowthestringtospanmorethanoneline. Itisterse,butitcontainstheessentialinformationsomeonewouldneedtousethisfunction.Itexplainsconciselywhatthefunctiondoes(withoutgettinginto thedetailsofhowitdoesit).Itexplainswhateffecteachparameterhasonthebehaviorofthefunctionandwhattypeeachparametershouldbe(ifitisnot obvious). Writingthiskindofdocumentationisanimportantpartofinterfacedesign.Awelldesignedinterfaceshouldbesimpletoexplainifyouarehavingahardtime explainingoneofyourfunctions,thatmightbeasignthattheinterfacecouldbeimproved.

Debugging
Aninterfaceislikeacontractbetweenafunctionandacaller.Thecalleragreestoprovidecertainparametersandthefunctionagreestodocertainwork. Forexample, p o l y l i n e requiresfourarguments.ThefirsthastobeaTurtle(orsomeotherobjectthatworkswith f d and l t ).Thesecondhastobeanumber, anditshouldprobablybepositive,althoughitturnsoutthatthefunctionworksevenifitisnt.Thethirdargumentshouldbeaninteger r a n g e complains otherwise(dependingonwhichversionofPythonyouarerunning).Thefourthhastobeanumber,whichisunderstoodtobeindegrees. Theserequirementsarecalled preconditionsbecausetheyaresupposedtobetruebeforethefunctionstartsexecuting.Conversely,conditionsattheendof thefunctionare postconditions.Postconditionsincludetheintendedeffectofthefunction(likedrawinglinesegments)andanysideeffects(likemovingthe TurtleormakingotherchangesintheWorld). Preconditionsaretheresponsibilityofthecaller.Ifthecallerviolatesa(properlydocumented!)preconditionandthefunctiondoesntworkcorrectly,thebugis inthecaller,notthefunction.However,forpurposesofdebuggingitisoftenagoodideaforfunctionstochecktheirpreconditionsratherthanassumetheyare true.Ifeveryfunctionchecksitspreconditionsbeforestarting,thenifsomethinggoeswrong,youwillknowwhichfunctiontoblame.

Glossary
instance: Amemberofaset.TheTurtleWorldinthischapterisamemberofthesetofTurtleWorlds. loop: Apartofaprogramthatcanexecuterepeatedly. encapsulation: Theprocessoftransformingasequenceofstatementsintoafunctiondefinition.
en.wikibooks.org/wiki/Think_Python/Print_version 46/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

generalization: Theprocessofreplacingsomethingunnecessarilyspecific(likeanumber)withsomethingappropriatelygeneral(likeavariableorparameter). keywordargument: Anargumentthatincludesthenameoftheparameterasakeyword. interface: Adescriptionofhowtouseafunction,includingthenameanddescriptionsoftheargumentsandreturnvalue. developmentplan: Aprocessforwritingprograms. docstring: Astringthatappearsinafunctiondefinitiontodocumentthefunctionsinterface. precondition: Arequirementthatshouldbesatisfiedbythecallerbeforeafunctionstarts. postcondition: Arequirementthatshouldbesatisfiedbythefunctionbeforeitends.

Exercises
Exercise1 Downloadthecodeinthischapterfrom't h i n k p y t h o n . c o m / c o d e / p o l y g o n . p y '. Writeappropriatedocstringsfor'p o l y g o n ','a r c 'and 'c i r c l e '. Drawastackdiagramthatshowsthestateoftheprogram whileexecuting'c i r c l e ( b o b ,r a d i u s ) '.Youcandothearithmeticbyhandoradd'p r i n t 'statementstothecode. Theversionof'a r c 'inSection'4.7'isnot veryaccuratebecausethelinearapproximationofthecircleisalwaysoutsidethetruecircle.Asaresult,theturtleendsupafewunitsawayfromthecorrect destination.Mysolutionshowsawaytoreducetheeffectofthiserror.Readthecodeandseeifitmakessensetoyou.Ifyoudrawadiagram,youmightsee howitworks. Exercise2 Writeanappropriatelygeneralsetoffunctionsthat candrawflowerslikethis: <IMGSRC="book005.png"> Youcandownloadasolutionfrom't h i n k p y t h o n . c o m / c o d e / f l o w e r . p y '. Exercise3 Writeanappropriatelygeneralsetoffunctionsthat candrawshapeslikethis:
en.wikibooks.org/wiki/Think_Python/Print_version 47/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

<IMGSRC="book006.png"> Youcandownloadasolutionfrom't h i n k p y t h o n . c o m / c o d e / p i e . p y '. Exercise4 '' Thelettersofthealphabetcanbeconstructedfromamoderatenumberofbasicelements,likeverticalandhorizontallinesandafewcurves.Designafont thatcanbedrawnwithaminimalnumberofbasicelementsandthenwritefunctionsthatdrawlettersofthealphabet. Youshouldwriteonefunctionforeachletter,withnames d r a w _ a , d r a w _ b ,etc.,andputyourfunctionsinafilenamed'l e t t e r s . p y '.Youcandownloadaturtle typewriterfrom't h i n k p y t h o n . c o m / c o d e / t y p e w r i t e r . p y 'tohelpyoutestyourcode. Youcandownloadasolutionfrom't h i n k p y t h o n . c o m / c o d e / l e t t e r s . p y '.

Conditionalandrecursion
Modulusoperator
The modulusoperatorworksonintegersandyieldstheremainderwhenthefirstoperandisdividedbythesecond.InPython,themodulusoperatorisa percentsign(% ).Thesyntaxisthesameasforotheroperators:
> > >q u o t i e n t=7/ /3 > > >p r i n t ( q u o t i e n t ) 2 > > >r e m a i n d e r=7%3 > > >p r i n t ( r e m a i n d e r ) 1

So7dividedby3is2with1leftover. Themodulusoperatorturnsouttobesurprisinglyuseful.Forexample,youcancheckwhetheronenumberisdivisiblebyanotherif x%y iszero,then x is divisibleby y . Also,youcanextracttherightmostdigitordigitsfromanumber.Forexample, x%1 0 yieldstherightmostdigitof x (inbase10).Similarly x%1 0 0 yieldsthe lasttwodigits.

Booleanexpressions
A booleanexpressionisanexpressionthatiseithertrueorfalse.Thefollowingexamplesusetheoperator = = ,whichcomparestwooperandsandproduces T r u e iftheyareequaland F a l s e otherwise:
> > >5= =5 T r u e
en.wikibooks.org/wiki/Think_Python/Print_version 48/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >5= =6 F a l s e


T r u e and F a l s e arespecialvaluesthatbelongtothetype b o o l theyarenotstrings:

> > >t y p e ( T r u e ) < t y p e' b o o l ' > > > >t y p e ( F a l s e ) < t y p e' b o o l ' >

The = = operatorisoneofthe comparisonoperatorstheothersare:


x! =y x>y x<y x> =y x< =y #xi sn o te q u a lt oy #xi sg r e a t e rt h a ny #xi sl e s st h a ny #xi sg r e a t e rt h a no re q u a lt oy #xi sl e s st h a no re q u a lt oy

Althoughtheseoperationsareprobablyfamiliartoyou,thePythonsymbolsaredifferentfromthemathematicalsymbols.Acommonerroristouseasingle equalsign(= )insteadofadoubleequalsign(= = ).Rememberthat = isanassignmentoperatorand = = isacomparisonoperator.Thereisnosuchthingas = < or = > .

Logicaloperators
Therearethree logicaloperators: a n d , o r ,and n o t .Thesemantics(meaning)oftheseoperatorsissimilartotheirmeaninginEnglish.Forexample, x>0a n dx <1 0 istrueonlyif x isgreaterthan0 andlessthan10.
n % 2= =0o rn % 3= =0 istrueif eitheroftheconditionsistrue,thatis,ifthenumberisdivisibleby2 or3.

Finally,the n o t operatornegatesabooleanexpression,so n o t( x>y ) istrueif x>y isfalse,thatis,if x islessthanorequalto y . Strictlyspeaking,theoperandsofthelogicaloperatorsshouldbebooleanexpressions,butPythonisnotverystrict.Anynonzeronumberisinterpretedas true.


> > >1 7a n dT r u e T r u e

Thisflexibilitycanbeuseful,buttherearesomesubtletiestoitthatmightbeconfusing.Youmightwanttoavoidit(unlessyouknowwhatyouaredoing).

Conditionalexecution
Inordertowriteusefulprograms,wealmostalwaysneedtheabilitytocheckconditionsandchangethebehavioroftheprogramaccordingly. Conditional

en.wikibooks.org/wiki/Think_Python/Print_version

49/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Inordertowriteusefulprograms,wealmostalwaysneedtheabilitytocheckconditionsandchangethebehavioroftheprogramaccordingly. Conditional statementsgiveusthisability.Thesimplestformisthe i f statement:


i fx>0 : p r i n t' xi sp o s i t i v e '

Thebooleanexpressionafterthe i f statementiscalledthe condition.Ifitistrue,thentheindentedstatementgetsexecuted.Ifnot,nothinghappens.


i f statementshavethesamestructureasfunctiondefinitions:aheaderfollowedbyanindentedblock.Statementslikethisarecalled compoundstatements.

Thereisnolimitonthenumberofstatementsthatcanappearinthebody,buttherehastobeatleastone.Occasionally,itisusefultohaveabodywithno statements(usuallyasaplacekeeperforcodeyouhaven'twrittenyet).Inthatcase,youcanusethe p a s s statement,whichdoesnothing.


i fx<0 : p a s s

#n e e dt oh a n d l en e g a t i v ev a l u e s !

Alternativeexecution
Asecondformofthe i f statementis alternativeexecution,inwhichtherearetwopossibilitiesandtheconditiondetermineswhichonegetsexecuted.The syntaxlookslikethis:
i fx%2= =0 : p r i n t' xi se v e n ' e l s e : p r i n t' xi so d d '

Iftheremainderwhen x isdividedby2is0,thenweknowthat x iseven,andtheprogramdisplaysamessagetothateffect.Iftheconditionisfalse,the secondsetofstatementsisexecuted.Sincetheconditionmustbetrueorfalse,exactlyoneofthealternativeswillbeexecuted.Thealternativesarecalled branches,becausetheyarebranchesintheflowofexecution.

Chainedconditionals
Sometimestherearemorethantwopossibilitiesandweneedmorethantwobranches.Onewaytoexpressacomputationlikethatisa chainedconditional :
i fx<y : p r i n t' xi sl e s st h a ny ' e l i fx>y : p r i n t' xi sg r e a t e rt h a ny ' e l s e : p r i n t' xa n dya r ee q u a l '

e l i f isanabbreviationofelseif.Again,exactlyonebranchwillbeexecuted.Thereisnolimitonthenumberof e l i f statements.Ifthereisan e l s e clause,it50/282 en.wikibooks.org/wiki/Think_Python/Print_version

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

e l i f isanabbreviationofelseif.Again,exactlyonebranchwillbeexecuted.Thereisnolimitonthenumberof e l i f statements.Ifthereisan e l s e clause,it

hastobeattheend,buttheredoesnthavetobeone.
i fc h o i c e= =' a ' : d r a w _ a ( ) e l i fc h o i c e= =' b ' : d r a w _ b ( ) e l i fc h o i c e= =' c ' : d r a w _ c ( )

Eachconditionischeckedinorder.Ifthefirstisfalse,thenextischecked,andsoon.Ifoneofthemistrue,thecorrespondingbranchexecutes,andthe statementends.Evenifmorethanoneconditionistrue,onlythefirsttruebranchexecutes.

Nestedconditionals
Oneconditionalcanalsobenestedwithinanother.Wecouldhavewrittenthetrichotomyexamplelikethis:
i fx= =y : p r i n t' xa n dya r ee q u a l ' e l s e : i fx<y : p r i n t' xi sl e s st h a ny ' e l s e : p r i n t' xi sg r e a t e rt h a ny '

Theouterconditionalcontainstwobranches.Thefirstbranchcontainsasimplestatement.Thesecondbranchcontainsanother i f statement,whichhastwo branchesofitsown.Thosetwobranchesarebothsimplestatements,althoughtheycouldhavebeenconditionalstatementsaswell. Althoughtheindentationofthestatementsmakesthestructureapparent, nestedconditionalsbecomedifficulttoreadveryquickly.Ingeneral,itisagood ideatoavoidthemwhenyoucan. Logicaloperatorsoftenprovideawaytosimplifynestedconditionalstatements.Forexample,wecanrewritethefollowingcodeusingasingleconditional:


i f0<x : i fx<1 0 : p r i n t' xi sap o s i t i v es i n g l e d i g i tn u m b e r . '

The p r i n t statementisexecutedonlyifwemakeitpastbothconditionals,sowecangetthesameeffectwiththe a n d operator:


i f0<xa n dx<1 0 : p r i n t' xi sap o s i t i v es i n g l e d i g i tn u m b e r . '

en.wikibooks.org/wiki/Think_Python/Print_version

51/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Recursion
Itislegalforonefunctiontocallanotheritisalsolegalforafunctiontocallitself.Itmaynotbeobviouswhythatisagoodthing,butitturnsouttobeoneof themostmagicalthingsaprogramcando.Forexample,lookatthefollowingfunction:
d e fc o u n t d o w n ( n ) : i fn< =0 : p r i n t' B l a s t o f f ! ' e l s e : p r i n tn c o u n t d o w n ( n 1 )

If n is0ornegative,itoutputstheword,Blastoff!Otherwise,itoutputs n andthencallsafunctionnamed c o u n t d o w n itselfpassing n 1 asanargument. Whathappensifwecallthisfunctionlikethis?


> > >c o u n t d o w n ( 3 )

Theexecutionof c o u n t d o w n beginswith n = 3 ,andsince n isgreaterthan0,itoutputsthevalue3,andthencallsitself... Theexecutionof c o u n t d o w n beginswith n = 2 ,andsince


n isgreaterthan0,itoutputsthevalue2,andthencallsitself...

Theexecutionof c o u n t d o w n beginswith n = 1 ,andsince


n isgreaterthan0,itoutputsthevalue1,andthencallsitself...

Theexecutionof c o u n t d o w n beginswith n = 0 ,andsince n isnotgreaterthan0,itoutputstheword,Blastoff!andthen returns. The c o u n t d o w n thatgot n = 1 returns. The c o u n t d o w n thatgot n = 2 returns. The c o u n t d o w n thatgot n = 3 returns. Andthenyourebackin _ _ m a i n _ _ .So,thetotaloutputlookslikethis:
3 2 1 B l a s t o f f !
en.wikibooks.org/wiki/Think_Python/Print_version 52/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Afunctionthatcallsitselfis recursivetheprocessiscalled recursion. Asanotherexample,wecanwriteafunctionthatprintsastring n times.


d e fp r i n t _ n ( s ,n ) : i fn< =0 : r e t u r n p r i n ts p r i n t _ n ( s ,n 1 )

If n< =0 the r e t u r n statementexitsthefunction.Theflowofexecutionimmediatelyreturnstothecaller,andtheremaininglinesofthefunctionarenot executed. Therestofthefunctionissimilarto c o u n t d o w n :if n isgreaterthan0,itdisplays s andthencallsitselftodisplay s n1additionaltimes.Sothenumberoflinesof outputis 1+( n-1 ) ,whichaddsupto n . Forsimpleexampleslikethis,itisprobablyeasiertousea f o r loop.Butwewillseeexampleslaterthatarehardtowritewitha f o r loopandeasytowritewith recursion,soitisgoodtostartearly.

Stackdiagramsforrecursivefunctions
InSection3.10,weusedastackdiagramtorepresentthestateofaprogramduringafunctioncall.Thesamekindofdiagramcanhelpinterpretarecursive function. Everytimeafunctiongetscalled,Pythoncreatesanewfunctionframe,whichcontainsthefunctionslocalvariablesandparameters.Forarecursivefunction, theremightbemorethanoneframeonthestackatthesametime. Thisfigureshowsastackdiagramfor c o u n t d o w n calledwith n=3 : <IMGSRC="book007.png"> Asusual,thetopofthestackistheframefor _ _ m a i n _ _ .Itisemptybecausewedidnotcreateanyvariablesin _ _ m a i n _ _ orpassanyargumentstoit. Thefour c o u n t d o w n frameshavedifferentvaluesfortheparameter n .Thebottomofthestack,where n = 0 ,iscalledthe basecase.Itdoesnotmakearecursive call,sotherearenomoreframes. Drawastackdiagramfor p r i n t _ n calledwith s=' H e l l o ' and n = 2 . Writeafunctioncalled d o _ n thattakesafunctionobjectandanumber, n asarguments,andthatcallsthegivenfunction n times.

Infiniterecursion
Ifarecursionneverreachesabasecase,itgoesonmakingrecursivecallsforever,andtheprogramneverterminates.Thisisknownas infiniterecursion, anditisgenerallynotagoodidea.Hereisaminimalprogramwithaninfiniterecursion:
en.wikibooks.org/wiki/Think_Python/Print_version 53/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fr e c u r s e ( ) : r e c u r s e ( )

Inmostprogrammingenvironments,aprogramwithinfiniterecursiondoesnotreallyrunforever.Pythonreportsanerrormessagewhenthemaximum recursiondepthisreached:
F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e . . . F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e R u n t i m e E r r o r :M a x i m u mr e c u r s i o nd e p t he x c e e d e d

Thistracebackisalittlebiggerthantheonewesawinthepreviouschapter.Whentheerroroccurs,thereare1000 r e c u r s e framesonthestack!

Keyboardinput
Theprogramswehavewrittensofarareabitrudeinthesensethattheyacceptnoinputfromtheuser.Theyjustdothesamethingeverytime. Pythonprovidesabuiltinfunctioncalled r a w _ i n p u t thatgetsinputfromthekeyboard[1].Whenthisfunctioniscalled,theprogramstopsandwaitsfortheuserto typesomething.WhentheuserpressesReturnorEnter,theprogramresumesand r a w _ i n p u t returnswhattheusertypedasastring.
> > >i n p u t=r a w _ i n p u t ( ) W h a ta r ey o uw a i t i n gf o r ? > > >p r i n ti n p u t W h a ta r ey o uw a i t i n gf o r ?

Beforegettinginputfromtheuser,itisagoodideatoprintaprompttellingtheuserwhattoinput. r a w _ i n p u t cantakeapromptasanargument:
> > >n a m e=r a w _ i n p u t ( ' W h a t . . . i sy o u rn a m e ? \ n ' ) W h a t . . . i sy o u rn a m e ? A r t h u r ,K i n go ft h eB r i t o n s ! > > >p r i n tn a m e A r t h u r ,K i n go ft h eB r i t o n s !

Thesequence \ n attheendofthepromptrepresentsa newline,whichisaspecialcharacterthatcausesalinebreak.Thatswhytheusersinputappears belowtheprompt. Ifyouexpecttheusertotypeaninteger,youcantrytoconvertthereturnvalueto i n t :


en.wikibooks.org/wiki/Think_Python/Print_version 54/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >p r o m p t=' W h a t . . . i st h ea i r s p e e dv e l o c i t yo fa nu n l a d e ns w a l l o w ? \ n ' > > >s p e e d=r a w _ i n p u t ( p r o m p t ) W h a t . . . i st h ea i r s p e e dv e l o c i t yo fa nu n l a d e ns w a l l o w ? 1 7 > > >i n t ( s p e e d ) 1 7

Butiftheusertypessomethingotherthanastringofdigits,yougetanerror:
> > >s p e e d=r a w _ i n p u t ( p r o m p t ) W h a t . . . i st h ea i r s p e e dv e l o c i t yo fa nu n l a d e ns w a l l o w ? W h a td oy o um e a n ,a nA f r i c a no raE u r o p e a ns w a l l o w ? > > >i n t ( s p e e d ) V a l u e E r r o r :i n v a l i dl i t e r a lf o ri n t ( )

Wewillseehowtohandlethiskindoferrorlater.

Debugging
ThetracebackPythondisplayswhenanerroroccurscontainsalotofinformation,butitcanbeoverwhelming,especiallywhentherearemanyframesonthe stack.Themostusefulpartsareusually: Whatkindoferroritwas,and Whereitoccurred. Syntaxerrorsareusuallyeasytofind,butthereareafewgotchas.Whitespaceerrorscanbetrickybecausespacesandtabsareinvisibleandweareusedto ignoringthem.
> > >x=5 > > > y=6 F i l e" < s t d i n > " ,l i n e1 y=6 ^ S y n t a x E r r o r :i n v a l i ds y n t a x

Inthisexample,theproblemisthatthesecondlineisindentedbyonespace.Buttheerrormessagepointsto y ,whichismisleading.Ingeneral,error messagesindicatewheretheproblemwasdiscovered,buttheactualerrormightbeearlierinthecode,sometimesonapreviousline. Thesameistrueofruntimeerrors.Supposeyouaretryingtocomputeasignaltonoiseratioindecibels.Theformulais SNRdb=10log10(P signal/ P noise).In Python,youmightwritesomethinglikethis:


i m p o r tm a t h
en.wikibooks.org/wiki/Think_Python/Print_version 55/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

s i g n a l _ p o w e r=9 n o i s e _ p o w e r=1 0 r a t i o=s i g n a l _ p o w e r/n o i s e _ p o w e r d e c i b e l s=1 0*m a t h . l o g 1 0 ( r a t i o ) p r i n td e c i b e l s

Butwhenyourunit,yougetanerrormessage:
T r a c e b a c k( m o s tr e c e n tc a l ll a s t ) : F i l e" s n r . p y " ,l i n e5 ,i n? d e c i b e l s=1 0*m a t h . l o g 1 0 ( r a t i o ) O v e r f l o w E r r o r :m a t hr a n g ee r r o r

Theerrormessageindicatesline5,butthereisnothingwrongwiththatline.Tofindtherealerror,itmightbeusefultoprintthevalueof r a t i o ,whichturnsout tobe0.Theproblemisinline4,becausedividingtwointegersdoesfloordivision.Thesolutionistorepresentsignalpowerandnoisepowerwithfloatingpoint values. Ingeneral,errormessagestellyouwheretheproblemwasdiscovered,butthatisoftennotwhereitwascaused.

Glossary
modulusoperator: Anoperator,denotedwithapercentsign(% ),thatworksonintegersandyieldstheremainderwhenonenumberisdividedbyanother. booleanexpression: Anexpressionwhosevalueiseither T r u e or F a l s e . comparisonoperator: Oneoftheoperatorsthatcomparesitsoperands: = = , ! = , > , < , > = ,and < = . logicaloperator: Oneoftheoperatorsthatcombinesbooleanexpressions: a n d , o r ,and n o t . conditionalstatement: Astatementthatcontrolstheflowofexecutiondependingonsomecondition. condition: Thebooleanexpressioninaconditionalstatementthatdetermineswhichbranchisexecuted. compoundstatement: Astatementthatconsistsofaheaderandabody.Theheaderendswithacolon(:).Thebodyisindentedrelativetotheheader. body: Thesequenceofstatementswithinacompoundstatement. branch: Oneofthealternativesequencesofstatementsinaconditionalstatement.
en.wikibooks.org/wiki/Think_Python/Print_version 56/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

chainedconditional: Aconditionalstatementwithaseriesofalternativebranches. nestedconditional: Aconditionalstatementthatappearsinoneofthebranchesofanotherconditionalstatement. recursion: Theprocessofcallingthefunctionthatiscurrentlyexecuting. basecase: Aconditionalbranchinarecursivefunctionthatdoesnotmakearecursivecall. infiniterecursion: Afunctionthatcallsitselfrecursivelywithouteverreachingthebasecase.Eventually,aninfiniterecursioncausesaruntimeerror.

Exercises
Exercise1 FermatsLastTheoremsaysthattherearenointegers'a','b',and'c'suchthat an+ bn= cn foranyvaluesof'n'greaterthan2. Writeafunctionnamed c h e c k _ f e r m a t thattakesfour parameters'a ','b ','c 'and'n 'andthatcheckstoseeifFermatstheoremholds.If 'n'isgreaterthan2anditturnsouttobetruethat 'a''n ' '+ b''n ' '= c''n ' '' 'theprogramshouldprint,Holysmokes,Fermatwaswrong!Otherwisetheprogramshouldprint,No,thatdoesntwork.' 'Writeafunctionthatpromptstheusertoinputvalues for'''a ''','''b ''','''c '''and'''n ''',convertsthemtointegers,anduses'' c h e c k _ f e r m a t ' 'tocheckwhethertheyviolateFermatstheorem.' Exercise2 Ifyouaregiventhreesticks,youmayormaynotbeabletoarrangetheminatriangle.Forexample,ifoneofthesticksis12incheslongandthe othertwoareoneinchlong,itisclearthatyouwillnotbeabletogettheshortstickstomeetinthemiddle.Foranythreelengths,thereisasimpletesttosee ifitispossibletoformatriangle: Ifanyofthethreelengthsisgreaterthanthesumoftheothertwo,thenyoucannotformatriangle.Otherwise,youcan[2]. Writeafunctionnamed i s _ t r i a n g l e thattakesthree

en.wikibooks.org/wiki/Think_Python/Print_version

57/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

integersasarguments,andthatprintseitherYesorNo,dependingonwhetheryoucanorcannotformatrianglefromstickswiththegivenlengths. Writeafunctionthatpromptstheusertoinputthreestick lengths,convertsthemtointegers,anduses i s _ t r i a n g l e tocheckwhetherstickswiththegivenlengthscanformatriangle. ThefollowingexercisesuseTurtleWorldfromChapter4: Exercise3 Readthefollowingfunctionandseeifyoucanfigureout whatitdoes.Thenrunit(seetheexamplesinChapter'4').


' ' d e fd r a w ( t ,l e n g t h ,n ) : i fn= =0 : r e t u r n a n g l e=5 0 f d ( t ,l e n g t h * n ) l t ( t ,a n g l e ) d r a w ( t ,l e n g t h ,n 1 ) r t ( t ,2 * a n g l e ) d r a w ( t ,l e n g t h ,n 1 ) l t ( t ,a n g l e ) b k ( t ,l e n g t h * n ) ' '

Exercise4 TheKochcurveisafractalthatlookssomethinglikethis: <IMGSRC="book008.png"> TodrawaKochcurvewithlength'x',allyouhavetodois DrawaKochcurvewithlength'x/3'. Turnleft60degrees. DrawaKochcurvewithlength'x/3'. Turnright120degrees. DrawaKochcurvewithlength'x/3'. Turnleft60degrees. DrawaKochcurvewithlength'x/3'.
en.wikibooks.org/wiki/Think_Python/Print_version 58/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theonlyexceptionisif'x'islessthan3.Inthatcase, youcanjustdrawastraightlinewithlength'x'. Writeafunctioncalled'k o c h 'thattakesaturtleand alengthasparameters,andthatusestheturtletodrawaKochcurvewiththegivenlength. Writeafunctioncalled's n o w f l a k e 'thatdrawsthree Kochcurvestomaketheoutlineofasnowflake. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / k o c h . p y '. TheKochcurvecanbegeneralizedinseveralways.See 'w i k i p e d i a . o r g / w i k i / K o c h _ s n o w f l a k e 'forexamplesandimplementyourfavorite.

Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.

Fruitfulfunctions
Returnvalues
Someofthebuiltinfunctionswehaveused,suchasthemathfunctions,produceresults.Callingthefunctiongeneratesavalue,whichweusuallyassigntoa variableoruseaspartofanexpression.
e=m a t h . e x p ( 1 . 0 ) h e i g h t=r a d i u s*m a t h . s i n ( r a d i a n s )

Allofthefunctionswehavewrittensofararevoidtheyprintsomethingormoveturtlesaround,buttheirreturnvalueis N o n e . Inthischapter,weare(finally)goingtowritefruitfulfunctions.Thefirstexampleis a r e a ,whichreturnstheareaofacirclewiththegivenradius:


d e fa r e a ( r a d i u s ) : t e m p=m a t h . p i*r a d i u s * * 2 r e t u r nt e m p

Wehaveseenthe r e t u r n statementbefore,butinafruitfulfunctionthe r e t u r n statementincludesanexpression.Thisstatementmeans:Returnimmediately fromthisfunctionandusethefollowingexpressionasareturnvalue.Theexpressioncanbearbitrarilycomplicated,sowecouldhavewrittenthisfunction moreconcisely:


d e fa r e a ( r a d i u s ) :
en.wikibooks.org/wiki/Think_Python/Print_version 59/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r nm a t h . p i*r a d i u s * * 2

Ontheotherhand, temporaryvariableslike t e m p oftenmakedebuggingeasier. Sometimesitisusefultohavemultiplereturnstatements,oneineachbranchofaconditional:


d e fa b s o l u t e _ v a l u e ( x ) : i fx<0 : r e t u r nx e l s e : r e t u r nx

Sincethese r e t u r n statementsareinanalternativeconditional,onlyonewillbeexecuted. Assoonasareturnstatementexecutes,thefunctionterminateswithoutexecutinganysubsequentstatements.Codethatappearsaftera r e t u r n statement,or anyotherplacetheflowofexecutioncanneverreach,iscalled deadcode. Inafruitfulfunction,itisagoodideatoensurethateverypossiblepaththroughtheprogramhitsa r e t u r n statement.Forexample:


d e fa b s o l u t e _ v a l u e ( x ) : i fx<0 : r e t u r nx i fx>0 : r e t u r nx

Thisfunctionisincorrectbecauseif x happenstobe0,neitherconditionistrue,andthefunctionendswithouthittinga r e t u r n statement.Iftheflowof executiongetstotheendofafunction,thereturnvalueis N o n e ,whichisnottheabsolutevalueof0.


> > >p r i n ta b s o l u t e _ v a l u e ( 0 ) N o n e

Bytheway,Pythonprovidesabuiltinfunctioncalled a b s thatcomputesabsolutevalues.

Exercise1
Writea'c o m p a r e 'functionthatreturns'1 'if'x>y ','0 'if'x= =y ',and'1 'if'x<y '.

Incrementaldevelopment
Asyouwritelargerfunctions,youmightfindyourselfspendingmoretimedebugging.

en.wikibooks.org/wiki/Think_Python/Print_version

Todealwithincreasinglycomplexprograms,youmightwanttotryaprocesscalled incrementaldevelopment.Thegoalofincrementaldevelopmentisto

60/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Todealwithincreasinglycomplexprograms,youmightwanttotryaprocesscalled incrementaldevelopment.Thegoalofincrementaldevelopmentisto avoidlongdebuggingsessionsbyaddingandtestingonlyasmallamountofcodeatatime. Asanexample,supposeyouwanttofindthedistancebetweentwopoints,givenbythecoordinates(x1, y1)and(x2, y2).BythePythagoreantheorem,the distanceis:

Thefirststepistoconsiderwhata d i s t a n c e functionshouldlooklikeinPython.Inotherwords,whataretheinputs(parameters)andwhatistheoutput(return value)? Inthiscase,theinputsaretwopoints,whichyoucanrepresentusingfournumbers.Thereturnvalueisthedistance,whichisafloatingpointvalue. Alreadyyoucanwriteanoutlineofthefunction:


d e fd i s t a n c e ( x 1 ,y 1 ,x 2 ,y 2 ) : r e t u r n0 . 0

Obviously,thisversiondoesn'tcomputedistancesitalwaysreturnszero.Butitissyntacticallycorrect,anditruns,whichmeansthatyoucantestitbeforeyou makeitmorecomplicated. Totestthenewfunction,callitwithsamplearguments:


> > >d i s t a n c e ( 1 ,2 ,4 ,6 ) 0 . 0

Ichosethesevaluessothatthehorizontaldistanceis3andtheverticaldistanceis4thatway,theresultis5(thehypotenuseofa345triangle).When testingafunction,itisusefultoknowtherightanswer. Atthispointwehaveconfirmedthatthefunctionissyntacticallycorrect,andwecanstartaddingcodetothebody.Areasonablenextstepistofindthe differences x2 x1and y2 y1.Thenextversionstoresthosevaluesintemporaryvariablesandprintsthem.


d e fd i s t a n c e ( x 1 ,y 1 ,x 2 ,y 2 ) : d x=x 2-x 1 d y=y 2-y 1 p r i n t' d xi s ' ,d x p r i n t' d yi s ' ,d y r e t u r n0 . 0

Ifthefunctionisworking,itshoulddisplay ' d xi s3 ' and d yi s4 .Ifso,weknowthatthefunctionisgettingtherightargumentsandperformingthefirst computationcorrectly.Ifnot,thereareonlyafewlinestocheck. Nextwecomputethesumofsquaresof d x and d y :


en.wikibooks.org/wiki/Think_Python/Print_version 61/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fd i s t a n c e ( x 1 ,y 1 ,x 2 ,y 2 ) : d x=x 2-x 1 d y=y 2-y 1 d s q u a r e d=d x * * 2+d y * * 2 p r i n t' d s q u a r e di s :' ,d s q u a r e d r e t u r n0 . 0

Again,youwouldruntheprogramatthisstageandchecktheoutput(whichshouldbe25).Finally,youcanuse m a t h . s q r t tocomputeandreturntheresult:
d e fd i s t a n c e ( x 1 ,y 1 ,x 2 ,y 2 ) : d x=x 2-x 1 d y=y 2-y 1 d s q u a r e d=d x * * 2+d y * * 2 r e s u l t=m a t h . s q r t ( d s q u a r e d ) r e t u r nr e s u l t

Ifthatworkscorrectly,youaredone.Otherwise,youmightwanttoprintthevalueof r e s u l t beforethereturnstatement. Thefinalversionofthefunctiondoesntdisplayanythingwhenitrunsitonlyreturnsavalue.The p r i n t statementswewroteareusefulfordebugging,butonce yougetthefunctionworking,youshouldremovethem.Codelikethatiscalled scaffoldingbecauseitishelpfulforbuildingtheprogrambutisnotpartofthe finalproduct. Whenyoustartout,youshouldaddonlyalineortwoofcodeatatime.Asyougainmoreexperience,youmightfindyourselfwritinganddebuggingbigger chunks.Eitherway,incrementaldevelopmentcansaveyoualotofdebuggingtime. Thekeyaspectsoftheprocessare: Startwithaworkingprogramandmakesmallincrementalchanges.Atanypoint,ifthereisanerror,youshouldhaveagoodideawhereitis. Usetemporaryvariablestoholdintermediatevaluessoyoucandisplayandcheckthem. Oncetheprogramisworking,youmightwanttoremovesomeofthescaffoldingorconsolidatemultiplestatementsintocompoundexpressions,but onlyifitdoesnotmaketheprogramdifficulttoread.

Exercise2
Useincrementaldevelopmenttowriteafunctioncalled'h y p o t e n u s e 'thatreturnsthelengthofthehypotenuseofarighttrianglegiventhelengthsofthetwolegs asarguments.Recordeachstageofthedevelopmentprocessasyougo.

Composition
Asyoushouldexpectbynow,youcancallonefunctionfromwithinanother.Thisabilityiscalled composition. Asanexample,wellwriteafunctionthattakestwopoints,thecenterofthecircleandapointontheperimeter,andcomputestheareaofthecircle. Assumethatthecenterpointisstoredinthevariables x c and y c ,andtheperimeterpointisin x p and y p .Thefirststepistofindtheradiusofthecircle,whichis en.wikibooks.org/wiki/Think_Python/Print_version 62/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Assumethatthecenterpointisstoredinthevariables x c and y c ,andtheperimeterpointisin x p and y p .Thefirststepistofindtheradiusofthecircle,whichis thedistancebetweenthetwopoints.Wejustwroteafunction, d i s t a n c e ,thatdoesthat:


r a d i u s=d i s t a n c e ( x c ,y c ,x p ,y p )

Thenextstepistofindtheareaofacirclewiththatradiuswejustwrotethat,too:
r e s u l t=a r e a ( r a d i u s )

Encapsulatingthesestepsinafunction,weget:
d e fc i r c l e _ a r e a ( x c ,y c ,x p ,y p ) : r a d i u s=d i s t a n c e ( x c ,y c ,x p ,y p ) r e s u l t=a r e a ( r a d i u s ) r e t u r nr e s u l t

Thetemporaryvariables r a d i u s and r e s u l t areusefulfordevelopmentanddebugging,butoncetheprogramisworking,wecanmakeitmoreconciseby composingthefunctioncalls:


d e fc i r c l e _ a r e a ( x c ,y c ,x p ,y p ) : r e t u r na r e a ( d i s t a n c e ( x c ,y c ,x p ,y p ) )

Booleanfunctions
Functionscanreturnbooleans,whichisoftenconvenientforhidingcomplicatedtestsinsidefunctions.Forexample:
d e fi s _ d i v i s i b l e ( x ,y ) : i fx%y= =0 : r e t u r nT r u e e l s e : r e t u r nF a l s e

Itiscommontogivebooleanfunctionsnamesthatsoundlikeyes/noquestions i s _ d i v i s i b l e returnseither T r u e or F a l s e toindicatewhether x isdivisibleby y . Hereisanexample:


> > > i s _ d i v i s i b l e ( 6 ,4 ) F a l s e > > > i s _ d i v i s i b l e ( 6 ,3 ) T r u e
en.wikibooks.org/wiki/Think_Python/Print_version 63/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theresultofthe = = operatorisaboolean,sowecanwritethefunctionmoreconciselybyreturningitdirectly:
d e fi s _ d i v i s i b l e ( x ,y ) : r e t u r nx%y= =0

Booleanfunctionsareoftenusedinconditionalstatements:
i fi s _ d i v i s i b l e ( x ,y ) : p r i n t' xi sd i v i s i b l eb yy '

Itmightbetemptingtowritesomethinglike:
i fi s _ d i v i s i b l e ( x ,y )= =T r u e : p r i n t' xi sd i v i s i b l eb yy '

Buttheextracomparisonisunnecessary. Exercise3 Writeafunction i s _ b e t w e e n ( x ,y ,z ) thatreturns'T r u e 'if'x y z'or'F a l s e 'otherwise.

Morerecursion
WehaveonlycoveredasmallsubsetofPython,butyoumightbeinterestedtoknowthatthissubsetisa completeprogramminglanguage,whichmeansthat anythingthatcanbecomputedcanbeexpressedinthislanguage.Anyprogrameverwrittencouldberewrittenusingonlythelanguagefeaturesyouhave learnedsofar(actually,youwouldneedafewcommandstocontroldeviceslikethekeyboard,mouse,disks,etc.,butthatsall). ProvingthatclaimisanontrivialexercisefirstaccomplishedbyAlanTuring,oneofthefirstcomputerscientists(somewouldarguethathewasa mathematician,butalotofearlycomputerscientistsstartedasmathematicians).Accordingly,itisknownastheTuringThesis.Foramorecomplete(and accurate)discussionoftheTuringThesis,IrecommendMichaelSipsersbook IntroductiontotheTheoryofComputation. Togiveyouanideaofwhatyoucandowiththetoolsyouhavelearnedsofar,wellevaluateafewrecursivelydefinedmathematicalfunctions.Arecursive definitionissimilartoacirculardefinition,inthesensethatthedefinitioncontainsareferencetothethingbeingdefined.Atrulycirculardefinitionisnotvery useful: frabjuous: Anadjectiveusedtodescribesomethingthatisfrabjuous. Ifyousawthatdefinitioninthedictionary,youmightbeannoyed.Ontheotherhand,ifyoulookedupthedefinitionofthefactorialfunction,denotedwiththe symbol!,youmightgetsomethinglikethis:
en.wikibooks.org/wiki/Think_Python/Print_version 64/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

0!=1 n!= n(n1)! Thisdefinitionsaysthatthefactorialof0is1,andthefactorialofanyothervalue, n,is nmultipliedbythefactorialof n1. So3!is3times2!,whichis2times1!,whichis1times0!.Puttingitalltogether,3!equals3times2times1times1,whichis6. Ifyoucanwritearecursivedefinitionofsomething,youcanusuallywriteaPythonprogramtoevaluateit.Thefirststepistodecidewhattheparameters shouldbe.Inthiscaseitshouldbeclearthat f a c t o r i a l takesaninteger:
d e ff a c t o r i a l ( n ) :

Iftheargumenthappenstobe0,allwehavetodoisreturn1:
d e ff a c t o r i a l ( n ) : i fn= =0 : r e t u r n1

Otherwise,andthisistheinterestingpart,wehavetomakearecursivecalltofindthefactorialof n1andthenmultiplyitby n:
d e ff a c t o r i a l ( n ) : i fn= =0 : r e t u r n1 e l s e : r e c u r s e=f a c t o r i a l ( n 1 ) r e s u l t=n*r e c u r s e r e t u r nr e s u l t

Theflowofexecutionforthisprogramissimilartotheflowof c o u n t d o w n inSection5.8.Ifwecall f a c t o r i a l withthevalue3: Since3isnot0,wetakethesecondbranchandcalculatethefactorialof n 1 ... Since2isnot0,wetakethesecondbranchandcalculatethefactorialof


n 1 ...

Since1isnot0,wetakethesecondbranchandcalculatethefactorial of n 1 ... Since0 is0,wetakethefirstbranchandreturn1withoutmakinganymorerecursivecalls.


en.wikibooks.org/wiki/Think_Python/Print_version 65/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thereturnvalue(1)ismultipliedby n,whichis1,andtheresultisreturned. Thereturnvalue(1)ismultipliedby n,whichis2,andtheresultisreturned. Thereturnvalue(2)ismultipliedby n,whichis3,andtheresult,6,becomesthereturnvalueofthefunctioncallthatstartedthewholeprocess. Hereiswhatthestackdiagramlookslikeforthissequenceoffunctioncalls:

<IMGSRC="book009.png">

Thereturnvaluesareshownbeingpassedbackupthestack.Ineachframe,thereturnvalueisthevalueof r e s u l t ,whichistheproductof n and r e c u r s e . Inthelastframe,thelocalvariables r e c u r s e and r e s u l t donotexist,becausethebranchthatcreatesthemdoesnotexecute.

Leapoffaith
Followingtheflowofexecutionisonewaytoreadprograms,butitcanquicklybecomelabyrinthine.AnalternativeiswhatIcalltheleapoffaith.Whenyou cometoafunctioncall,insteadoffollowingtheflowofexecution,you assumethatthefunctionworkscorrectlyandreturnstherightresult. Infact,youarealreadypracticingthisleapoffaithwhenyouusebuiltinfunctions.Whenyoucall m a t h . c o s or m a t h . e x p ,youdontexaminethebodiesofthose functions.Youjustassumethattheyworkbecausethepeoplewhowrotethebuiltinfunctionsweregoodprogrammers. Thesameistruewhenyoucalloneofyourownfunctions.Forexample,inSection6.4,wewroteafunctioncalled i s _ d i v i s i b l e thatdetermineswhetherone numberisdivisiblebyanother.Oncewehaveconvincedourselvesthatthisfunctioniscorrectbyexaminingthecodeandtestingwecanusethefunction withoutlookingatthebodyagain. Thesameistrueofrecursiveprograms.Whenyougettotherecursivecall,insteadoffollowingtheflowofexecution,youshouldassumethattherecursive callworks(yieldsthecorrectresult)andthenaskyourself,AssumingthatIcanfindthefactorialof n1,canIcomputethefactorialof n?Inthiscase,itis clearthatyoucan,bymultiplyingby n. Ofcourse,it'sabitstrangetoassumethatthefunctionworkscorrectlywhenyouhaven'tfinishedwritingit,butthat'swhyit'scalledaleapoffaith!

Onemoreexample
After f a c t o r i a l ,themostcommonexampleofarecursivelydefinedmathematicalfunctionis f i b o n a c c i ,whichhasthefollowingdefinition[3]: fibonacci(0)=0
en.wikibooks.org/wiki/Think_Python/Print_version 66/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

fibonacci(1)=1 fibonacci(n)= fibonacci(n1)+ fibonacci(n2) TranslatedintoPython,itlookslikethis:


d e ff i b o n a c c i( n ) : i fn= =0 : r e t u r n0 e l i f n= =1 : r e t u r n1 e l s e : r e t u r nf i b o n a c c i ( n 1 )+f i b o n a c c i ( n 2 )

Ifyoutrytofollowtheflowofexecutionhere,evenforfairlysmallvaluesof n,yourheadexplodes.Butaccordingtotheleapoffaith,ifyouassumethatthe tworecursivecallsworkcorrectly,thenitisclearthatyougettherightresultbyaddingthemtogether.

Checkingtypes
Whathappensifwecall f a c t o r i a l andgiveit1.5asanargument?
> > >f a c t o r i a l ( 1 . 5 ) R u n t i m e E r r o r :M a x i m u mr e c u r s i o nd e p t he x c e e d e d

Itlookslikeaninfiniterecursion.Buthowcanthatbe?Thereisabasecasewhen n= =0 .Butif n isnotaninteger,wecan missthebasecaseandrecurse forever. Inthefirstrecursivecall,thevalueof n is0.5.Inthenext,itis0.5.Fromthere,itgetssmaller(morenegative),butitwillneverbe0. Wehavetwochoices.Wecantrytogeneralizethe f a c t o r i a l functiontoworkwithfloatingpointnumbers,orwecanmake f a c t o r i a l checkthetypeofits argument.Thefirstoptioniscalledthegammafunction[4]anditsalittlebeyondthescopeofthisbook.Sowellgoforthesecond. Wecanusethebuiltinfunction i s i n s t a n c e toverifythetypeoftheargument.Whilewereatit,wecanalsomakesuretheargumentispositive:

d e ff a c t o r i a l( n ) : i fn o ti s i n s t a n c e ( n ,i n t ) : p r i n t' F a c t o r i a li so n l yd e f i n e df o ri n t e g e r s . ' r e t u r nN o n e e l i fn<0 : p r i n t' F a c t o r i a li so n l yd e f i n e df o rp o s i t i v ei n t e g e r s . ' r e t u r nN o n e


en.wikibooks.org/wiki/Think_Python/Print_version 67/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

e l i fn= =0 : r e t u r n1 e l s e : r e t u r nn*f a c t o r i a l ( n 1 )

Thefirstbasecasehandlesnonintegersthesecondcatchesnegativeintegers.Inbothcases,theprogramprintsanerrormessageandreturns N o n e toindicate thatsomethingwentwrong:


> > >f a c t o r i a l ( ' f r e d ' ) F a c t o r i a li so n l yd e f i n e df o ri n t e g e r s . N o n e > > >f a c t o r i a l ( 2 ) F a c t o r i a li so n l yd e f i n e df o rp o s i t i v ei n t e g e r s . N o n e

Ifwegetpastbothchecks,thenweknowthat nisapositiveinteger,andwecanprovethattherecursionterminates. Thisprogramdemonstratesapatternsometimescalleda guardian.Thefirsttwoconditionalsactasguardians,protectingthecodethatfollowsfromvalues thatmightcauseanerror.Theguardiansmakeitpossibletoprovethecorrectnessofthecode.

Debugging
Breakingalargeprogramintosmallerfunctionscreatesnaturalcheckpointsfordebugging.Ifafunctionisnotworking,therearethreepossibilitiestoconsider: Thereissomethingwrongwiththeargumentsthefunction isgettingapreconditionisviolated. Thereissomethingwrongwiththefunctionapostcondition isviolated. Thereissomethingwrongwiththereturnvalueorthe wayitisbeingused. Toruleoutthefirstpossibility,youcanadda p r i n t statementatthebeginningofthefunctionanddisplaythevaluesoftheparameters(andmaybetheir types).Oryoucanwritecodethatchecksthepreconditionsexplicitly. Iftheparameterslookgood,adda p r i n t statementbeforeeach r e t u r n statementthatdisplaysthereturnvalue.Ifpossible,checktheresultbyhand.Consider callingthefunctionwithvaluesthatmakeiteasytochecktheresult(asinSection6.2). Ifthefunctionseemstobeworking,lookatthefunctioncalltomakesurethereturnvalueisbeingusedcorrectly(orusedatall!). Addingprintstatementsatthebeginningandendofafunctioncanhelpmaketheflowofexecutionmorevisible.Forexample,hereisaversionof f a c t o r i a l68/282 en.wikibooks.org/wiki/Think_Python/Print_version

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Addingprintstatementsatthebeginningandendofafunctioncanhelpmaketheflowofexecutionmorevisible.Forexample,hereisaversionof f a c t o r i a l withprintstatements:
d e ff a c t o r i a l ( n ) : s p a c e=''*( 4*n ) p r i n ts p a c e ,' f a c t o r i a l ' ,n i fn= =0 : p r i n ts p a c e ,' r e t u r n i n g1 ' r e t u r n1 e l s e : r e c u r s e=f a c t o r i a l ( n 1 ) r e s u l t=n*r e c u r s e p r i n ts p a c e ,' r e t u r n i n g ' ,r e s u l t r e t u r nr e s u l t
s p a c e isastringofspacecharactersthatcontrolstheindentationoftheoutput.Hereistheresultof f a c t o r i a l ( 5 ) :

f a c t o r i a l5 f a c t o r i a l4 f a c t o r i a l3 f a c t o r i a l2 f a c t o r i a l1 f a c t o r i a l0 r e t u r n i n g1 r e t u r n i n g1 r e t u r n i n g2 r e t u r n i n g6 r e t u r n i n g2 4 r e t u r n i n g1 2 0

Ifyouareconfusedabouttheflowofexecution,thiskindofoutputcanbehelpful.Ittakessometimetodevelopeffectivescaffolding,butalittlebitof scaffoldingcansavealotofdebugging.

Glossary
temporaryvariable: Avariableusedtostoreanintermediatevalueinacomplexcalculation. deadcode: Partofaprogramthatcanneverbeexecuted,oftenbecauseitappearsaftera r e t u r n statement. 'N o n e ': Aspecialvaluereturnedbyfunctionsthathavenoreturnstatementorareturnstatementwithoutanargument. incrementaldevelopment: Aprogramdevelopmentplanintendedtoavoiddebuggingbyaddingandtestingonlyasmallamountofcodeatatime.
en.wikibooks.org/wiki/Think_Python/Print_version 69/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

scaffolding: Codethatisusedduringprogramdevelopmentbutisnotpartofthefinalversion. guardian: Aprogrammingpatternthatusesaconditionalstatementtocheckforandhandlecircumstancesthatmightcauseanerror.

Exercises
Exercise4
Drawastackdiagramforthefollowingprogram.Whatdoestheprogramprint?
d e fb ( z ) : p r o d=a ( z ,z ) p r i n tz ,p r o d r e t u r np r o d d e fa ( x ,y ) : x=x+1 r e t u r nx*y d e fc ( x ,y ,z ) : s u m=x+y+z p o w=b ( s u m ) * * 2 r e t u r np o w x=1 y=x+1 p r i n tc ( x ,y + 3 ,x + y )

Exercise5
TheAckermannfunction,'A(m,n)'isdefined[5]:

1 See w i k i p e d i a . o r g / w i k i / C o l l a t z _ c o n j e c t u r e . 2 See w i k i p e d i a . o r g / w i k i / P i .

Strings
en.wikibooks.org/wiki/Think_Python/Print_version 70/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Astringisasequence
Astringisa sequenceofcharacters.Youcanaccessthecharactersoneatatimewiththebracketoperator:
> > >f r u i t=' b a n a n a ' > > >l e t t e r=f r u i t [ 1 ]

Thesecondstatementselectscharacternumber1from f r u i t andassignsitto l e t t e r . Theexpressioninbracketsiscalledan index.Theindexindicateswhichcharacterinthesequenceyouwant(hencethename). Butyoumightnotgetwhatyouexpect:


> > >p r i n tl e t t e r a

Formostpeople,thefirstletterof ' b a n a n a ' is b ,not a .Butforcomputerscientists,theindexisanoffsetfromthebeginningofthestring,andtheoffsetofthe firstletteriszero.


> > >l e t t e r=f r u i t [ 0 ] > > >p r i n tl e t t e r b

So b isthe0thletter(zeroeth)of ' b a n a n a ' , a isthe1thletter(oneeth),and n isthe2th(twoeth)letter. Youcanuseanyexpression,includingvariablesandoperators,asanindex,butthevalueoftheindexhastobeaninteger.Otherwiseyouget:


> > >l e t t e r=f r u i t [ 1 . 5 ] T y p e E r r o r :s t r i n gi n d i c e sm u s tb ei n t e g e r s

l e n
l e n isabuiltinfunctionthatreturnsthenumberofcharactersinastring:

> > >f r u i t=' b a n a n a ' > > >l e n ( f r u i t ) 6

Togetthelastletterofastring,youmightbetemptedtotrysomethinglikethis:
en.wikibooks.org/wiki/Think_Python/Print_version 71/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >l e n g t h=l e n ( f r u i t ) > > >l a s t=f r u i t [ l e n g t h ] I n d e x E r r o r :s t r i n gi n d e xo u to fr a n g e

Thereasonforthe I n d e x E r r o r isthatthereisnoletterin b a n a n a withtheindex6.Sincewestartedcountingatzero,thesixlettersarenumbered0to5.Toget thelastcharacter,youhavetosubtract1from l e n g t h :


> > >l a s t=f r u i t [ l e n g t h 1 ] > > >p r i n tl a s t a

Alternatively,youcanusenegativeindices,whichcountbackwardfromtheendofthestring.Theexpression f r u i t [ 1 ] yieldsthelastletter, f r u i t [ 2 ] yieldsthe secondtolast,andsoon.

Traversalwithaf o r loop
Alotofcomputationsinvolveprocessingastringonecharacteratatime.Oftentheystartatthebeginning,selecteachcharacterinturn,dosomethingtoit, andcontinueuntiltheend.Thispatternofprocessingiscalleda traversal .Onewaytowriteatraversaliswitha w h i l e loop:
i n d e x=0 w h i l ei n d e x<l e n ( f r u i t ) : l e t t e r=f r u i t [ i n d e x ] p r i n tl e t t e r i n d e x=i n d e x+1

Thislooptraversesthestringanddisplayseachletteronalinebyitself.Theloopconditionis i n d e x<l e n ( f r u i t ) ,sowhen i n d e x isequaltothelengthofthe string,theconditionisfalse,andthebodyoftheloopisnotexecuted.Thelastcharacteraccessedistheonewiththeindex l e n ( f r u i t ) 1 ,whichisthelast characterinthestring. Exercise1 Writeafunctionthattakesastringasanargumentanddisplaysthelettersbackward,oneperline. Anotherwaytowriteatraversaliswitha f o r loop:
f o rc h a ri nf r u i t : p r i n tc h a r

Eachtimethroughtheloop,thenextcharacterinthestringisassignedtothevariable c h a r .Theloopcontinuesuntilnocharactersareleft.
en.wikibooks.org/wiki/Think_Python/Print_version 72/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thefollowingexampleshowshowtouseconcatenation(stringaddition)anda f o r looptogenerateanabecedarianseries(thatis,inalphabeticalorder).In RobertMcCloskeysbookMakeWayforDucklings,thenamesoftheducklingsareJack,Kack,Lack,Mack,Nack,Ouack,Pack,andQuack.Thisloopoutputs thesenamesinorder:


p r e f i x e s=' J K L M N O P Q ' s u f f i x=' a c k ' f o rl e t t e ri np r e f i x e s : p r i n tl e t t e r+s u f f i x

Theoutputis:
J a c k K a c k L a c k M a c k N a c k O a c k P a c k Q a c k

Ofcourse,thatsnotquiterightbecauseOuackandQuackaremisspelled.

Exercise2
Modifytheprogramtofixthiserror.

Stringslices
Asegmentofastringiscalleda slice.Selectingasliceissimilartoselectingacharacter:
> > >s=' M o n t yP y t h o n ' > > >p r i n ts [ 0 : 5 ] M o n t y > > >p r i n ts [ 6 : 1 3 ] P y t h o n

Theoperator [ n : m ] returnsthepartofthestringfromthenethcharactertothemethcharacter,includingthefirstbutexcludingthelast.Thisbehavioris counterintuitive,butitmighthelptoimaginetheindicespointing betweenthecharacters,asinthefollowingdiagram: <IMGSRC="book011.png"> Ifyouomitthefirstindex(beforethecolon),theslicestartsatthebeginningofthestring.Ifyouomitthesecondindex,theslicegoestotheendofthestring:


en.wikibooks.org/wiki/Think_Python/Print_version 73/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >f r u i t=' b a n a n a ' > > >f r u i t [ : 3 ] ' b a n ' > > >f r u i t [ 3 : ] ' a n a '

Ifthefirstindexisgreaterthanorequaltothesecondtheresultisan emptystring,representedbytwoquotationmarks:
> > >f r u i t=' b a n a n a ' > > >f r u i t [ 3 : 3 ] ' '

Anemptystringcontainsnocharactersandhaslength0,butotherthanthat,itisthesameasanyotherstring.

Exercise3
Giventhat'f r u i t 'isastring,whatdoes'f r u i t [ : ] 'mean?

Stringsareimmutable
Itistemptingtousethe [ ] operatorontheleftsideofanassignment,withtheintentionofchangingacharacterinastring.Forexample:
> > >g r e e t i n g=' H e l l o ,w o r l d ! ' > > >g r e e t i n g [ 0 ]=' J ' T y p e E r r o r :o b j e c td o e sn o ts u p p o r ti t e ma s s i g n m e n t

Theobjectinthiscaseisthestringandtheitemisthecharacteryoutriedtoassign.Fornow,an objectisthesamethingasavalue,butwewillrefinethat definitionlater.An itemisoneofthevaluesinasequence. Thereasonfortheerroristhatstringsare immutable,whichmeansyoucantchangeanexistingstring.Thebestyoucandoiscreateanewstringthatisa variationontheoriginal:


> > >g r e e t i n g=' H e l l o ,w o r l d ! ' > > >n e w _ g r e e t i n g=' J '+g r e e t i n g [ 1 : ] > > >p r i n tn e w _ g r e e t i n g J e l l o ,w o r l d !

Thisexampleconcatenatesanewfirstletterontoasliceof g r e e t i n g .Ithasnoeffectontheoriginalstring.

Searching
en.wikibooks.org/wiki/Think_Python/Print_version 74/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Whatdoesthefollowingfunctiondo?
d e ff i n d ( w o r d ,l e t t e r ) : i n d e x=0 w h i l ei n d e x<l e n ( w o r d ) : i fw o r d [ i n d e x ]= =l e t t e r : r e t u r ni n d e x i n d e x=i n d e x+1 r e t u r n1

Inasense, f i n d istheoppositeofthe [ ] operator.Insteadoftakinganindexandextractingthecorrespondingcharacter,ittakesacharacterandfindsthe indexwherethatcharacterappears.Ifthecharacterisnotfound,thefunctionreturns 1 . Thisisthefirstexamplewehaveseenofa r e t u r n statementinsidealoop.If w o r d [ i n d e x ]= =l e t t e r ,thefunctionbreaksoutoftheloopandreturnsimmediately. Ifthecharacterdoesntappearinthestring,theprogramexitstheloopnormallyandreturns 1 . Thispatternofcomputationtraversingasequenceandreturningwhenwefindwhatwearelookingforisacalleda search.

Exercise4
Modify'f i n d 'sothatithasathirdparameter,theindexin'w o r d 'whereitshouldstartlooking.

Loopingandcounting
Thefollowingprogramcountsthenumberoftimestheletter a appearsinastring:
w o r d=' b a n a n a ' c o u n t=0 f o rl e t t e ri nw o r d : i fl e t t e r= =' a ' : c o u n t=c o u n t+1 p r i n tc o u n t

Thisprogramdemonstratesanotherpatternofcomputationcalleda counter.Thevariable c o u n t isinitializedto0andthenincrementedeachtimean a is found.Whentheloopexits, c o u n t containstheresultthetotalnumberof a s. Exercise5 Encapsulatethiscodeinafunctionnamed'c o u n t ',andgeneralizeitsothatitacceptsthestringandtheletterasarguments. Exercise6

en.wikibooks.org/wiki/Think_Python/Print_version

75/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Rewritethisfunctionsothatinsteadoftraversingthestring,itusesthethreeparameterversionof'f i n d 'fromtheprevioussection.

s t r i n g methods
A methodissimilartoafunctionittakesargumentsandreturnsavaluebutthesyntaxisdifferent.Forexample,themethod u p p e r takesastringand returnsanewstringwithalluppercaseletters: Insteadofthefunctionsyntax u p p e r ( w o r d ) ,itusesthemethodsyntax w o r d . u p p e r ( ) .
> > >w o r d=' b a n a n a ' > > >n e w _ w o r d=w o r d . u p p e r ( ) > > >p r i n tn e w _ w o r d B A N A N A

Thisformofdotnotationspecifiesthenameofthemethod, u p p e r ,andthenameofthestringtoapplythemethodto, w o r d .Theemptyparenthesesindicate thatthismethodtakesnoargument. Amethodcalliscalledan invocationinthiscase,wewouldsaythatweareinvoking u p p e r onthe w o r d . Asitturnsout,thereisastringmethodnamed f i n d thatisremarkablysimilartothefunctionwewrote:


> > >w o r d=' b a n a n a ' > > >i n d e x=w o r d . f i n d ( ' a ' ) > > >p r i n ti n d e x 1

Inthisexample,weinvoke f i n d on w o r d andpasstheletterwearelookingforasaparameter. Actually,the f i n d methodismoregeneralthanourfunctionitcanfindsubstrings,notjustcharacters:


> > >w o r d . f i n d ( ' n a ' ) 2

Itcantakeasasecondargumenttheindexwhereitshouldstart:

> > >w o r d . f i n d ( ' n a ' ,3 )


en.wikibooks.org/wiki/Think_Python/Print_version 76/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Andasathirdargumenttheindexwhereitshouldstop:
> > >n a m e=' b o b ' > > >n a m e . f i n d ( ' b ' ,1 ,2 ) 1

Thissearchfailsbecause b doesnotappearintheindexrangefrom 1 to 2 (notincluding 2 ). Exercise7 ' Thereisastringmethodcalled'c o u n t 'thatissimilartothefunctioninthepreviousexercise.Readthedocumentationofthismethodandwriteaninvocation thatcountsthenumberof'a 'sin b a n a n a .

Thei n operator
Theword i n isabooleanoperatorthattakestwostringsandreturns T r u e ifthefirstappearsasasubstringinthesecond:
> > >' a 'i n' b a n a n a ' T r u e > > >' s e e d 'i n' b a n a n a ' F a l s e

Forexample,thefollowingfunctionprintsallthelettersfrom w o r d 1 thatalsoappearin w o r d 2 :
d e fi n _ b o t h ( w o r d 1 ,w o r d 2 ) : f o rl e t t e ri nw o r d 1 : i fl e t t e ri nw o r d 2 : p r i n tl e t t e r

Withwellchosenvariablenames,PythonsometimesreadslikeEnglish.Youcouldreadthisloop,for(each)letterin(thefirst)word,if(the)letter(appears)in (thesecond)word,print(the)letter. Hereswhatyougetifyoucompareapplesandoranges:


> > >i n _ b o t h ( ' a p p l e s ' ,' o r a n g e s ' ) a e
en.wikibooks.org/wiki/Think_Python/Print_version 77/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Stringcomparison
Thecomparisonoperatorsworkonstrings.Toseeiftwostringsareequal:
i fw o r d= =' b a n a n a ' : p r i n t ' A l lr i g h t ,b a n a n a s . '

Othercomparisonoperationsareusefulforputtingwordsinalphabeticalorder:
i fw o r d<' b a n a n a ' : p r i n t' Y o u rw o r d , '+w o r d+' ,c o m e sb e f o r eb a n a n a . ' e l i fw o r d>' b a n a n a ' : p r i n t' Y o u rw o r d , '+w o r d+' ,c o m e sa f t e rb a n a n a . ' e l s e : p r i n t' A l lr i g h t ,b a n a n a s . '

Pythondoesnothandleuppercaseandlowercaselettersthesamewaythatpeopledo.Alltheuppercaseletterscomebeforeallthelowercaseletters,so:
Y o u rw o r d ,P i n e a p p l e ,c o m e sb e f o r eb a n a n a .

Acommonwaytoaddressthisproblemistoconvertstringstoastandardformat,suchasalllowercase,beforeperformingthecomparison.Keepthatinmind incaseyouhavetodefendyourselfagainstamanarmedwithaPineapple.

Debugging
Whenyouuseindicestotraversethevaluesinasequence,itistrickytogetthebeginningandendofthetraversalright.Hereisafunctionthatissupposedto comparetwowordsandreturn T r u e ifoneofthewordsisthereverseoftheother,butitcontainstwoerrors:
d e fi s _ r e v e r s e ( w o r d 1 ,w o r d 2 ) : i fl e n ( w o r d 1 )! =l e n ( w o r d 2 ) : r e t u r nF a l s e i=0 j=l e n ( w o r d 2 ) w h i l ej>0 : i fw o r d 1 [ i ]! =w o r d 2 [ j ] : r e t u r nF a l s e i=i + 1 j=j 1
en.wikibooks.org/wiki/Think_Python/Print_version 78/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r nT r u e

Thefirst i f statementcheckswhetherthewordsarethesamelength.Ifnot,wecanreturn F a l s e immediatelyandthen,fortherestofthefunction,wecan assumethatthewordsarethesamelength.ThisisanexampleoftheguardianpatterninSection6.8.


i and j areindices: i traverses w o r d 1 forwardwhile j traverses w o r d 2 backward.Ifwefindtwolettersthatdontmatch,wecanreturn F a l s e immediately.Ifweget

throughthewholeloopandallthelettersmatch,wereturn T r u e . Ifwetestthisfunctionwiththewordspotsandstop,weexpectthereturnvalue T r u e ,butwegetanIndexError:

> > >i s _ r e v e r s e ( ' p o t s ' ,' s t o p ' ) . . . F i l e" r e v e r s e . p y " ,l i n e1 5 ,i ni s _ r e v e r s e i fw o r d 1 [ i ]! =w o r d 2 [ j ] : I n d e x E r r o r :s t r i n gi n d e xo u to fr a n g e

Fordebuggingthiskindoferror,myfirstmoveistoprintthevaluesoftheindicesimmediatelybeforethelinewheretheerrorappears.
w h i l ej>0 : p r i n ti ,j

#p r i n th e r e

i fw o r d 1 [ i ]! =w o r d 2 [ j ] : r e t u r nF a l s e i=i + 1 j=j 1

NowwhenIruntheprogramagain,Igetmoreinformation:
> > >i s _ r e v e r s e ( ' p o t s ' ,' s t o p ' ) 04 . . . I n d e x E r r o r :s t r i n gi n d e xo u to fr a n g e

Thefirsttimethroughtheloop,thevalueof j is4,whichisoutofrangeforthestring ' p o t s ' .Theindexofthelastcharacteris3,sotheinitialvaluefor j should be l e n ( w o r d 2 ) 1 .

IfIfixthaterrorandruntheprogramagain,Iget:
en.wikibooks.org/wiki/Think_Python/Print_version 79/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >i s _ r e v e r s e ( ' p o t s ' ,' s t o p ' ) 03 12 21 T r u e

Thistimewegettherightanswer,butitlookslikethelooponlyranthreetimes,whichissuspicious.Togetabetterideaofwhatishappening,itisusefulto drawastatediagram.Duringthefirstiteration,theframefor i s _ r e v e r s e lookslikethis:

<IMGSRC="book012.png"> Itookalittlelicensebyarrangingthevariablesintheframeandaddingdottedlinestoshowthatthevaluesof i and j indicatecharactersin w o r d 1 and w o r d 2 . Exercise8 'Startingwiththisdiagram,executetheprogramonpaper,changingthevaluesof'i 'and'j 'duringeachiteration.Findandfixtheseconderrorinthisfunction.

Glossary
object: Somethingavariablecanreferto.Fornow,youcanuseobjectandvalueinterchangeably. sequence: Anorderedsetthatis,asetofvalueswhereeachvalueisidentifiedbyanintegerindex. item: Oneofthevaluesinasequence. index: Anintegervalueusedtoselectaniteminasequence,suchasacharacterinastring. slice: Apartofastringspecifiedbyarangeofindices. emptystring: Astringwithnocharactersandlength0,representedbytwoquotationmarks. immutable: Thepropertyofasequencewhoseitemscannotbeassigned. traverse: Toiteratethroughtheitemsinasequence,performingasimilaroperationoneach. search: Apatternoftraversalthatstopswhenitfindswhatitislookingfor.
en.wikibooks.org/wiki/Think_Python/Print_version 80/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

counter: Avariableusedtocountsomething,usuallyinitializedtozeroandthenincremented. method: Afunctionthatisassociatedwithanobjectandcalledusingdotnotation. invocation: Astatementthatcallsamethod.

Exercises
Exercise9
Astringslicecantakeathirdindexthatspecifiesthestepsizethatis,thenumberofspacesbetweensuccessivecharacters.Astepsizeof2meansevery othercharacter3meanseverythird,etc.
' ' > > >f r u i t=' b a n a n a ' > > >f r u i t [ 0 : 5 : 2 ] ' b n n ' ' '

Astepsizeof1goesthroughthewordbackwards,sotheslice [ : : 1 ] generatesareversedstring. Usethisidiomtowriteaonelineversionof i s _ p a l i n d r o m e fromExercise'6.6'.

Exercise10
Readthedocumentationofthestringmethodsat'd o c s . p y t h o n . o r g / l i b / s t r i n g m e t h o d s . h t m l '.Youmightwanttoexperimentwithsomeofthemtomakesureyou understandhowtheywork.'s t r i p 'and'r e p l a c e 'areparticularlyuseful. Thedocumentationusesasyntaxthatmightbeconfusing. Forexample,in f i n d ( s u b [ ,s t a r t [ ,e n d ] ] ) ,thebracketsindicateoptionalarguments.So's u b 'is required,but's t a r t 'isoptional,andifyouinclude's t a r t ',then'e n d 'isoptional.

Exercise11
Thefollowingfunctionsareall intendedtocheckwhetherastringcontainsanylowercaseletters,butatleastsomeofthemare wrong.Foreachfunction,describewhatthefunctionactuallydoes.
' ' d e fa n y _ l o w e r c a s e 1 ( s ) : f o rci ns : i fc . i s l o w e r ( ) : r e t u r nT r u e
en.wikibooks.org/wiki/Think_Python/Print_version 81/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

e l s e : r e t u r nF a l s e d e fa n y _ l o w e r c a s e 2 ( s ) : f o rci ns : i f' c ' . i s l o w e r ( ) : r e t u r n' T r u e ' e l s e : r e t u r n' F a l s e ' d e fa n y _ l o w e r c a s e 3 ( s ) : f o rci ns : f l a g=c . i s l o w e r ( ) r e t u r nf l a g d e fa n y _ l o w e r c a s e 4 ( s ) : f l a g=F a l s e f o rci ns : f l a g=f l a go rc . i s l o w e r ( ) r e t u r nf l a g d e fa n y _ l o w e r c a s e 5 ( s ) : f o rci ns : i fn o tc . i s l o w e r ( ) : r e t u r nF a l s e r e t u r nT r u e ' '

Exercise12
ROT13isaweakformofencryptionthatinvolvesrotatingeachletterinawordby13places[7].Torotatealettermeanstoshiftitthroughthealphabet, wrappingaroundtothebeginningifnecessary,soAshiftedby3isDandZshiftedby1isA. Writeafunctioncalled r o t a t e _ w o r d thattakesastringandanintegerasparameters,andthatreturnsanewstringthatcontainsthelettersfromtheoriginal stringrotatedbythegivenamount. Forexample,cheerrotatedby7isjollyandmelonrotatedby10iscubed. Youmightwanttousethebuiltinfunctions'o r d ',whichconvertsacharactertoanumericcode,and'c h r ',whichconvertsnumericcodestocharacters. PotentiallyoffensivejokesontheInternetaresometimesencodedinROT13.Ifyouarenoteasilyoffended,findanddecodesomeofthem.

Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.
en.wikibooks.org/wiki/Think_Python/Print_version 82/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Casestudy:wordplay
Readingwordlists
FortheexercisesinthischapterweneedalistofEnglishwords.TherearelotsofwordlistsavailableontheWeb,buttheonemostsuitableforourpurposeis oneofthewordlistscollectedandcontributedtothepublicdomainbyGradyWardaspartoftheMobylexiconproject [8].Itisalistof113,809official crosswordsthatis,wordsthatareconsideredvalidincrosswordpuzzlesandotherwordgames.IntheMobycollection,thefilenameis 1 1 3 8 0 9 o f . f i c Iincludea copyofthisfile,withthesimplername w o r d s . t x t ,alongwithSwampy. Thisfileisinplaintext,soyoucanopenitwithatexteditor,butyoucanalsoreaditfromPython.(Youmayneedtomovethefilefromtheswampyfolder intothemainpythonfolder)Thebuiltinfunction o p e n takesthenameofthefileasaparameterandreturnsa fileobjectyoucanusetoreadthefile.
> > >f i n=o p e n ( ' w o r d s . t x t ' ) > > >p r i n tf i n < o p e nf i l e' w o r d s . t x t ' ,m o d e' r 'a t0 x b 7 f 4 b 3 8 0 >
f i n isacommonnameforafileobjectusedforinput.Mode ' r ' indicatesthatthisfileisopenforreading(asopposedto ' w ' forwriting).

Thefileobjectprovidesseveralmethodsforreading,including r e a d l i n e ,whichreadscharactersfromthefileuntilitgetstoanewlineandreturnstheresultasa string:


> > >f i n . r e a d l i n e ( ) ' a a \ r \ n '

Thefirstwordinthisparticularlistisaa,whichisakindoflava.Thesequence \ r \ n representstwowhitespacecharacters,acarriagereturnandanewline, thatseparatethiswordfromthenext. Thefileobjectkeepstrackofwhereitisinthefile,soifyoucall r e a d l i n e again,yougetthenextword:


> > >f i n . r e a d l i n e ( ) ' a a h \ r \ n '

Thenextwordisaah,whichisaperfectlylegitimateword,sostoplookingatmelikethat.Or,ifitsthewhitespacethatsbotheringyou,wecangetridofit withthestringmethod s t r i p :
> > >l i n e=f i n . r e a d l i n e ( ) > > >w o r d=l i n e . s t r i p ( ) > > >p r i n tw o r d a a h e d

en.wikibooks.org/wiki/Think_Python/Print_version

83/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Youcanalsouseafileobjectaspartofa f o r loop.Thisprogramreads w o r d s . t x t andprintseachword,oneperline:


f i n=o p e n ( ' w o r d s . t x t ' ) f o rl i n ei nf i n : w o r d=l i n e . s t r i p ( ) p r i n tw o r d

Exercise1 Writeaprogramthatreads'w o r d s . t x t 'andprintsonlythewordswithmorethan20characters(notcountingwhitespace).

Exercises
Therearesolutionstotheseexercisesinthenextsection.Youshouldatleastattempteachonebeforeyoureadthesolutions. Exercise2 In1939ErnestVincentWrightpublisheda50,000wordnovelcalled Gadsbythatdoesnotcontainthelettere.Sinceeisthemostcommonletterin English,thatsnoteasytodo. Infact,itisdifficulttoconstructasolitarythoughtwithoutusingthatmostcommonsymbol.Itisslowgoingatfirst,butwith cautionandhoursoftrainingyoucangraduallygainfacility. Allright,Illstopnow. Writeafunctioncalled h a s _ n o _ e thatreturns'T r u e 'if thegivenworddoesnthavethelettereinit. Modifyyourprogramfromtheprevioussectiontoprintonlythewordsthathavenoeandcomputethepercentageofthewordsinthelisthavenoe. Exercise3 Writeafunctionnamed'a v o i d s 'thattakesawordandastringofforbiddenletters,andthatreturns'T r u e 'iftheworddoesntuseanyoftheforbiddenletters. Modifyyourprogramtoprompttheusertoenterastringofforbiddenlettersandthenprintthenumberofwordsthatdontcontainanyofthem.Canyoufinda combinationof5forbiddenlettersthatexcludesthesmallestnumberofwords? Exercise4 Writeafunctionnamed u s e s _ o n l y thattakesawordandastringofletters,andthatreturns'T r u e 'ifthewordcontainsonlylettersinthelist.Canyoumakea sentenceusingonlytheletters'a c e f h l o '?OtherthanHoealfalfa? Exercise5 Writeafunctionnamed u s e s _ a l l thattakesawordandastringofrequiredletters,andthatreturns'T r u e 'ifthewordusesalltherequiredlettersatleastonce. Howmanywordsaretherethatuseallthevowels'a e i o u '?Howabout'a e i o u y '? Exercise6
en.wikibooks.org/wiki/Think_Python/Print_version 84/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Writeafunctioncalled i s _ a b e c e d a r i a n thatreturns'T r u e 'ifthelettersinawordappearinalphabeticalorder(doublelettersareok).Howmanyabecedarianwords arethere?

Search
AlloftheexercisesintheprevioussectionhavesomethingincommontheycanbesolvedwiththesearchpatternwesawinSection8.6.Thesimplest exampleis:
d e fh a s _ n o _ e ( w o r d ) : f o rl e t t e ri nw o r d : i fl e t t e r= =' e ' : r e t u r nF a l s e r e t u r nT r u e

The f o r looptraversesthecharactersin w o r d .Ifwefindthelettere,wecanimmediatelyreturn F a l s e otherwisewehavetogotothenextletter.Ifweexitthe loopnormally,thatmeanswedidntfindane,sowereturn T r u e . Youcanwritethisfunctionmoreconciselyusingthe i n operator,butIstartedwiththisversionbecauseitdemonstratesthelogicofthesearchpattern.


a v o i d s isamoregeneralversionof h a s _ n o _ e butithasthesamestructure:

d e fa v o i d s ( w o r d ,f o r b i d d e n ) : f o rl e t t e ri nw o r d : i fl e t t e ri nf o r b i d d e n : r e t u r nF a l s e r e t u r nT r u e

Wecanreturn F a l s e assoonaswefindaforbiddenletterifwegettotheendoftheloop,wereturn T r u e .
u s e s _ o n l y issimilarexceptthatthesenseoftheconditionisreversed:

d e fu s e s _ o n l y ( w o r d ,a v a i l a b l e ) : f o rl e t t e ri nw o r d : i fl e t t e rn o ti na v a i l a b l e : r e t u r nF a l s e r e t u r nT r u e

Insteadofalistofforbiddenwords,wehavealistofavailablewords.Ifwefindaletterin w o r d thatisnotin a v a i l a b l e ,wecanreturn F a l s e .

en.wikibooks.org/wiki/Think_Python/Print_version

85/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

u s e s _ a l l issimilarexceptthatwereversetheroleofthewordandthestringofletters:

d e fu s e s _ a l l ( w o r d ,r e q u i r e d ) : f o rl e t t e ri nr e q u i r e d : i fl e t t e rn o ti nw o r d : r e t u r nF a l s e r e t u r nT r u e

Insteadoftraversingthelettersin w o r d ,thelooptraversestherequiredletters.Ifanyoftherequiredlettersdonotappearintheword,wecanreturn F a l s e . Ifyouwerereallythinkinglikeacomputerscientist,youwouldhaverecognizedthat u s e s _ a l l wasaninstanceofapreviouslysolvedproblem,andyouwould havewritten:


d e fu s e s _ a l l ( w o r d ,r e q u i r e d ) : r e t u r nu s e s _ o n l y ( r e q u i r e d ,w o r d )

Thisisanexampleofaprogramdevelopmentmethodcalled problemrecognition,whichmeansthatyourecognizetheproblemyouareworkingonasan instanceofapreviouslysolvedproblem,andapplyapreviouslydevelopedsolution.

Loopingwithindices
Iwrotethefunctionsintheprevioussectionwith f o r loopsbecauseIonlyneededthecharactersinthestringsIdidnthavetodoanythingwiththeindices. For i s _ a b e c e d a r i a n wehavetocompareadjacentletters,whichisalittletrickywitha f o r loop:
d e fi s _ a b e c e d a r i a n ( w o r d ) : p r e v i o u s=w o r d [ 0 ] f o rci nw o r d : i fc<p r e v i o u s : r e t u r nF a l s e p r e v i o u s=c r e t u r nT r u e

Analternativeistouserecursion:
d e fi s _ a b e c e d a r i a n ( w o r d ) : i fl e n ( w o r d )< =1 : r e t u r nT r u e i fw o r d [ 0 ]>w o r d [ 1 ] :
en.wikibooks.org/wiki/Think_Python/Print_version 86/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r nF a l s e r e t u r ni s _ a b e c e d a r i a n ( w o r d [ 1 : ] )

Anotheroptionistousea w h i l e loop:
d e fi s _ a b e c e d a r i a n ( w o r d ) : i=0 w h i l ei<l e n ( w o r d ) 1 : i fw o r d [ i + 1 ]<w o r d [ i ] : r e t u r nF a l s e i=i + 1 r e t u r nT r u e

Theloopstartsat i = 0 andendswhen i = l e n ( w o r d ) 1 .Eachtimethroughtheloop,itcomparestheithcharacter(whichyoucanthinkofasthecurrentcharacter)to thei+1thcharacter(whichyoucanthinkofasthenext). Ifthenextcharacterislessthan(alphabeticallybefore)thecurrentone,thenwehavediscoveredabreakintheabecedariantrend,andwereturn F a l s e . Ifwegettotheendoftheloopwithoutfindingafault,thenthewordpassesthetest.Toconvinceyourselfthattheloopendscorrectly,consideranexample like ' f l o s s y ' .Thelengthofthewordis6,sothelasttimethelooprunsiswhen i is4,whichistheindexofthesecondtolastcharacter.Onthelastiteration,it comparesthesecondtolastcharactertothelast,whichiswhatwewant. Hereisaversionof i s _ p a l i n d r o m e (seeExercise6.6)thatusestwoindicesonestartsatthebeginningandgoesuptheotherstartsattheendandgoesdown.
d e fi s _ p a l i n d r o m e ( w o r d ) : i=0 j=l e n ( w o r d ) 1 w h i l ei < j : i fw o r d [ i ]! =w o r d [ j ] : r e t u r nF a l s e i=i + 1 j=j 1 r e t u r nT r u e

Or,ifyounoticedthatthisisaninstanceofapreviouslysolvedproblem,youmighthavewritten:
d e fi s _ p a l i n d r o m e ( w o r d ) : r e t u r ni s _ r e v e r s e ( w o r d ,w o r d )

en.wikibooks.org/wiki/Think_Python/Print_version

87/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

AssumingyoudidExercise8.8.

Debugging
Testingprogramsishard.Thefunctionsinthischapterarerelativelyeasytotestbecauseyoucanchecktheresultsbyhand.Evenso,itissomewhere betweendifficultandimpossibletochooseasetofwordsthattestforallpossibleerrors. Taking h a s _ n o _ e asanexample,therearetwoobviouscasestocheck:wordsthathaveaneshouldreturn F a l s e wordsthatdontshouldreturn T r u e .Youshould havenotroublecomingupwithoneofeach. Withineachcase,therearesomelessobvioussubcases.Amongthewordsthathaveane,youshouldtestwordswithaneatthebeginning,theend,and somewhereinthemiddle.Youshouldtestlongwords,shortwords,andveryshortwords,liketheemptystring.Theemptystringisanexampleofa special case,whichisoneofthenonobviouscaseswhereerrorsoftenlurk. Inadditiontothetestcasesyougenerate,youcanalsotestyourprogramwithawordlistlike w o r d s . t x t .Byscanningtheoutput,youmightbeabletocatch errors,butbecareful:youmightcatchonekindoferror(wordsthatshouldnotbeincluded,butare)andnotanother(wordsthatshouldbeincluded,but arent). Ingeneral,testingcanhelpyoufindbugs,butitisnoteasytogenerateagoodsetoftestcases,andevenifyoudo,youcantbesureyourprogramiscorrect. Accordingtoalegendarycomputerscientist: Programtestingcanbeusedtoshowthepresenceofbugs,butnevertoshowtheirabsence!EdsgerW.Dijkstra

Glossary
fileobject: Avaluethatrepresentsanopenfile. problemrecognition: Awayofsolvingaproblembyexpressingitasaninstanceofapreviouslysolvedproblem. specialcase: Atestcasethatisatypicalornonobvious(andlesslikelytobehandledcorrectly).

Exercises
Exercise7
ThisquestionisbasedonaPuzzlerthatwasbroadcastontheradioprogram CarTalk[9]: Givemeawordwiththreeconsecutivedoubleletters.I'llgiveyoua

coupleofwordsthatalmostqualify,butdon't.Forexample,thewordcommittee,committee.Itwouldbegreatexceptfortheithatsneaks en.wikibooks.org/wiki/Think_Python/Print_version

88/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

coupleofwordsthatalmostqualify,butdon't.Forexample,thewordcommittee,committee.Itwouldbegreatexceptfortheithatsneaks inthere.OrMississippi:Mississippi.Ifyoucouldtakeoutthoseisitwouldwork.Butthereisawordthathasthreeconsecutivepairsof lettersandtothebestofmyknowledgethismaybetheonlyword.Ofcoursethereareprobably500morebutIcanonlythinkofone.Whatis theword? Writeaprogramtofindit.Youcanseemysolutionat 't h i n k p y t h o n . c o m / c o d e / c a r t a l k . p y '.

Exercise8
Heresanother CarTalkPuzzler[10]: IwasdrivingonthehighwaytheotherdayandIhappenedtonoticemyodometer.Likemostodometers,itshowssixdigits,inwholemilesonly. So,ifmycarhad300,000miles,forexample,Idsee300000. Now,whatIsawthatdaywasveryinteresting.Inoticedthatthelast4digits werepalindromicthatis,theyreadthesameforwardasbackward.Forexample,5445isapalindrome,somyodometercouldhaveread31 5445. Onemilelater,thelast5numberswerepalindromic.Forexample,it couldhaveread365456.Onemileafterthat,themiddle4outof6 numberswerepalindromic.Andyoureadyforthis?Onemilelater,all6werepalindromic! Thequestionis,whatwasontheodometerwhenIfirstlooked? WriteaPythonprogramthattestsallthesixdigitnumbersandprintsanynumbersthatsatisfytheserequirements.Youcanseemysolutionat 't h i n k p y t h o n . c o m / c o d e / c a r t a l k . p y '.

Exercise9
Heresanother CarTalkPuzzleryoucansolvewithasearch[11]: RecentlyIhadavisitwithmymomandwerealizedthatthetwodigitsthatmakeupmyagewhenreversedresultedinherage.Forexample,if shes73,Im37.Wewonderedhowoftenthishashappenedovertheyearsbutwegotsidetrackedwithothertopicsandwenevercameupwith ananswer. WhenIgothomeIfiguredoutthatthedigitsofourageshavebeenreversiblesixtimessofar.Ialsofiguredoutthatifwereluckyit wouldhappenagaininafewyears,andifwerereallyluckyitwouldhappenonemoretimeafterthat.Inotherwords,itwouldhavehappened8 timesoverall.Sothequestionis,howoldamInow? WriteaPythonprogramthatsearchesforsolutionstothisPuzzler. Hint:youmightfindthestringmethod'z f i l l 'useful. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / c a r t a l k . p y '.

Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.

Lists
en.wikibooks.org/wiki/Think_Python/Print_version 89/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Alistisasequence
Likeastring,a listisasequenceofvalues.Inastring,thevaluesarecharactersinalist,theycanbeanytype.Thevaluesinlistarecalled elementsor sometimes items. Thereareseveralwaystocreateanewlistthesimplestistoenclosetheelementsinsquarebrackets([ and ] ):
[ 1 0 ,2 0 ,3 0 ,4 0 ] [ ' c r u n c h yf r o g ' ,' r a mb l a d d e r ' ,' l a r kv o m i t ' ]

Thefirstexampleisalistoffourintegers.Thesecondisalistofthreestrings.Theelementsofalistdonthavetobethesametype.Thefollowinglist containsastring,afloat,aninteger,and(lo!)anotherlist:
[ ' s p a m ' ,2 . 0 ,5 ,[ 1 0 ,2 0 ] ]

Alistwithinanotherlistis nested. Alistthatcontainsnoelementsiscalledanemptylistyoucancreateonewithemptybrackets, [ ] . Asyoumightexpect,youcanassignlistvaluestovariables:


> > >c h e e s e s=[ ' C h e d d a r ' ,' E d a m ' ,' G o u d a ' ] > > >n u m b e r s=[ 1 7 ,1 2 3 ] > > >e m p t y=[ ] > > >p r i n tc h e e s e s ,n u m b e r s ,e m p t y [ ' C h e d d a r ' ,' E d a m ' ,' G o u d a ' ][ 1 7 ,1 2 3 ][ ]

Listsaremutable
Thesyntaxforaccessingtheelementsofalististhesameasforaccessingthecharactersofastringthebracketoperator.Theexpressioninsidethe bracketsspecifiestheindex.Rememberthattheindicesstartat0:
> > >p r i n tc h e e s e s [ 0 ] C h e d d a r

Unlikestrings,listsaremutable.Whenthebracketoperatorappearsontheleftsideofanassignment,itidentifiestheelementofthelistthatwillbeassigned.
> > >n u m b e r s=[ 1 7 ,1 2 3 ] > > >n u m b e r s [ 1 ]=5 > > >p r i n tn u m b e r s
en.wikibooks.org/wiki/Think_Python/Print_version 90/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

[ 1 7 ,5 ]

Theoneethelementof n u m b e r s ,whichusedtobe123,isnow5. Youcanthinkofalistasarelationshipbetweenindicesandelements.Thisrelationshipiscalleda mappingeachindexmapstooneoftheelements.Here isastatediagramshowing c h e e s e s , n u m b e r s and e m p t y : <IMGSRC="book013.png"> Listsarerepresentedbyboxeswiththewordlistoutsideandtheelementsofthelistinside. c h e e s e s referstoalistwiththreeelementsindexed0,1and2. n u m b e r s containstwoelementsthediagramshowsthatthevalueofthesecondelementhasbeenreassignedfrom123to5. e m p t y referstoalistwithno elements. Listindicesworkthesamewayasstringindices: Anyintegerexpressioncanbeusedasanindex. Ifyoutrytoreadorwriteanelementthatdoesnotexist,yougetan I n d e x E r r o r . Ifanindexhasanegativevalue,itcountsbackwardfromtheendofthelist. The i n operatoralsoworksonlists.
> > >c h e e s e s=[ ' C h e d d a r ' ,' E d a m ' ,' G o u d a ' ] > > >' E d a m 'i nc h e e s e s T r u e > > >' B r i e 'i nc h e e s e s F a l s e

Traversingalist
Themostcommonwaytotraversetheelementsofalistiswitha f o r loop.Thesyntaxisthesameasforstrings:
f o rc h e e s ei nc h e e s e s : p r i n tc h e e s e

Thisworkswellifyouonlyneedtoreadtheelementsofthelist.Butifyouwanttowriteorupdatetheelements,youneedtheindices.Acommonwaytodo thatistocombinethefunctions r a n g e and l e n :


f o rii nr a n g e ( l e n ( n u m b e r s ) ) : n u m b e r s [ i ]=n u m b e r s [ i ]*2

Thislooptraversesthelistandupdateseachelement. l e n returnsthenumberofelementsinthelist. r a n g e returnsalistofindicesfrom0to n1,where nisthe en.wikibooks.org/wiki/Think_Python/Print_version 91/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thislooptraversesthelistandupdateseachelement. l e n returnsthenumberofelementsinthelist. r a n g e returnsalistofindicesfrom0to n1,where nisthe lengthofthelist.Eachtimethroughtheloop i getstheindexofthenextelement.Theassignmentstatementinthebodyuses i toreadtheoldvalueofthe elementandtoassignthenewvalue. A f o r loopoveranemptylistneverexecutesthebody:
f o rxi ne m p t y : p r i n t' T h i sn e v e rh a p p e n s . '

Althoughalistcancontainanotherlist,thenestedliststillcountsasasingleelement.Thelengthofthislistisfour:
[ ' s p a m ' ,1 ,[ ' B r i e ' ,' R o q u e f o r t ' ,' P o ll eV e q ' ] ,[ 1 ,2 ,3 ] ]

Listoperations
The + operatorconcatenateslists:
> > >a=[ 1 ,2 ,3 ] > > >b=[ 4 ,5 ,6 ] > > >c=a+b > > >p r i n tc [ 1 ,2 ,3 ,4 ,5 ,6 ]

Similarly,the * operatorrepeatsalistagivennumberoftimes:
> > >[ 0 ]*4 [ 0 ,0 ,0 ,0 ] > > >[ 1 ,2 ,3 ]*3 [ 1 ,2 ,3 ,1 ,2 ,3 ,1 ,2 ,3 ]

Thefirstexamplerepeats [ 0 ] fourtimes.Thesecondexamplerepeatsthelist [ 1 ,2 ,3 ] threetimes.

Listslices
Thesliceoperatoralsoworksonlists:
> > >t=[ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ] > > >t [ 1 : 3 ] [ ' b ' ,' c ' ] > > >t [ : 4 ]
en.wikibooks.org/wiki/Think_Python/Print_version 92/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

[ ' a ' ,' b ' ,' c ' ,' d ' ] > > >t [ 3 : ] [ ' d ' ,' e ' ,' f ' ]

Ifyouomitthefirstindex,theslicestartsatthebeginning.Ifyouomitthesecond,theslicegoestotheend.Soifyouomitboth,thesliceisacopyofthe wholelist.
> > >t [ : ] [ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ]

Sincelistsaremutable,itisoftenusefultomakeacopybeforeperformingoperationsthatfold,spindleormutilatelists. Asliceoperatorontheleftsideofanassignmentcanupdatemultipleelements:
> > >t=[ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ] > > >t [ 1 : 3 ]=[ ' x ' ,' y ' ] > > >p r i n tt [ ' a ' ,' x ' ,' y ' ,' d ' ,' e ' ,' f ' ]

Listmethods
Pythonprovidesmethodsthatoperateonlists.Forexample, a p p e n d addsanewelementtotheendofalist:
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >t . a p p e n d ( ' d ' ) > > >p r i n tt [ ' a ' ,' b ' ,' c ' ,' d ' ]
e x t e n d takesalistasanargumentandappendsalloftheelements:

> > >t 1=[ ' a ' ,' b ' ,' c ' ] > > >t 2=[ ' d ' ,' e ' ] > > >t 1 . e x t e n d ( t 2 ) > > >p r i n tt 1 [ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ]

Thisexampleleaves t 2 unmodified.
s o r t arrangestheelementsofthelistfromlowtohigh:

> > >t=[ ' d ' ,' c ' ,' e ' ,' b ' ,' a ' ]
en.wikibooks.org/wiki/Think_Python/Print_version 93/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >t . s o r t ( ) > > >p r i n tt [ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ]

Listmethodsareallvoidtheymodifythelistandreturn N o n e .Ifyouaccidentallywrite t=t . s o r t ( ) ,youwillbedisappointedwiththeresult.

Map,filterandreduce
Toaddupallthenumbersinalist,youcanusealooplikethis:
d e fa d d _ a l l ( t ) : t o t a l=0 f o rxi nt : t o t a l+ =x r e t u r nt o t a l
t o t a l isinitializedto0.Eachtimethroughtheloop, x getsoneelementfromthelist.The + = operatorprovidesashortwaytoupdateavariable:

t o t a l+ =x

isequivalentto:
t o t a l=t o t a l+x

Astheloopexecutes, t o t a l accumulatesthesumoftheelementsavariableusedthiswayissometimescalledan accumulator. AddinguptheelementsofalistissuchacommonoperationthatPythonprovidesitasabuiltinfunction, s u m :


> > >t=[ 1 ,2 ,3 ] > > >s u m ( t ) 6

Anoperationlikethisthatcombinesasequenceofelementsintoasinglevalueissometimescalled reduce. Sometimesyouwanttotraverseonelistwhilebuildinganother.Forexample,thefollowingfunctiontakesalistofstringsandreturnsanewlistthatcontains capitalizedstrings:


d e fc a p i t a l i z e _ a l l ( t ) : r e s=[ ] f o rsi nt : r e s . a p p e n d ( s . c a p i t a l i z e ( ) )
en.wikibooks.org/wiki/Think_Python/Print_version 94/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r nr e s
r e s isinitializedwithanemptylisteachtimethroughtheloop,weappendthenextelement.So r e s isanotherkindofaccumulator.

Anoperationlike c a p i t a l i z e _ a l l issometimescalleda mapbecauseitmapsafunction(inthiscasethemethod c a p i t a l i z e )ontoeachoftheelementsina sequence. Anothercommonoperationistoselectsomeoftheelementsfromalistandreturnasublist.Forexample,thefollowingfunctiontakesalistofstringsand returnsalistthatcontainsonlytheuppercasestrings:


d e fo n l y _ u p p e r ( t ) : r e s=[ ] f o rsi nt : i fs . i s u p p e r ( ) : r e s . a p p e n d ( s ) r e t u r nr e s
i s u p p e r isastringmethodthatreturns T r u e ifthestringcontainsonlyuppercaseletters.

Anoperationlike o n l y _ u p p e r iscalleda filterbecauseitselectssomeoftheelementsandfiltersouttheothers. Mostcommonlistoperationscanbeexpressedasacombinationofmap,filterandreduce.Becausetheseoperationsaresocommon,Pythonprovides languagefeaturestosupportthem,includingthebuiltinfunction m a p andanoperatorcalledalistcomprehension.

Exercise1
Writeafunctionthattakesalistofnumbersandreturnsthecumulativesumthatis,anewlistwherethe'i 'thelementisthesumofthefirst'i +1'elements fromtheoriginallist.Forexample,thecumulativesumof'[ 1 ,2 ,3 ] 'is'[ 1 ,3 ,6 ] '.

Deletingelements
Thereareseveralwaystodeleteelementsfromalist.Ifyouknowtheindexoftheelementyouwant,youcanuse p o p :
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >x=t . p o p ( 1 ) > > >p r i n tt [ ' a ' ,' c ' ] > > >p r i n tx b
p o p modifiesthelistandreturnstheelementthatwasremoved.Ifyoudontprovideanindex,itdeletesandreturnsthelastelement.

Ifyoudontneedtheremovedvalue,youcanusethe d e l operator:
en.wikibooks.org/wiki/Think_Python/Print_version 95/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >t=[ ' a ' ,' b ' ,' c ' ] > > >d e lt [ 1 ] > > >p r i n tt [ ' a ' ,' c ' ]

Ifyouknowtheelementyouwanttoremove(butnottheindex),youcanuse r e m o v e :
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >t . r e m o v e ( ' b ' ) > > >p r i n tt [ ' a ' ,' c ' ]

Thereturnvaluefrom r e m o v e is N o n e . Toremovemorethanoneelement,youcanuse d e l withasliceindex:


> > >t=[ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ] > > >d e lt [ 1 : 5 ] > > >p r i n tt [ ' a ' ,' f ' ]

Asusual,thesliceselectsalltheelementsupto,butnotincluding,thesecondindex.

Listsandstrings
Astringisasequenceofcharactersandalistisasequenceofvalues,butalistofcharactersisnotthesameasastring.Toconvertfromastringtoalistof characters,youcanuse l i s t :
> > >s=' s p a m ' > > >t=l i s t ( s ) > > >p r i n tt [ ' s ' ,' p ' ,' a ' ,' m ' ]

Because l i s t isthenameofabuiltinfunction,youshouldavoidusingitasavariablename.Ialsoavoid l becauseitlookstoomuchlike 1 .SothatswhyI use t . The l i s t functionbreaksastringintoindividualletters.Ifyouwanttobreakastringintowords,youcanusethe s p l i t method:


> > >s=' p i n i n gf o rt h ef j o r d s ' > > >t=s . s p l i t ( ) > > >p r i n tt
en.wikibooks.org/wiki/Think_Python/Print_version 96/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

[ ' p i n i n g ' ,' f o r ' ,' t h e ' ,' f j o r d s ' ]

Anoptionalargumentcalleda delimiterspecifieswhichcharacterstouseaswordboundaries.Thefollowingexampleusesahyphenasadelimiter:
> > >s=' s p a m s p a m s p a m ' > > >d e l i m i t e r=' ' > > >s . s p l i t ( d e l i m i t e r ) [ ' s p a m ' ,' s p a m ' ,' s p a m ' ]
j o i n istheinverseof s p l i t .Ittakesalistofstringsandconcatenatestheelements. j o i n isastringmethod,soyouhavetoinvokeitonthedelimiterandpass

thelistasaparameter:
> > >t=[ ' p i n i n g ' ,' f o r ' ,' t h e ' ,' f j o r d s ' ] > > >d e l i m i t e r='' > > >d e l i m i t e r . j o i n ( t ) ' p i n i n gf o rt h ef j o r d s '

Inthiscasethedelimiterisaspacecharacter,so j o i n putsaspacebetweenwords.Toconcatenatestringswithoutspaces,youcanusetheemptystring, ,as adelimiter.

Objectsandvalues
Ifweexecutetheseassignmentstatements:
a=' b a n a n a ' b=' b a n a n a '

Weknowthat a and b bothrefertoastring,butwedontknowwhethertheyrefertothe samestring.Therearetwopossiblestates: <IMGSRC="book014.png"> Inonecase, a and b refertotwodifferentobjectsthathavethesamevalue.Inthesecondcase,theyrefertothesameobject. Tocheckwhethertwovariablesrefertothesameobject,youcanusethe i s operator.
> > >a=' b a n a n a ' > > >b=' b a n a n a ' > > >ai sb T r u e

Inthisexample,Pythononlycreatedonestringobject,andboth a and b refertoit.


en.wikibooks.org/wiki/Think_Python/Print_version 97/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Butwhenyoucreatetwolists,yougettwoobjects:
> > >a=[ 1 ,2 ,3 ] > > >b=[ 1 ,2 ,3 ] > > >ai sb F a l s e

Sothestatediagramlookslikethis: <IMGSRC="book015.png"> Inthiscasewewouldsaythatthetwolistsare equivalent,becausetheyhavethesameelements,butnot identical ,becausetheyarenotthesameobject.If twoobjectsareidentical,theyarealsoequivalent,butiftheyareequivalent,theyarenotnecessarilyidentical. Untilnow,wehavebeenusingobjectandvalueinterchangeably,butitismoreprecisetosaythatanobjecthasavalue.Ifyouexecute a=[ 1 , 2 , 3 ] , a refers toalistobjectwhosevalueisaparticularsequenceofelements.Ifanotherlisthasthesameelements,wewouldsayithasthesamevalue.

Aliasing
If a referstoanobjectandyouassign b=a ,thenbothvariablesrefertothesameobject:
> > >a=[ 1 ,2 ,3 ] > > >b=a > > >bi sa T r u e

Thestatediagramlookslikethis: <IMGSRC="book016.png"> Theassociationofavariablewithanobjectiscalleda reference.Inthisexample,therearetworeferencestothesameobject. Anobjectwithmorethanonereferencehasmorethanonename,sowesaythattheobjectis aliased. Ifthealiasedobjectismutable,changesmadewithonealiasaffecttheother:


> > >b [ 0 ]=1 7 > > >p r i n ta [ 1 7 ,2 ,3 ]

Althoughthisbehaviorcanbeuseful,itiserrorprone.Ingeneral,itissafertoavoidaliasingwhenyouareworkingwithmutableobjects. Forimmutableobjectslikestrings,aliasingisnotasmuchofaproblem.Inthisexample:
en.wikibooks.org/wiki/Think_Python/Print_version 98/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

a=' b a n a n a ' b=' b a n a n a '

Italmostnevermakesadifferencewhether a and b refertothesamestringornot.

Listarguments
Whenyoupassalisttoafunction,thefunctiongetsareferencetothelist.Ifthefunctionmodifiesalistparameter,thecallerseesthechange.Forexample, d e l e t e _ h e a d removesthefirstelementfromalist:
d e fd e l e t e _ h e a d ( t ) : d e lt [ 0 ]

Hereshowitisused:
> > >l e t t e r s=[ ' a ' ,' b ' ,' c ' ] > > >d e l e t e _ h e a d ( l e t t e r s ) > > >p r i n tl e t t e r s [ ' b ' ,' c ' ]

Theparameter t andthevariable l e t t e r s arealiasesforthesameobject.Thestackdiagramlookslikethis: <IMGSRC="book017.png"> Sincethelistissharedbytwoframes,Idrewitbetweenthem. Itisimportanttodistinguishbetweenoperationsthatmodifylistsandoperationsthatcreatenewlists.Forexample,the a p p e n d methodmodifiesalist,butthe + operatorcreatesanewlist:


> > >t 1=[ 1 ,2 ] > > >t 2=t 1 . a p p e n d ( 3 ) > > >p r i n tt 1 [ 1 ,2 ,3 ] > > >p r i n tt 2 N o n e > > >t 3=t 1+[ 3 ] > > >p r i n tt 3 [ 1 ,2 ,3 ] > > >t 2i st 3 F a l s e

en.wikibooks.org/wiki/Think_Python/Print_version

99/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thisdifferenceisimportantwhenyouwritefunctionsthataresupposedtomodifylists.Forexample,thisfunction doesnot deletetheheadofalist:


d e fb a d _ d e l e t e _ h e a d ( t ) : t=t [ 1 : ]

#W R O N G !

Thesliceoperatorcreatesanewlistandtheassignmentmakes t refertoit,butnoneofthathasanyeffectonthelistthatwaspassedasanargument. Analternativeistowriteafunctionthatcreatesandreturnsanewlist.Forexample, t a i l returnsallbutthefirstelementofalist:


d e ft a i l ( t ) : r e t u r nt [ 1 : ]

Thisfunctionleavestheoriginallistunmodified.Hereshowitisused:
> > >l e t t e r s=[ ' a ' ,' b ' ,' c ' ] > > >r e s t=t a i l ( l e t t e r s ) > > >p r i n tr e s t [ ' b ' ,' c ' ]

Exercise2
Writeafunctioncalled'c h o p 'thattakesalistandmodifiesit,removingthefirstandlastelements,andreturns'N o n e '. Thenwriteafunctioncalled'm i d d l e 'thattakesalistandreturnsanewlistthatcontainsallbutthefirstandlastelements.

Debugging
Carelessuseoflists(andothermutableobjects)canleadtolonghoursofdebugging.Herearesomecommonpitfallsandwaystoavoidthem: Dontforgetthatmostlistmethodsmodifytheargumentand return N o n e .Thisistheoppositeofthestringmethods,whichreturnanewstringandleavetheoriginalalone.Ifyouareusedtowritingstringcodelikethis:
w o r d=w o r d . s t r i p ( )

Itistemptingtowritelistcodelikethis:
t=t . s o r t ( ) #W R O N G !

en.wikibooks.org/wiki/Think_Python/Print_version

100/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Because s o r t returns N o n e ,thenextoperationyouperformwith t islikelytofail. Beforeusinglistmethodsandoperators,youshouldreadthedocumentationcarefullyandthentestthemininteractivemode.Themethodsandoperatorsthat listssharewithothersequences(likestrings)aredocumentedat d o c s . p y t h o n . o r g / l i b / t y p e s s e q . h t m l .Themethodsandoperatorsthatonlyapplytomutable sequencesaredocumentedat d o c s . p y t h o n . o r g / l i b / t y p e s s e q m u t a b l e . h t m l . Pickanidiomandstickwithit. Partoftheproblemwithlistsisthattherearetoomanywaystodothings.Forexample,toremoveanelementfromalist,youcanuse p o p , r e m o v e , d e l ,oreven asliceassignment. Toaddanelement,youcanusethe a p p e n d methodorthe + operator.Butdontforgetthattheseareright:
t . a p p e n d ( x ) t=t+[ x ]

Andthesearewrong:
t . a p p e n d ( [ x ] ) t=t . a p p e n d ( x ) t+[ x ] t=t+x #W R O N G ! #W R O N G ! #W R O N G ! #W R O N G !

Tryouteachoftheseexamplesininteractivemodetomakesureyouunderstandwhattheydo.Noticethatonlythelastonecausesaruntimeerrortheother threearelegal,buttheydothewrongthing. Makecopiestoavoidaliasing.

Ifyouwanttouseamethodlike s o r t thatmodifiestheargument,butyouneedtokeeptheoriginallistaswell,youcanmakeacopy.
o r i g=t [ : ] t . s o r t ( )

Inthisexampleyoucouldalsousethebuiltinfunction s o r t e d ,whichreturnsanew,sortedlistandleavestheoriginalalone.Butinthatcaseyoushouldavoid using s o r t e d asavariablename!

Glossary
en.wikibooks.org/wiki/Think_Python/Print_version 101/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

list: Asequenceofvalues. element: Oneofthevaluesinalist(orothersequence),alsocalleditems. index: Anintegervaluethatindicatesanelementinalist. nestedlist: Alistthatisanelementofanotherlist. listtraversal: Thesequentialaccessingofeachelementinalist. mapping: Arelationshipinwhicheachelementofonesetcorrespondstoanelementofanotherset.Forexample,alistisamappingfromindicestoelements. accumulator: Avariableusedinalooptoadduporaccumulatearesult. reduce: Aprocessingpatternthattraversesasequenceandaccumulatestheelementsintoasingleresult. map: Aprocessingpatternthattraversesasequenceandperformsanoperationoneachelement. filter: Aprocessingpatternthattraversesalistandselectstheelementsthatsatisfysomecriterion. object: Somethingavariablecanreferto.Anobjecthasatypeandavalue. equivalent: Havingthesamevalue. identical: Beingthesameobject(whichimpliesequivalence). reference: Theassociationbetweenavariableanditsvalue. aliasing: Acircumstancewheretwovariablesrefertothesameobject. delimiter: Acharacterorstringusedtoindicatewhereastringshouldbesplit.

Exercises
Exercise3
en.wikibooks.org/wiki/Think_Python/Print_version 102/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Writeafunctioncalled i s _ s o r t e d thattakesalistasaparameterandreturns'T r u e 'ifthelistissortedinascendingorderand'F a l s e 'otherwise.Youcanassume (asaprecondition)thattheelementsofthelistcanbecomparedwiththecomparisonoperators'< ','> ',etc. Forexample, i s _ s o r t e d ( [ 1 , 2 , 2 ] ) shouldreturn'T r u e 'and i s _ s o r t e d ( [ ' b ' , ' a ' ] ) shouldreturn'F a l s e '.

Exercise4
Twowordsareanagramsifyoucanrearrangethelettersfromonetospelltheother.Writeafunctioncalled i s _ a n a g r a m thattakestwostringsandreturns'T r u e 'if theyareanagrams. Exercise5 The(socalled)BirthdayParadox: Writeafunctioncalled h a s _ d u p l i c a t e s thattakesalistandreturns'T r u e 'ifthereisanyelementthatappearsmorethanonce.Itshouldnotmodifytheoriginallist. Ifthereare23studentsinyourclass,whatarethechances thattwoofyouhavethesamebirthday?Youcanestimatethisprobabilitybygeneratingrandomsamplesof23birthdaysandcheckingformatches.Hint:you cangeneraterandombirthdayswiththe'r a n d i n t 'functioninthe'r a n d o m 'module. Youcanreadaboutthisproblemat 'w i k i p e d i a . o r g / w i k i / B i r t h d a y _ p a r a d o x ',andyoucanseemysolutionat't h i n k p y t h o n . c o m / c o d e / b i r t h d a y . p y '. Exercise6 Writeafunctioncalled r e m o v e _ d u p l i c a t e s thattakesalistandreturnsanewlistwithonlytheuniqueelementsfromtheoriginal.Hint:theydonthavetobeinthe sameorder.

Exercise7
Writeafunctionthatreadsthefile'w o r d s . t x t 'andbuildsalistwithoneelementperword.Writetwoversionsofthisfunction,oneusingthe'a p p e n d 'methodand theotherusingtheidiom't=t+[ x ] '.Whichonetakeslongertorun?Why? Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / w o r d l i s t . p y '.

Exercise8
Tocheckwhetherawordisinthewordlist,youcouldusethe'i n 'operator,butitwouldbeslowbecauseitsearchesthroughthewordsinorder. Becausethewordsareinalphabeticalorder,wecanspeedthingsupwithabisectionsearch,whichissimilartowhatyoudowhenyoulookawordupinthe dictionary.Youstartinthemiddleandchecktoseewhetherthewordyouarelookingforcomesbeforethewordinthemiddleofthelist.Ifso,thenyousearch thefirsthalfofthelistthesameway.Otherwiseyousearchthesecondhalf.

Eitherway,youcuttheremainingsearchspaceinhalf.Ifthewordlisthas113,809words,itwilltakeabout17stepstofindthewordorconcludethatitsnot en.wikibooks.org/wiki/Think_Python/Print_version 103/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Eitherway,youcuttheremainingsearchspaceinhalf.Ifthewordlisthas113,809words,itwilltakeabout17stepstofindthewordorconcludethatitsnot there. Writeafunctioncalled'b i s e c t 'thattakesasortedlist andatargetvalueandreturnstheindexofthevalueinthelist,ifitsthere,or'N o n e 'ifitsnot. Oryoucouldreadthedocumentationofthe'b i s e c t 'moduleandusethat!

Exercise9
Twowordsareareversepairifeachisthereverseoftheother.Writeaprogramthatfindsallthereversepairsinthewordlist.

Exercise10
Twowordsinterlockiftakingalternatinglettersfromeachformsanewword1.Forexample,shoeandcoldinterlocktoformschooled. Writeaprogramthatfindsallpairsofwordsthatinterlock. Hint:dontenumerateallpairs! Canyoufindanywordsthatarethreewayinterlockedthatis, everythirdletterformsaword,startingfromthefirst,secondorthird?

1 Thisexerciseisinspiredbyanexampleat p u z z l e r s . o r g .

Dictionaries
A dictionaryislikealist,butmoregeneral.Inalist,theindiceshavetobeintegersinadictionarytheycanbe(almost)anytype. Youcanthinkofadictionaryasamappingbetweenasetofindices(whicharecalled keys)andasetofvalues.Eachkeymapstoavalue.Theassociationof akeyandavalueiscalleda keyvaluepairorsometimesan item. Asanexample,we'llbuildadictionarythatmapsfromEnglishtoSpanishwords,sothekeysandthevaluesareallstrings. Thefunction d i c t createsanewdictionarywithnoitems.Because d i c t isthenameofabuiltinfunction,youshouldavoidusingitasavariablename.
> > >e n g 2 s p=d i c t ( ) > > >p r i n te n g 2 s p { }

en.wikibooks.org/wiki/Think_Python/Print_version

104/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thesquigglybrackets, { } ,representanemptydictionary.Toadditemstothedictionary,youcanusesquarebrackets:
> > >e n g 2 s p [ ' o n e ' ]=' u n o '

Thislinecreatesanitemthatmapsfromthekey o n e tothevalue ' u n o ' .Ifweprintthedictionaryagain,weseeakeyvaluepairwithacolonbetweenthekey andvalue:


> > >p r i n te n g 2 s p { ' o n e ' :' u n o ' }

Thisoutputformatisalsoaninputformat.Forexample,youcancreateanewdictionarywiththreeitems:
> > >e n g 2 s p={ ' o n e ' :' u n o ' ,' t w o ' :' d o s ' ,' t h r e e ' :' t r e s ' }

Butifyouprint e n g 2 s p ,youmightbesurprised:
> > >p r i n te n g 2 s p { ' o n e ' :' u n o ' ,' t h r e e ' :' t r e s ' ,' t w o ' :' d o s ' }

Theorderofthekeyvaluepairsisnotthesame.Infact,ifyoutypethesameexampleonyourcomputer,youmightgetadifferentresult.Ingeneral,theorder ofitemsinadictionaryisunpredictable. Butthatsnotaproblembecausetheelementsofadictionaryareneverindexedwithintegerindices.Instead,youusethekeystolookupthecorresponding values:


> > >p r i n te n g 2 s p [ ' t w o ' ] ' d o s '

Thekey t w o alwaysmapstothevalue ' d o s ' sotheorderoftheitemsdoesntmatter. Ifthekeyisntinthedictionary,yougetanexception:


> > >p r i n te n g 2 s p [ ' f o u r ' ] K e y E r r o r :' f o u r '

The l e n functionworksondictionariesitreturnsthenumberofkeyvaluepairs:
> > >l e n ( e n g 2 s p )
en.wikibooks.org/wiki/Think_Python/Print_version 105/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

The i n operatorworksondictionariesittellsyouwhethersomethingappearsasa keyinthedictionary(appearingasavalueisnotgoodenough).


> > >' o n e 'i ne n g 2 s p T r u e > > >' u n o 'i ne n g 2 s p F a l s e

Toseewhethersomethingappearsasavalueinadictionary,youcanusethemethod v a l u e s ,whichreturnsthevaluesasalist,andthenusethe i n operator:


> > >v a l s=e n g 2 s p . v a l u e s ( ) > > >' u n o 'i nv a l s T r u e

The i n operatorusesdifferentalgorithmsforlistsanddictionaries.Forlists,itusesasearchalgorithm,asinSection8.6.Asthelistgetslonger,thesearch timegetslongerindirectproportion.Fordictionaries,Pythonusesanalgorithmcalleda hashtablethathasaremarkableproperty:the i n operatortakesabout thesameamountoftimenomatterhowmanyitemsthereareinadictionary.Iwontexplainhowthatspossible,butyoucanreadmoreaboutitat w i k i p e d i a . o r g / w i k i / H a s h _ t a b l e .

Exercise1
Writeafunctionthatreadsthewordsin'w o r d s . t x t 'andstoresthemaskeysinadictionary.Itdoesntmatterwhatthevaluesare.Thenyoucanusethe'i n ' operatorasafastwaytocheckwhetherastringisinthedictionary. IfyoudidExercise'10.8',youcancomparethespeedofthisimplementationwiththelist'i n 'operatorandthebisectionsearch.

Dictionaryasasetofcounters
Supposeyouaregivenastringandyouwanttocounthowmanytimeseachletterappears.Thereareseveralwaysyoucoulddoit: Youcouldcreate26variables,oneforeachletterofthealphabet.Thenyoucouldtraversethestringand,foreachcharacter,incrementthe correspondingcounter,probablyusingachainedconditional. Youcouldcreatealistwith26elements.Thenyoucouldconverteachcharactertoanumber(usingthebuiltinfunction o r d ),usethenumberasan indexintothelist,andincrementtheappropriatecounter. Youcouldcreateadictionarywithcharactersaskeysandcountersasthecorrespondingvalues.Thefirsttimeyouseeacharacter,youwouldaddan itemtothedictionary.Afterthatyouwouldincrementthevalueofanexistingitem. Eachoftheseoptionsperformsthesamecomputation,buteachofthemimplementsthatcomputationinadifferentway. An implementationisawayofperformingacomputationsomeimplementationsarebetterthanothers.Forexample,anadvantageofthedictionary en.wikibooks.org/wiki/Think_Python/Print_version

106/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

An implementationisawayofperformingacomputationsomeimplementationsarebetterthanothers.Forexample,anadvantageofthedictionary implementationisthatwedonthavetoknowaheadoftimewhichlettersappearinthestringandweonlyhavetomakeroomforthelettersthatdoappear. Hereiswhatthecodemightlooklike:


d e fh i s t o g r a m ( s ) : d=d i c t ( ) f o rci ns : i fcn o ti nd : d [ c ]=1 e l s e : d [ c ]+ =1 r e t u r nd

Thenameofthefunctionis histogram,whichisastatisticaltermforasetofcounters(orfrequencies). Thefirstlineofthefunctioncreatesanemptydictionary.The f o r looptraversesthestring.Eachtimethroughtheloop,ifthecharacter c isnotinthe dictionary,wecreateanewitemwithkey c andtheinitialvalue1(sincewehaveseenthisletteronce).If c isalreadyinthedictionaryweincrement d [ c ] . Hereshowitworks:


> > >h=h i s t o g r a m ( ' b r o n t o s a u r u s ' ) > > >p r i n th { ' a ' :1 ,' b ' :1 ,' o ' :2 ,' n ' :1 ,' s ' :2 ,' r ' :2 ,' u ' :2 ,' t ' :1 }

Thehistogramindicatesthattheletters a and ' b ' appearonce ' o ' appearstwice,andsoon.

Exercise2
Dictionarieshaveamethodcalled'g e t 'thattakesakeyandadefaultvalue.Ifthekeyappearsinthedictionary,'g e t 'returnsthecorrespondingvalueotherwise itreturnsthedefaultvalue.Forexample:
' ' > > >h=h i s t o g r a m ( ' a ' ) > > >p r i n th { ' a ' :1 } > > >h . g e t ( ' a ' ,0 ) 1 > > >h . g e t ( ' b ' ,0 ) 0 ' '

Use'g e t 'towrite'h i s t o g r a m 'moreconcisely.Youshouldbeabletoeliminatethe'i f 'statement.

en.wikibooks.org/wiki/Think_Python/Print_version

107/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Loopinganddictionaries
Ifyouuseadictionaryina f o r statement,ittraversesthekeysofthedictionary.Forexample, p r i n t _ h i s t printseachkeyandthecorrespondingvalue:
d e fp r i n t _ h i s t ( h ) : f o rci nh : p r i n tc ,h [ c ]

Hereswhattheoutputlookslike:
> > >h=h i s t o g r a m ( ' p a r r o t ' ) > > >p r i n t _ h i s t ( h ) a1 p1 r2 t1 o1

Again,thekeysareinnoparticularorder.

Exercise3
Dictionarieshaveamethodcalled'k e y s 'thatreturnsthekeysofthedictionary,innoparticularorder,asalist. Modify p r i n t _ h i s t toprintthekeysandtheirvaluesinalphabeticalorder.

Reverselookup
Givenadictionary d andakey k ,itiseasytofindthecorrespondingvalue v=d [ k ] .Thisoperationiscalleda lookup. Butwhatifyouhave v andyouwanttofind k ?Youhavetwoproblems:first,theremightbemorethanonekeythatmapstothevalue v .Dependingonthe application,youmightbeabletopickone,oryoumighthavetomakealistthatcontainsallofthem.Second,thereisnosimplesyntaxtodoa reverse lookupyouhavetosearch. Hereisafunctionthattakesavalueandreturnsthefirstkeythatmapstothatvalue:
d e fr e v e r s e _ l o o k u p ( d ,v ) : f o rki nd : i fd [ k ]= =v : r e t u r nk r a i s eV a l u e E r r o r

en.wikibooks.org/wiki/Think_Python/Print_version

108/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thisfunctionisyetanotherexampleofthesearchpattern,butitusesafeaturewehaventseenbefore, r a i s e .The r a i s e statementcausesanexceptioninthis caseitcausesa V a l u e E r r o r ,whichgenerallyindicatesthatthereissomethingwrongwiththevalueofaparameter. Ifwegettotheendoftheloop,thatmeans v doesntappearinthedictionaryasavalue,soweraiseanexception. Hereisanexampleofasuccessfulreverselookup:


> > >h=h i s t o g r a m ( ' p a r r o t ' ) > > >k=r e v e r s e _ l o o k u p ( h ,2 ) > > >p r i n tk r

Andanunsuccessfulone:
> > >k=r e v e r s e _ l o o k u p ( h ,3 ) T r a c e b a c k( m o s tr e c e n tc a l ll a s t ) : F i l e" < s t d i n > " ,l i n e1 ,i n? F i l e" < s t d i n > " ,l i n e5 ,i nr e v e r s e _ l o o k u p V a l u e E r r o r

TheresultwhenyouraiseanexceptionisthesameaswhenPythonraisesone:itprintsatracebackandanerrormessage. The r a i s e statementtakesadetailederrormessageasanoptionalargument.Forexample:


> > >r a i s eV a l u e E r r o r ,' v a l u ed o e sn o ta p p e a ri nt h ed i c t i o n a r y ' T r a c e b a c k( m o s tr e c e n tc a l ll a s t ) : F i l e" < s t d i n > " ,l i n e1 ,i n? V a l u e E r r o r :v a l u ed o e sn o ta p p e a ri nt h ed i c t i o n a r y

Areverselookupismuchslowerthanaforwardlookupifyouhavetodoitoften,orifthedictionarygetsbig,theperformanceofyourprogramwillsuffer. Exercise4 Modify r e v e r s e _ l o o k u p sothatitbuildsandreturnsalistof allkeysthatmapto'v ',oranemptylistiftherearenone.

Dictionariesandlists
Listscanappearasvaluesinadictionary.Forexample,ifyouweregivenadictionarythatmapsfromletterstofrequencies,youmightwanttoinvertitthatis, createadictionarythatmapsfromfrequenciestoletters.Sincetheremightbeseveralletterswiththesamefrequency,eachvalueintheinverteddictionary shouldbealistofletters. Hereisafunctionthatinvertsadictionary:
en.wikibooks.org/wiki/Think_Python/Print_version 109/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fi n v e r t _ d i c t ( d ) : i n v=d i c t ( ) f o rk e yi nd : v a l=d [ k e y ] i fv a ln o ti ni n v : i n v [ v a l ]=[ k e y ] e l s e : i n v [ v a l ] . a p p e n d ( k e y ) r e t u r ni n v

Eachtimethroughtheloop, k e y getsakeyfrom d and v a l getsthecorrespondingvalue.If v a l isnotin i n v ,thatmeanswehaventseenitbefore,sowecreatea newitemandinitializeitwitha singleton(alistthatcontainsasingleelement).Otherwisewehaveseenthisvaluebefore,soweappendthecorresponding keytothelist. Hereisanexample:
> > >h i s t=h i s t o g r a m ( ' p a r r o t ' ) > > >p r i n th i s t { ' a ' :1 ,' p ' :1 ,' r ' :2 ,' t ' :1 ,' o ' :1 } > > >i n v=i n v e r t _ d i c t ( h i s t ) > > >p r i n ti n v { 1 :[ ' a ' ,' p ' ,' t ' ,' o ' ] ,2 :[ ' r ' ] }

Andhereisadiagramshowing h i s t and i n v : <IMGSRC="book018.png"> Adictionaryisrepresentedasaboxwiththetype d i c t aboveitandthekeyvaluepairsinside.Ifthevaluesareintegers,floatsorstrings,Iusuallydrawthem insidethebox,butIusuallydrawlistsoutsidethebox,justtokeepthediagramsimple. Listscanbevaluesinadictionary,asthisexampleshows,buttheycannotbekeys.Hereswhathappensifyoutry:


> > >t=[ 1 ,2 ,3 ] > > >d=d i c t ( ) > > >d [ t ]=' o o p s ' T r a c e b a c k( m o s tr e c e n tc a l ll a s t ) : F i l e" < s t d i n > " ,l i n e1 ,i n? T y p e E r r o r :l i s to b j e c t sa r eu n h a s h a b l e

Imentionedearlierthatadictionaryisimplementedusingahashtableandthatmeansthatthekeyshavetobe hashable.
en.wikibooks.org/wiki/Think_Python/Print_version 110/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

A hashisafunctionthattakesavalue(ofanykind)andreturnsaninteger.Dictionariesusetheseintegers,calledhashvalues,tostoreandlookupkeyvalue pairs. Thissystemworksfineifthekeysareimmutable.Butifthekeysaremutable,likelists,badthingshappen.Forexample,whenyoucreateakeyvaluepair, Pythonhashesthekeyandstoresitinthecorrespondinglocation.Ifyoumodifythekeyandthenhashitagain,itwouldgotoadifferentlocation.Inthatcase youmighthavetwoentriesforthesamekey,oryoumightnotbeabletofindakey.Eitherway,thedictionarywouldntworkcorrectly. Thatswhythekeyshavetobehashable,andwhymutabletypeslikelistsarent.Thesimplestwaytogetaroundthislimitationistousetuples,whichwewill seeinthenextchapter. Sincedictionariesaremutable,theycantbeusedaskeys,buttheycanbeusedasvalues.

Exercise5
Readthedocumentationofthedictionarymethod's e t d e f a u l t 'anduseittowriteamoreconciseversionof i n v e r t _ d i c t .

Memos
Ifyouplayedwiththe f i b o n a c c i functionfromSection6.7,youmighthavenoticedthatthebiggertheargumentyouprovide,thelongerthefunctiontakesto run.Furthermore,theruntimeincreasesveryquickly. Tounderstandwhy,considerthis callgraphfor f i b o n a c c i with n = 4 : <IMGSRC="book019.png"> Acallgraphshowsasetoffunctionframes,withlinesconnectingeachframetotheframesofthefunctionsitcalls.Atthetopofthegraph, f i b o n a c c i with n = 4 calls f i b o n a c c i with n = 3 and n = 2 .Inturn, f i b o n a c c i with n = 3 calls f i b o n a c c i with n = 2 and n = 1 .Andsoon. Counthowmanytimes f i b o n a c c i ( 0 ) and f i b o n a c c i ( 1 ) arecalled.Thisisaninefficientsolutiontotheproblem,anditgetsworseastheargumentgetsbigger. Onesolutionistokeeptrackofvaluesthathavealreadybeencomputedbystoringtheminadictionary.Apreviouslycomputedvaluethatisstoredforlater useiscalleda memo[12].Hereisanimplementationof f i b o n a c c i usingmemos:
k n o w n={ 0 : 0 ,1 : 1 } d e ff i b o n a c c i ( n ) : i fni nk n o w n : r e t u r nk n o w n [ n ] r e s=f i b o n a c c i ( n 1 )+f i b o n a c c i ( n 2 ) k n o w n [ n ]=r e s r e t u r nr e s
k n o w n isadictionarythatkeepstrackoftheFibonaccinumberswealreadyknow.Itstartswithtwoitems:0mapsto0and1mapsto1.
en.wikibooks.org/wiki/Think_Python/Print_version 111/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Whenever f i b o n a c c i iscalled,itchecks k n o w n .Iftheresultisalreadythere,itcanreturnimmediately.Otherwiseithastocomputethenewvalue,addittothe dictionary,andreturnit.

Exercise6
Runthisversionof'f i b o n a c c i 'andtheoriginalwitharangeofparametersandcomparetheirruntimes.

Globalvariables
Inthepreviousexample, k n o w n iscreatedoutsidethefunction,soitbelongstothespecialframecalled _ _ m a i n _ _ .Variablesin _ _ m a i n _ _ aresometimescalled global becausetheycanbeaccessedfromanyfunction.Unlikelocalvariables,whichdisappearwhentheirfunctionends,globalvariablespersistfromone functioncalltothenext. Itiscommontouseglobalvariablesfor flagsthatis,booleanvariablesthatindicate(flag)whetheraconditionistrue.Forexample,someprogramsusea flagnamed v e r b o s e tocontrolthelevelofdetailintheoutput:
v e r b o s e=T r u e d e fe x a m p l e 1 ( ) : i fv e r b o s e : p r i n t' R u n n i n ge x a m p l e 1 '

Ifyoutrytoreassignaglobalvariable,youmightbesurprised.Thefollowingexampleissupposedtokeeptrackofwhetherthefunctionhasbeencalled:
b e e n _ c a l l e d=F a l s e d e fe x a m p l e 2 ( ) : b e e n _ c a l l e d=T r u e

#W R O N G

Butifyourunityouwillseethatthevalueof b e e n _ c a l l e d doesntchange.Theproblemisthat e x a m p l e 2 createsanewlocalvariablenamed b e e n _ c a l l e d .Thelocal variablegoesawaywhenthefunctionends,andhasnoeffectontheglobalvariable. Toreassignaglobalvariableinsideafunctionyouhaveto declaretheglobalvariablebeforeyouuseit:


b e e n _ c a l l e d=F a l s e d e fe x a m p l e 2 ( ) : g l o b a lb e e n _ c a l l e d b e e n _ c a l l e d=T r u e

The g l o b a l statementtellstheinterpretersomethinglike,Inthisfunction,whenIsay b e e n _ c a l l e d ,Imeantheglobalvariabledontcreatealocalone.

en.wikibooks.org/wiki/Think_Python/Print_version

112/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Heresanexamplethattriestoupdateaglobalvariable:
c o u n t=0 d e fe x a m p l e 3 ( ) : c o u n t=c o u n t+1

#W R O N G

Ifyourunityouget:
U n b o u n d L o c a l E r r o r :l o c a lv a r i a b l e' c o u n t 'r e f e r e n c e db e f o r ea s s i g n m e n t

Pythonassumesthat c o u n t islocal,whichmeansthatyouarereadingitbeforewritingit.Thesolution,again,istodeclare c o u n t global.


d e fe x a m p l e 3 ( ) : g l o b a lc o u n t c o u n t+ =1

Iftheglobalvalueismutable,youcanmodifyitwithoutdeclaringit:
k n o w n={ 0 : 0 ,1 : 1 } d e fe x a m p l e 4 ( ) : k n o w n [ 2 ]=1

Soyoucanadd,removeandreplaceelementsofagloballistordictionary,butifyouwanttoreassignthevariable,youhavetodeclareit:
d e fe x a m p l e 5 ( ) : g l o b a lk n o w n k n o w n=d i c t ( )

Longintegers
Ifyoucompute f i b o n a c c i ( 5 0 ) ,youget:
> > >f i b o n a c c i ( 5 0 ) 1 2 5 8 6 2 6 9 0 2 5 L

The L attheendindicatesthattheresultisalonginteger[13],ortype l o n g .
en.wikibooks.org/wiki/Think_Python/Print_version 113/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Valueswithtype i n t havealimitedrangelongintegerscanbearbitrarilybig,butastheygetbiggertheyconsumemorespaceandtime. Themathematicaloperatorsworkonlongintegers,andthefunctionsinthe m a t h module,too,soingeneralanycodethatworkswith i n t willalsoworkwith l o n g . Anytimetheresultofacomputationistoobigtoberepresentedwithaninteger,Pythonconvertstheresultasalonginteger:


> > >1 0 0 0*1 0 0 0 1 0 0 0 0 0 0 > > >1 0 0 0 0 0*1 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L

Inthefirstcasetheresulthastype i n t inthesecondcaseitis l o n g .

Exercise7
Exponentiationoflargeintegersisthebasisofcommonalgorithmsforpublickeyencryption.ReadtheWikipediapageontheRSAalgorithm[14]andwrite functionstoencodeanddecodemessages.

Debugging
Asyouworkwithbiggerdatasetsitcanbecomeunwieldytodebugbyprintingandcheckingdatabyhand.Herearesomesuggestionsfordebugginglarge datasets: Scaledowntheinput: Ifpossible,reducethesizeofthedataset.Forexampleiftheprogramreadsatextfile,startwithjustthefirst10lines,orwiththesmallestexample youcanfind.Youcaneithereditthefilesthemselves,or(better)modifytheprogramsoitreadsonlythefirst n lines.Ifthereisanerror,youcanreduce
n tothesmallestvaluethatmanifeststheerror,andthenincreaseitgraduallyasyoufindandcorrecterrors.

Checksummariesandtypes: Insteadofprintingandcheckingtheentiredataset,considerprintingsummariesofthedata:forexample,thenumberofitemsinadictionaryorthe totalofalistofnumbers.Acommoncauseofruntimeerrorsisavaluethatisnottherighttype.Fordebuggingthiskindoferror,itisoftenenoughto printthetypeofavalue. Writeselfchecks: Sometimesyoucanwritecodetocheckforerrorsautomatically.Forexample,ifyouarecomputingtheaverageofalistofnumbers,youcouldcheck thattheresultisnotgreaterthanthelargestelementinthelistorlessthanthesmallest.Thisiscalledasanitycheckbecauseitdetectsresultsthat areinsane.Anotherkindofcheckcomparestheresultsoftwodifferentcomputationstoseeiftheyareconsistent.Thisiscalledaconsistencycheck. Prettyprinttheoutput: Formattingdebuggingoutputcanmakeiteasiertospotanerror.WesawanexampleinSection6.9.The p p r i n t moduleprovidesa p p r i n t functionthat displaysbuiltintypesinamorehumanreadableformat. Again,timeyouspendbuildingscaffoldingcanreducethetimeyouspenddebugging.
en.wikibooks.org/wiki/Think_Python/Print_version 114/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Glossary
dictionary: Amappingfromasetofkeystotheircorrespondingvalues. keyvaluepair: Therepresentationofthemappingfromakeytoavalue. item: Anothernameforakeyvaluepair. key: Anobjectthatappearsinadictionaryasthefirstpartofakeyvaluepair. value: Anobjectthatappearsinadictionaryasthesecondpartofakeyvaluepair.Thisismorespecificthanourprevioususeofthewordvalue. implementation: Awayofperformingacomputation. hashtable: ThealgorithmusedtoimplementPythondictionaries. hashfunction: Afunctionusedbyahashtabletocomputethelocationforakey. hashable: Atypethathasahashfunction.Immutabletypeslikeintegers,floatsandstringsarehashablemutabletypeslikelistsanddictionariesarenot. lookup: Adictionaryoperationthattakesakeyandfindsthecorrespondingvalue. reverselookup: Adictionaryoperationthattakesavalueandfindsoneormorekeysthatmaptoit. singleton: Alist(orothersequence)withasingleelement. callgraph: Adiagramthatshowseveryframecreatedduringtheexecutionofaprogram,withanarrowfromeachcallertoeachcallee. histogram: Asetofcounters. memo: Acomputedvaluestoredtoavoidunnecessaryfuturecomputation. globalvariable: Avariabledefinedoutsideafunction.Globalvariablescanbeaccessedfromanyfunction. flag: Abooleanvariableusedtoindicatewhetheraconditionistrue.
en.wikibooks.org/wiki/Think_Python/Print_version 115/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

declaration: Astatementlike g l o b a l thattellstheinterpretersomethingaboutavariable.

Exercise8
D i c t i o n a r i e sh a v eam e t h o dc a l l e d' k e y s 't h a tr e t u r n st h ek e y so ft h ed i c t i o n a r y ,i n

noparticularorder,asalist.Modifyprint_histtoprintthekeysandtheirvaluesinalphabeticalorder.

Exercise9
Twowordsarerotatepairsifyoucanrotateoneofthemandgettheother(see r o t a t e _ w o r d inExercise'8.12'). Writeaprogramthatreadsawordlistandfindsalltherotatepairs.

Exercise10
HeresanotherPuzzlerfromCarTalk[15]: ThiswassentinbyafellownamedDanOLeary.Hecameuponacommononesyllable,fiveletterwordrecentlythathasthefollowingunique property.Whenyouremovethefirstletter,theremaininglettersformahomophoneoftheoriginalword,thatisawordthatsoundsexactlythe same.Replacethefirstletter,thatis,putitbackandremovethesecondletterandtheresultisyetanotherhomophoneoftheoriginalword.And thequestionis,whatstheword? NowImgoingtogiveyouanexamplethatdoesntwork.Letslookat thefiveletterword,wrack.WRACK, youknowliketowrackwithpain.IfIremovethefirstletter,Iamleftwithafourletterword,RACK.Asin,Holycow,didyouseetherackon thatbuck!Itmusthavebeenaninepointer!Itsaperfecthomophone.Ifyouputthewback,andremovether,instead,youreleftwiththe word,wack,whichisarealword,itsjustnotahomophoneoftheothertwowords. Butthereis,however,atleastonewordthatDanandweknowof, whichwillyieldtwohomophonesifyouremoveeitherofthefirsttwolettersto maketwo,newfourletterwords.Thequestionis,whatstheword? ' YoucanusethedictionaryfromExercise'11.1'tocheckwhetherastringisinthewordlist. Tocheckwhethertwowordsarehomophones,youcanusetheCMUPronouncingDictionary.Youcandownloaditfrom'w w w . s p e e c h . c s . c m u . e d u / c g i b i n / c m u d i c t 'or from't h i n k p y t h o n . c o m / c o d e / c 0 6 d 'andyoucanalsodownload't h i n k p y t h o n . c o m / c o d e / p r o n o u n c e . p y ',whichprovidesafunctionnamed r e a d _ d i c t i o n a r y thatreadsthe pronouncingdictionaryandreturnsaPythondictionarythatmapsfromeachwordtoastringthatdescribesitsprimarypronunciation. WriteaprogramthatlistsallthewordsthatsolvethePuzzler. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / h o m o p h o n e . p y '.

Notes
en.wikibooks.org/wiki/Think_Python/Print_version 116/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.

Tuples
Tuplesareimmutable
Atupleisasequenceofvalues.Thevaluescanbeanytype,andtheyareindexedbyintegers,sointhatrespecttuplesarealotlikelists.Theimportant differenceisthattuplesareimmutable. Syntactically,atupleisacommaseparatedlistofvalues:
> > >t=' a ' ,' b ' ,' c ' ,' d ' ,' e '

Althoughitisnotnecessary,itiscommontoenclosetuplesinparentheses:
> > >t=( ' a ' ,' b ' ,' c ' ,' d ' ,' e ' )

Tocreateatuplewithasingleelement,youhavetoincludethefinalcomma:
> > >t 1=( ' a ' , ) > > >t y p e ( t 1 ) < t y p e' t u p l e ' >

Withoutthecomma,Pythontreats ( ' a ' ) asastringinparentheses:


> > >t 2=( ' a ' ) > > >t y p e ( t 2 ) < t y p e' s t r ' >

Anotherwaytocreateatupleisthebuiltinfunction t u p l e .Withnoargument,itcreatesanemptytuple:
> > >t=t u p l e ( ) > > >p r i n tt ( )

Iftheargumentisasequence(string,listortuple),theresultisatuplewiththeelementsofthesequence:
> > >t=t u p l e ( ' l u p i n s ' ) > > >p r i n tt
en.wikibooks.org/wiki/Think_Python/Print_version 117/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

( ' l ' ,' u ' ,' p ' ,' i ' ,' n ' ,' s ' )

Because t u p l e isthenameofabuiltinfunction,youshouldavoidusingitasavariablename. Mostlistoperatorsalsoworkontuples.Thebracketoperatorindexesanelement:


> > >t=( ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ) > > >p r i n tt [ 0 ] ' a '

Andthesliceoperatorselectsarangeofelements.
> > >p r i n tt [ 1 : 3 ] ( ' b ' ,' c ' )

Butifyoutrytomodifyoneoftheelementsofthetuple,yougetanerror:
> > >t [ 0 ]=' A ' T y p e E r r o r :o b j e c td o e s n ' ts u p p o r ti t e ma s s i g n m e n t

Youcantmodifytheelementsofatuple,butyoucanreplaceonetuplewithanother:
> > >t=( ' A ' , )+t [ 1 : ] > > >p r i n tt ( ' A ' ,' b ' ,' c ' ,' d ' ,' e ' )

Tupleassignment
Itisoftenusefultoswapthevaluesoftwovariables.Withconventionalassignments,youhavetouseatemporaryvariable.Forexample,toswap a and b :
> > >t e m p=a > > >a=b > > >b=t e m p

Thissolutioniscumbersome tupleassignmentismoreelegant:
> > >a ,b=b ,a

en.wikibooks.org/wiki/Think_Python/Print_version

118/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theleftsideisatupleofvariablestherightsideisatupleofexpressions.Eachvalueisassignedtoitsrespectivevariable.Alltheexpressionsontheright sideareevaluatedbeforeanyoftheassignments. Thenumberofvariablesontheleftandthenumberofvaluesontherighthavetobethesame:


> > >a ,b=1 ,2 ,3 V a l u e E r r o r :t o om a n yv a l u e st ou n p a c k

Moregenerally,therightsidecanbeanykindofsequence(string,listortuple).Forexample,tosplitanemailaddressintoausernameandadomain,you couldwrite:
> > >a d d r=' m o n t y @ p y t h o n . o r g ' > > >u n a m e ,d o m a i n=a d d r . s p l i t ( ' @ ' )

Thereturnvaluefrom s p l i t isalistwithtwoelementsthefirstelementisassignedto u n a m e ,thesecondto d o m a i n .


> > >p r i n tu n a m e m o n t y > > >p r i n td o m a i n p y t h o n . o r g

Tuplesasreturnvalues
Strictlyspeaking,afunctioncanonlyreturnonevalue,butifthevalueisatuple,theeffectisthesameasreturningmultiplevalues.Forexample,ifyouwant todividetwointegersandcomputethequotientandremainder,itisinefficienttocompute x / y andthen x % y .Itisbettertocomputethembothatthesame time. Thebuiltinfunction d i v m o d takestwoargumentsandreturnsatupleoftwovalues,thequotientandremainder.Youcanstoretheresultasatuple:
> > >t=d i v m o d ( 7 ,3 ) > > >p r i n tt ( 2 ,1 )

Orusetupleassignmenttostoretheelementsseparately:
> > >q u o t ,r e m=d i v m o d ( 7 ,3 ) > > >p r i n tq u o t 2 > > >p r i n tr e m 1

en.wikibooks.org/wiki/Think_Python/Print_version

119/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Hereisanexampleofafunctionthatreturnsatuple:
d e fm i n _ m a x ( t ) : r e t u r nm i n ( t ) ,m a x ( t )
m a x and m i n arebuiltinfunctionsthatfindthelargestandsmallestelementsofasequence. m i n _ m a x computesbothandreturnsatupleoftwovalues.

Variablelengthargumenttuples
Functionscantakeavariablenumberofarguments.Aparameternamethatbeginswith * gathersargumentsintoatuple.Forexample, p r i n t a l l takesany numberofargumentsandprintsthem:
d e fp r i n t a l l ( * a r g s ) : p r i n ta r g s

Thegatherparametercanhaveanynameyoulike,but a r g s isconventional.Hereshowthefunctionworks:
> > >p r i n t a l l ( 1 ,2 . 0 ,' 3 ' ) ( 1 ,2 . 0 ,' 3 ' )

Youcancombinethegatheroperatorwithrequiredandpositionalarguments:
d e fp o i n t l e s s ( r e q u i r e d ,o p t i o n a l = 0 ,* a r g s ) : p r i n tr e q u i r e d ,o p t i o n a l ,a r g s

Runthisfunctionwith1,2,3and4ormoreargumentsandmakesureyouunderstandwhatitdoes. Thecomplementofgatheris scatter.Ifyouhaveasequenceofvaluesandyouwanttopassittoafunctionasmultiplearguments,youcanusethe * operator.Forexample, d i v m o d takesexactlytwoargumentsitdoesntworkwithatuple:


> > >t=( 7 ,3 ) > > >d i v m o d ( t ) T y p e E r r o r :d i v m o de x p e c t e d2a r g u m e n t s ,g o t1

Butifyouscatterthetuple,itworks:
> > >d i v m o d ( * t ) ( 2 ,1 )

en.wikibooks.org/wiki/Think_Python/Print_version

120/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise1
Manyofthebuiltinfunctionsusevariablelengthargumenttuples.Forexample,'m a x 'and'm i n 'cantakeanynumberofarguments:
' ' > > >m a x ( 1 , 2 , 3 ) 3 ' '

But's u m 'doesnot.
' ' > > >s u m ( 1 , 2 , 3 ) T y p e E r r o r :s u me x p e c t e da tm o s t2a r g u m e n t s ,g o t3 ' '

Writeafunctioncalled's u m a l l 'thattakesanynumberofargumentsandreturnstheirsum.

Listsandtuples
z i p isabuiltinfunctionthattakestwoormoresequencesandzipsthemintoalist 1oftupleswhereeachtuplecontainsoneelementfromeachsequence.

Thisexamplezipsastringandalist:
> > >s=' a b c ' > > >t=[ 0 ,1 ,2 ] > > >z i p ( s ,t ) [ ( ' a ' ,0 ) ,( ' b ' ,1 ) ,( ' c ' ,2 ) ]

Theresultisalistoftupleswhereeachtuplecontainsacharacterfromthestringandthecorrespondingelementfromthelist. Ifthesequencesarenotthesamelength,theresulthasthelengthoftheshorterone.
> > >z i p ( ' A n n e ' ,' E l k ' ) [ ( ' A ' ,' E ' ) ,( ' n ' ,' l ' ) ,( ' n ' ,' k ' ) ]

Youcanusetupleassignmentina f o r looptotraversealistoftuples:
t=[ ( ' a ' ,0 ) ,( ' b ' ,1 ) ,( ' c ' ,2 ) ] f o rl e t t e r ,n u m b e ri nt : p r i n tn u m b e r ,l e t t e r

en.wikibooks.org/wiki/Think_Python/Print_version

121/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Eachtimethroughtheloop,Pythonselectsthenexttupleinthelistandassignstheelementsto l e t t e r and n u m b e r .Theoutputofthisloopis:


0a 1b 2c

Ifyoucombine z i p , f o r andtupleassignment,yougetausefulidiomfortraversingtwo(ormore)sequencesatthesametime.Forexample, h a s _ m a t c h takestwo sequences, t 1 and t 2 ,andreturns T r u e ifthereisanindex i suchthat t 1 [ i ]= =t 2 [ i ] :


d e fh a s _ m a t c h ( t 1 ,t 2 ) : f o rx ,yi nz i p ( t 1 ,t 2 ) : i fx= =y : r e t u r nT r u e r e t u r nF a l s e

Ifyouneedtotraversetheelementsofasequenceandtheirindices,youcanusethebuiltinfunction e n u m e r a t e :
f o ri n d e x ,e l e m e n ti ne n u m e r a t e ( ' a b c ' ) : p r i n ti n d e x ,e l e m e n t

Theoutputofthisloopis:
0a 1b 2c

Again.

Dictionariesandtuples
Dictionarieshaveamethodcalled i t e m s thatreturnsalistoftuples,whereeachtupleisakeyvaluepair2.
> > >d={ ' a ' : 0 ,' b ' : 1 ,' c ' : 2 } > > >t=d . i t e m s ( ) > > >p r i n tt [ ( ' a ' ,0 ) ,( ' c ' ,2 ) ,( ' b ' ,1 ) ]

Asyoushouldexpectfromadictionary,theitemsareinnoparticularorder. Conversely,youcanusealistoftuplestoinitializeanewdictionary:
en.wikibooks.org/wiki/Think_Python/Print_version 122/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >t=[ ( ' a ' ,0 ) ,( ' c ' ,2 ) ,( ' b ' ,1 ) ] > > >d=d i c t ( t ) > > >p r i n td { ' a ' :0 ,' c ' :2 ,' b ' :1 }

Combining d i c t with z i p yieldsaconcisewaytocreateadictionary:


> > >d=d i c t ( z i p ( ' a b c ' ,r a n g e ( 3 ) ) ) > > >p r i n td { ' a ' :0 ,' c ' :2 ,' b ' :1 }

Thedictionarymethod u p d a t e alsotakesalistoftuplesandaddsthem,askeyvaluepairs,toanexistingdictionary. Combining i t e m s ,tupleassignmentand f o r ,yougettheidiomfortraversingthekeysandvaluesofadictionary:


f o rk e y ,v a li nd . i t e m s ( ) : p r i n tv a l ,k e y

Theoutputofthisloopis:
0a 2c 1b

Again. Itiscommontousetuplesaskeysindictionaries(primarilybecauseyoucantuselists).Forexample,atelephonedirectorymightmapfromlastname,first namepairstotelephonenumbers.Assumingthatwehavedefined l a s t , f i r s t and n u m b e r ,wecouldwrite:


d i r e c t o r y [ l a s t , f i r s t ]=n u m b e r

Theexpressioninbracketsisatuple.Wecouldusetupleassignmenttotraversethisdictionary.
f o rl a s t ,f i r s ti nd i r e c t o r y : p r i n tf i r s t ,l a s t ,d i r e c t o r y [ l a s t , f i r s t ]

Thislooptraversesthekeysin d i r e c t o r y ,whicharetuples.Itassignstheelementsofeachtupleto l a s t and f i r s t ,thenprintsthenameandcorresponding telephonenumber.

en.wikibooks.org/wiki/Think_Python/Print_version

123/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Therearetwowaystorepresenttuplesinastatediagram.Themoredetailedversionshowstheindicesandelementsjustastheyappearinalist.For example,thetuple ( ' C l e e s e ' ,' J o h n ' ) wouldappear: <IMGSRC="book020.png"> Butinalargerdiagramyoumightwanttoleaveoutthedetails.Forexample,adiagramofthetelephonedirectorymightappear: <IMGSRC="book021.png"> HerethetuplesareshownusingPythonsyntaxasagraphicalshorthand. ThetelephonenumberinthediagramisthecomplaintslinefortheBBC,sopleasedontcallit.

Comparingtuples
ThecomparisonoperatorsworkwithtuplesandothersequencesPythonstartsbycomparingthefirstelementfromeachsequence.Iftheyareequal,itgoes ontothenextelements,andsoon,untilitfindselementsthatdiffer.Subsequentelementsarenotconsidered(eveniftheyarereallybig).
> > >( 0 ,1 ,2 )<( 0 ,3 ,4 ) T r u e > > >( 0 ,1 ,2 0 0 0 0 0 0 )<( 0 ,3 ,4 ) T r u e

The s o r t functionworksthesameway.Itsortsprimarilybyfirstelement,butinthecaseofatie,itsortsbysecondelement,andsoon. Thisfeaturelendsitselftoapatterncalled DSUfor Decorate asequencebybuildingalistoftupleswithoneormoresortkeysprecedingtheelementsfromthesequence, Sort thelistoftuples,and Undecorate byextractingthesortedelementsofthesequence. Forexample,supposeyouhavealistofwordsandyouwanttosortthemfromlongesttoshortest:
d e fs o r t _ b y _ l e n g t h ( w o r d s ) : t=[ ] f o rw o r di nw o r d s : t . a p p e n d ( ( l e n ( w o r d ) ,w o r d ) ) t . s o r t ( r e v e r s e = T r u e )

en.wikibooks.org/wiki/Think_Python/Print_version

124/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e s=[ ] f o rl e n g t h ,w o r di nt : r e s . a p p e n d ( w o r d ) r e t u r nr e s

Thefirstloopbuildsalistoftuples,whereeachtupleisawordprecededbyitslength.
s o r t comparesthefirstelement,length,first,andonlyconsidersthesecondelementtobreakties.Thekeywordargument r e v e r s e = T r u e tells s o r t togoin

decreasingorder. Thesecondlooptraversesthelistoftuplesandbuildsalistofwordsindescendingorderoflength.

Exercise2
Inthisexample,tiesarebrokenbycomparingwords,sowordswiththesamelengthappearinalphabeticalorder.Forotherapplicationsyoumightwantto breaktiesatrandom.Modifythisexamplesothatwordswiththesamelengthappearinrandomorder.Hint:seethe'r a n d o m 'functioninthe'r a n d o m 'module.

Sequencesofsequences
Ihavefocusedonlistsoftuples,butalmostalloftheexamplesinthischapteralsoworkwithlistsoflists,tuplesoftuples,andtuplesoflists.Toavoid enumeratingthepossiblecombinations,itissometimeseasiertotalkaboutsequencesofsequences. Inmanycontexts,thedifferentkindsofsequences(strings,listsandtuples)canbeusedinterchangeably.Sohowandwhydoyouchooseoneovertheothers? Tostartwiththeobvious,stringsaremorelimitedthanothersequencesbecausetheelementshavetobecharacters.Theyarealsoimmutable.Ifyouneed theabilitytochangethecharactersinastring(asopposedtocreatinganewstring),youmightwanttousealistofcharactersinstead. Listsaremorecommonthantuples,mostlybecausetheyaremutable.Butthereareafewcaseswhereyoumightprefertuples: Insomecontexts,likea r e t u r n statement,itissyntacticallysimplertocreateatuplethanalist.Inothercontexts,youmightpreferalist. Ifyouwanttouseasequenceasadictionarykey,youhavetouseanimmutabletypelikeatupleorstring. Ifyouarepassingasequenceasanargumenttoafunction,usingtuplesreducesthepotentialforunexpectedbehaviorduetoaliasing. Becausetuplesareimmutable,theydontprovidemethodslike s o r t and r e v e r s e ,whichmodifyexistinglists.ButPythonprovidesthebuiltinfunctions s o r t e d and r e v e r s e d ,whichtakeanysequenceasaparameterandreturnanewlistwiththesameelementsinadifferentorder.

Debugging
Lists,dictionariesandtuplesareknowngenericallyas datastructuresinthischapterwearestartingtoseecompounddatastructures,likelistsoftuples, anddictionariesthatcontaintuplesaskeysandlistsasvalues.Compounddatastructuresareuseful,buttheyarepronetowhatIcall shapeerrorsthatis, errorscausedwhenadatastructurehasthewrongtype,sizeorcomposition.Forexample,ifyouareexpectingalistwithoneintegerandIgiveyouaplainold integer(notinalist),itwontwork.

Tohelpdebugthesekindsoferrors,Ihavewrittenamodulecalled s t r u c t s h a p e thatprovidesafunction,alsocalled s t r u c t s h a p e ,thattakesanykindofdata en.wikibooks.org/wiki/Think_Python/Print_version

125/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Tohelpdebugthesekindsoferrors,Ihavewrittenamodulecalled s t r u c t s h a p e thatprovidesafunction,alsocalled s t r u c t s h a p e ,thattakesanykindofdata structureasanargumentandreturnsastringthatsummarizesitsshape.Youcandownloaditfrom t h i n k p y t h o n . c o m / c o d e / s t r u c t s h a p e . p y Herestheresultforasimplelist:


> > >f r o ms t r u c t s h a p ei m p o r ts t r u c t s h a p e > > >t=[ 1 , 2 , 3 ] > > >p r i n ts t r u c t s h a p e ( t ) l i s to f3i n t

Afancierprogrammightwritelistof3int s,butitwaseasiernottodealwithplurals.Heresalistoflists:
> > >t 2=[ [ 1 , 2 ] ,[ 3 , 4 ] ,[ 5 , 6 ] ] > > >p r i n ts t r u c t s h a p e ( t 2 ) l i s to f3l i s to f2i n t

Iftheelementsofthelistarenotthesametype, s t r u c t s h a p e groupsthem,inorder,bytype:
> > >t 3=[ 1 ,2 ,3 ,4 . 0 ,' 5 ' ,' 6 ' ,[ 7 ] ,[ 8 ] ,9 ] > > >p r i n ts t r u c t s h a p e ( t 3 ) l i s to f( 3i n t ,f l o a t ,2s t r ,2l i s to fi n t ,i n t )

Heresalistoftuples:
> > >s=' a b c ' > > >l t=z i p ( t ,s ) > > >p r i n ts t r u c t s h a p e ( l t ) l i s to f3t u p l eo f( i n t ,s t r )

Andheresadictionarywith3itemsthatmapintegerstostrings.
> > >d=d i c t ( l t ) > > >p r i n ts t r u c t s h a p e ( d ) d i c to f3i n t > s t r

Ifyouarehavingtroublekeepingtrackofyourdatastructures, s t r u c t s h a p e canhelp.

Glossary
tuple:
en.wikibooks.org/wiki/Think_Python/Print_version 126/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Animmutablesequenceofelements. tupleassignment: Anassignmentwithasequenceontherightsideandatupleofvariablesontheleft.Therightsideisevaluatedandthenitselementsareassignedto thevariablesontheleft. gather: Theoperationofassemblingavariablelengthargumenttuple. scatter: Theoperationoftreatingasequenceasalistofarguments. DSU: Abbreviationofdecoratesortundecorate,apatternthatinvolvesbuildingalistoftuples,sorting,andextractingpartoftheresult. datastructure: Acollectionofrelatedvalues,oftenorganizedinlists,dictionaries,tuples,etc. shape(ofadatastructure): Asummaryofthetype,sizeandcompositionofadatastructure.

Exercises
Exercise3
Writeafunctioncalled m o s t _ f r e q u e n t thattakesastringandprintsthelettersindecreasingorderoffrequency.Findtextsamplesfromseveraldifferent languagesandseehowletterfrequencyvariesbetweenlanguages.Compareyourresultswiththetablesat'w i k i p e d i a . o r g / w i k i / L e t t e r _ f r e q u e n c i e s '.

Exercise4
Moreanagrams! Writeaprogram thatreadsawordlistfromafile(seeSection'9.1')andprintsallthesetsofwordsthatareanagrams. Hereisanexampleofwhattheoutputmightlooklike:
' ' [ ' d e l t a s ' ,' d e s a l t ' ,' l a s t e d ' ,' s a l t e d ' ,' s l a t e d ' ,' s t a l e d ' ] [ ' r e t a i n e r s ' ,' t e r n a r i e s ' ] [ ' g e n e r a t i n g ' ,' g r e a t e n i n g ' ] [ ' r e s m e l t s ' ,' s m e l t e r s ' ,' t e r m l e s s ' ] ' '

Hint:youmightwanttobuildadictionarythatmapsfromasetofletterstoalistofwordsthatcanbespelledwiththoseletters.Thequestionis,howcanyou representthesetoflettersinawaythatcanbeusedasakey? Modifythepreviousprogramsothatitprintsthelargestset


en.wikibooks.org/wiki/Think_Python/Print_version 127/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

ofanagramsfirst,followedbythesecondlargestset,andsoon. InScrabbleabingoiswhenyouplayallseventilesin yourrack,alongwithaletterontheboard,toformaneightletterword.Whatsetof8lettersformsthemostpossiblebingos?Hint:thereareseven. 'Twowordsformametathesispairifyoucantransformone intotheotherbyswappingtwoletters'' 3''forexample,converseandconserve.Writeaprogramthatfindsallofthemetathesispairsinthedictionary.Hint: donttestallpairsofwords,anddonttestallpossibleswaps.''Youcandownloadasolutionfrom'''t h i n k p y t h o n . c o m / c o d e / a n a g r a m _ s e t s . p y '''.'

Exercise5
HeresanotherCarTalkPuzzler4: WhatisthelongestEnglishword,thatremainsavalidEnglishword,asyouremoveitslettersoneatatime? Now,letterscanberemovedfrom eitherend,orthemiddle,butyoucantrearrangeanyoftheletters.Everytimeyoudropaletter,youwindupwithanotherEnglishword.Ifyou dothat,youreeventuallygoingtowindupwithoneletterandthattooisgoingtobeanEnglishwordonethatsfoundinthedictionary.Iwant toknowwhatsthelongestwordandhowmanylettersdoesithave? Imgoingtogiveyoualittlemodestexample:Sprite.Ok?Youstart offwithsprite,youtakealetteroff,onefromtheinterioroftheword,take theraway,andwereleftwiththewordspite,thenwetaketheeofftheend,wereleftwithspit,wetakethesoff,wereleftwithpit,it,andI. Writeaprogramtofindallwordsthatcanbereducedinthisway, andthenfindthelongestone. Thisexerciseisalittlemorechallengingthanmost,soherearesomesuggestions: Youmightwanttowriteafunctionthattakesawordand computesalistofallthewordsthatcanbeformedbyremovingoneletter.Thesearethechildrenoftheword. Recursively,awordisreducibleifanyofitschildren arereducible.Asabasecase,youcanconsidertheemptystringreducible. ThewordlistIprovided,'w o r d s . t x t ',doesnt containsingleletterwords.SoyoumightwanttoaddI,a,andtheemptystring. Toimprovetheperformanceofyourprogram,youmightwant tomemoizethewordsthatareknowntobereducible. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / r e d u c i b l e . p y '.
en.wikibooks.org/wiki/Think_Python/Print_version 128/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

1 InPython3.0, z i p returnsaniteratoroftuples,butformostpurposes,aniteratorbehaveslikealist. 2 ThisbehaviorisslightlydifferentinPython3.0. 3 Thisexerciseisinspiredbyanexampleat p u z z l e r s . o r g . 4


w w w . c a r t a l k . c o m / c o n t e n t / p u z z l e r / t r a n s c r i p t s / 2 0 0 6 5 1

=Casestudy:datastructureselection}}

Wordfrequencyanalysis
Asusual,youshouldatleastattemptthefollowingexercisesbeforeyoureadmysolutions.

Exercise1
Writeaprogramthatreadsafile,breakseachlineintowords,stripswhitespaceandpunctuationfromthewords,andconvertsthemtolowercase. Hint:The's t r i n g 'moduleprovidesstringsnamed'w h i t e s p a c e ', whichcontainsspace,tab,newline,etc.,and'p u n c t u a t i o n 'whichcontainsthepunctuation characters.LetsseeifwecanmakePythonswear:
> > >i m p o r ts t r i n g > > >p r i n ts t r i n g . p u n c t u a t i o n ! " # $ % & ' ( ) * + , . / : ; < = > ? @ [ \ ] ^ _ ` { | } ~

Also,youmightconsiderusingthestringmethods's t r i p ', 'r e p l a c e 'and't r a n s l a t e '.

Exercise2
GotoProjectGutenberg('g u t e n b e r g . o r g ')anddownloadyourfavoriteoutofcopyrightbookinplaintextformat. Modifyyourprogramfromthepreviousexercisetoreadthebookyoudownloaded,skipovertheheaderinformationatthebeginningofthefile,andprocess therestofthewordsasbefore. Thenmodifytheprogramtocountthetotalnumberofwordsinthebook,andthenumberoftimeseachwordisused. Printthenumberofdifferentwordsusedinthebook.Comparedifferentbooksbydifferentauthors,writtenindifferenteras.Whichauthorusesthemost extensivevocabulary?

en.wikibooks.org/wiki/Think_Python/Print_version

129/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise3
Modifytheprogramfromthepreviousexercisetoprintthe20mostfrequentlyusedwordsinthebook.

Exercise4
Modifythepreviousprogramtoreadawordlist(seeSection'9.1')andthenprintallthewordsinthebookthatarenotinthewordlist.Howmanyofthemare typos?Howmanyofthemarecommonwordsthat shouldbeinthewordlist,andhowmanyofthemarereallyobscure?

Randomnumbers
Giventhesameinputs,mostcomputerprogramsgeneratethesameoutputseverytime,sotheyaresaidtobe deterministic.Determinismisusuallyagood thing,sinceweexpectthesamecalculationtoyieldthesameresult.Forsomeapplications,though,wewantthecomputertobeunpredictable.Gamesarean obviousexample,buttherearemore. Makingaprogramtrulynondeterministicturnsouttobenotsoeasy,buttherearewaystomakeitatleastseemnondeterministic.Oneofthemistouse algorithmsthatgenerate pseudorandomnumbers.Pseudorandomnumbersarenottrulyrandombecausetheyaregeneratedbyadeterministiccomputation, butjustbylookingatthenumbersitisallbutimpossibletodistinguishthemfromrandom. The r a n d o m moduleprovidesfunctionsthatgeneratepseudorandomnumbers(whichIwillsimplycallrandomfromhereon). Thefunction r a n d o m returnsarandomfloatbetween0.0and1.0(including0.0butnot1.0).Eachtimeyoucall r a n d o m ,yougetthenextnumberinalongseries. Toseeasample,runthisloop:
i m p o r tr a n d o m f o rii nr a n g e ( 1 0 ) : x=r a n d o m . r a n d o m ( ) p r i n tx

Thefunction r a n d i n t takesparameters l o w and h i g h andreturnsanintegerbetween l o w and h i g h (includingboth).


> > >r a n d o m . r a n d i n t ( 5 ,1 0 ) 5 > > >r a n d o m . r a n d i n t ( 5 ,1 0 ) 9

Tochooseanelementfromasequenceatrandom,youcanuse c h o i c e :
> > >t=[ 1 ,2 ,3 ] > > >r a n d o m . c h o i c e ( t ) 2 > > >r a n d o m . c h o i c e ( t )
en.wikibooks.org/wiki/Think_Python/Print_version 130/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

The r a n d o m modulealsoprovidesfunctionstogeneraterandomvaluesfromcontinuousdistributionsincludingGaussian,exponential,gamma,andafewmore.

Exercise5
Writeafunctionnamed c h o o s e _ f r o m _ h i s t thattakesahistogramasdefinedinSection'11.1'andreturnsarandomvaluefromthehistogram,chosenwith probabilityinproportiontofrequency.Forexample,forthishistogram:
' ' > > >t=[ ' a ' ,' a ' ,' b ' ] > > >h=h i s t o g r a m ( t ) > > >p r i n th { ' a ' :2 ,' b ' :1 } ' '

yourfunctionshould' a 'withprobability'2/3'and b withprobability'1/3'.

Wordhistogram
Hereisaprogramthatreadsafileandbuildsahistogramofthewordsinthefile:
i m p o r ts t r i n g d e fp r o c e s s _ f i l e ( f i l e n a m e ) : h=d i c t ( ) f p=o p e n ( f i l e n a m e ) f o rl i n ei nf p : p r o c e s s _ l i n e ( l i n e ,h ) r e t u r nh d e fp r o c e s s _ l i n e ( l i n e ,h ) : l i n e=l i n e . r e p l a c e ( ' ' ,'' ) f o rw o r di nl i n e . s p l i t ( ) : w o r d=w o r d . s t r i p ( s t r i n g . p u n c t u a t i o n+s t r i n g . w h i t e s p a c e ) w o r d=w o r d . l o w e r ( ) h [ w o r d ]=h . g e t ( w o r d ,0 )+1 h i s t=p r o c e s s _ f i l e ( ' e m m a . t x t ' )

Thisprogramreads e m m a . t x t ,whichcontainsthetextof EmmabyJaneAusten.


p r o c e s s _ f i l e loopsthroughthelinesofthefile,passingthemoneatatimeto p r o c e s s _ l i n e .Thehistogram h isbeingusedasanaccumulator.
en.wikibooks.org/wiki/Think_Python/Print_version 131/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

p r o c e s s _ l i n e usesthestringmethod r e p l a c e toreplacehyphenswithspacesbeforeusing s p l i t tobreakthelineintoalistofstrings.Ittraversesthelistofwords

anduses s t r i p and l o w e r toremovepunctuationandconverttolowercase.(Itisashorthandtosaythatstringsareconvertedrememberthatstringare immutable,somethodslike s t r i p and l o w e r returnnewstrings.) Finally, p r o c e s s _ l i n e updatesthehistogrambycreatinganewitemorincrementinganexistingone. Tocountthetotalnumberofwordsinthefile,wecanaddupthefrequenciesinthehistogram:


d e ft o t a l _ w o r d s ( h ) : r e t u r ns u m ( h . v a l u e s ( ) )

Thenumberofdifferentwordsisjustthenumberofitemsinthedictionary:
d e fd i f f e r e n t _ w o r d s ( h ) : r e t u r nl e n ( h )

Hereissomecodetoprinttheresults:
p r i n t' T o t a ln u m b e ro fw o r d s : ' ,t o t a l _ w o r d s ( h i s t ) p r i n t' N u m b e ro fd i f f e r e n tw o r d s : ' ,d i f f e r e n t _ w o r d s ( h i s t )

Andtheresults:
T o t a ln u m b e ro fw o r d s :1 6 1 0 7 3 N u m b e ro fd i f f e r e n tw o r d s :7 2 1 2

Mostcommonwords
Tofindthemostcommonwords,wecanapplytheDSUpattern m o s t _ c o m m o n takesahistogramandreturnsalistofwordfrequencytuples,sortedinreverse orderbyfrequency:
d e fm o s t _ c o m m o n ( h ) : t=[ ] f o rk e y ,v a l u ei nh . i t e m s ( ) : t . a p p e n d ( ( v a l u e ,k e y ) ) t . s o r t ( r e v e r s e = T r u e ) r e t u r nt

Hereisaloopthatprintsthetenmostcommonwords:
en.wikibooks.org/wiki/Think_Python/Print_version 132/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

t=m o s t _ c o m m o n ( h i s t ) p r i n t' T h em o s tc o m m o nw o r d sa r e : ' f o rf r e q ,w o r di nt [ 0 : 1 0 ] : p r i n tw o r d ,' \ t ' ,f r e q

Andherearetheresultsfrom Emma:
T h em o s tc o m m o nw o r d sa r e : t o 5 2 4 2 t h e 5 2 0 4 a n d 4 8 9 7 o f 4 2 9 3 i 3 1 9 1 a 3 1 3 0 i t 2 5 2 9 h e r 2 4 8 3 w a s 2 4 0 0 s h e 2 3 6 4

Optionalparameters
Wehaveseenbuiltinfunctionsandmethodsthattakeavariablenumberofarguments.Itispossibletowriteuserdefinedfunctionswithoptionalarguments, too.Forexample,hereisafunctionthatprintsthemostcommonwordsinahistogram
d e fp r i n t _ m o s t _ c o m m o n ( h i s t ,n u m = 1 0 ) t=m o s t _ c o m m o n ( h i s t ) p r i n t' T h em o s tc o m m o nw o r d sa r e : ' f o rf r e q ,w o r di nt [ 0 : n u m ] : p r i n tw o r d ,' \ t ' ,f r e q

Thefirstparameterisrequiredthesecondisoptional.The defaultvalueof n u m is10. Ifyouonlyprovideoneargument:


p r i n t _ m o s t _ c o m m o n ( h i s t )
n u m getsthedefaultvalue.Ifyouprovidetwoarguments:

p r i n t _ m o s t _ c o m m o n ( h i s t ,2 0 )
n u m getsthevalueoftheargumentinstead.Inotherwords,theoptionalargument overridesthedefaultvalue.
en.wikibooks.org/wiki/Think_Python/Print_version 133/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Ifafunctionhasbothrequiredandoptionalparameters,alltherequiredparametershavetocomefirst,followedbytheoptionalones.

Dictionarysubtraction
Findingthewordsfromthebookthatarenotinthewordlistfrom w o r d s . t x t isaproblemyoumightrecognizeassetsubtractionthatis,wewanttofindallthe wordsfromoneset(thewordsinthebook)thatarenotinanotherset(thewordsinthelist).
s u b t r a c t takesdictionaries d 1 and d 2 andreturnsanewdictionarythatcontainsallthekeysfrom d 1 thatarenotin d 2 .Sincewedontreallycareaboutthevalues,

wesetthemalltoNone.
d e fs u b t r a c t ( d 1 ,d 2 ) : r e s=d i c t ( ) f o rk e yi nd 1 : i fk e yn o ti nd 2 : r e s [ k e y ]=N o n e r e t u r nr e s

Tofindthewordsinthebookthatarenotin w o r d s . t x t ,wecanuse p r o c e s s _ f i l e tobuildahistogramfor w o r d s . t x t ,andthensubtract:


w o r d s=p r o c e s s _ f i l e ( ' w o r d s . t x t ' ) d i f f=s u b t r a c t ( h i s t ,w o r d s ) p r i n t" T h ew o r d si nt h eb o o kt h a ta r e n ' ti nt h ew o r dl i s ta r e : " f o rw o r di nd i f f . k e y s ( ) : p r i n tw o r d ,

Herearesomeoftheresultsfrom Emma:
T h ew o r d si nt h eb o o kt h a ta r e n ' ti nt h ew o r dl i s ta r e : r e n c o n t r ej a n e ' sb l a n c h ew o o d h o u s e sd i s i n g e n u o u s n e s s f r i e n d ' sv e n i c ea p a r t m e n t. . .

Someofthesewordsarenamesandpossessives.Others,likerencontre,arenolongerincommonuse.Butafewarecommonwordsthatshouldreallybein thelist!

Exercise6
Pythonprovidesadatastructurecalled's e t 'thatprovidesmanycommonsetoperations.Readthedocumentationat'd o c s . p y t h o n . o r g / l i b / t y p e s s e t . h t m l 'andwritea programthatusessetsubtractiontofindwordsinthebookthatarenotinthewordlist.

Randomwords
en.wikibooks.org/wiki/Think_Python/Print_version 134/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Tochoosearandomwordfromthehistogram,thesimplestalgorithmistobuildalistwithmultiplecopiesofeachword,accordingtotheobservedfrequency, andthenchoosefromthelist:
d e fr a n d o m _ w o r d ( h ) : t=[ ] f o rw o r d ,f r e qi nh . i t e m s ( ) : t . e x t e n d ( [ w o r d ]*f r e q ) r e t u r nr a n d o m . c h o i c e ( t )

Theexpression [ w o r d ]*f r e q createsalistwith f r e q copiesofthestring w o r d .The e x t e n d methodissimilarto a p p e n d exceptthattheargumentisasequence.

Exercise7
Thisalgorithmworks,butitisnotveryefficienteachtimeyouchoosearandomword,itrebuildsthelist,whichisasbigastheoriginalbook.Anobvious improvementistobuildthelistonceandthenmakemultipleselections,butthelistisstillbig. Analternativeis: Use'k e y s 'togetalistofthewordsinthebook. Buildalistthatcontainsthecumulativesumoftheword frequencies(seeExercise'10.1').Thelastiteminthislististhetotalnumberofwordsinthebook,'n'. Choosearandomnumberfrom1to'n'.Useabisectionsearch (SeeExercise'10.8')tofindtheindexwheretherandomnumberwouldbeinsertedinthecumulativesum. Usetheindextofindthecorrespondingwordinthewordlist. Writeaprogramthatusesthisalgorithmtochoosearandomwordfromthebook.

Markovanalysis
Ifyouchoosewordsfromthebookatrandom,youcangetasenseofthevocabulary,youprobablywontgetasentence:
t h i st h es m a l lr e g a r dh a r r i e tw h i c hk n i g h t l e y ' si tm o s tt h i n g s

Aseriesofrandomwordsseldommakessensebecausethereisnorelationshipbetweensuccessivewords.Forexample,inarealsentenceyouwouldexpect anarticlelikethetobefollowedbyanadjectiveoranoun,andprobablynotaverboradverb.

OnewaytomeasurethesekindsofrelationshipsisMarkovanalysis,whichcharacterizes,foragivensequenceofwords,theprobabilityofthewordthatcomes en.wikibooks.org/wiki/Think_Python/Print_version 135/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

OnewaytomeasurethesekindsofrelationshipsisMarkovanalysis,whichcharacterizes,foragivensequenceofwords,theprobabilityofthewordthatcomes next.Forexample,thesong Eric,theHalfaBeebegins: Halfabee,philosophically, Must,ipsofacto,halfnotbe. Buthalfthebeehasgottobe Visavis,itsentity.Dyousee? Butcanabeebesaidtobe Ornottobeanentirebee Whenhalfthebeeisnotabee Duetosomeancientinjury? Inthistext,thephrasehalftheisalwaysfollowedbythewordbee,butthephrasethebeemightbefollowedbyeitherhasoris. TheresultofMarkovanalysisisamappingfromeachprefix(likehalftheandthebee)toallpossiblesuffixes(likehasandis). Giventhismapping,youcangeneratearandomtextbystartingwithanyprefixandchoosingatrandomfromthepossiblesuffixes.Next,youcancombinethe endoftheprefixandthenewsuffixtoformthenextprefix,andrepeat. Forexample,ifyoustartwiththeprefixHalfa,thenthenextwordhastobebee,becausetheprefixonlyappearsonceinthetext.Thenextprefixisa bee,sothenextsuffixmightbephilosophically,beordue. Inthisexamplethelengthoftheprefixisalwaystwo,butyoucandoMarkovanalysiswithanyprefixlength.Thelengthoftheprefixiscalledtheorderofthe analysis.

Exercise8
Markovanalysis: WriteaprogramtoreadatextfromafileandperformMarkovanalysis.Theresultshouldbeadictionarythatmapsfromprefixestoacollectionof possiblesuffixes.Thecollectionmightbealist,tuple,ordictionaryitisuptoyoutomakeanappropriatechoice.Youcantestyourprogramwithprefix lengthtwo,butyoushouldwritetheprograminawaythatmakesiteasytotryotherlengths. AddafunctiontothepreviousprogramtogeneraterandomtextbasedontheMarkovanalysis.HereisanexamplefromEmma withprefixlength2: Hewasveryclever,beitsweetnessorbeangry,ashamedoronly amused,atsuchastroke.ShehadneverthoughtofHannahtillyouwerenevermeantforme?""Icannotmakespeeches,Emma:"hesooncut itallhimself. Forthisexample,Ileftthepunctuationattachedtothewords.Theresultisalmostsyntacticallycorrect,butnotquite.Semantically,italmostmakessense, butnotquite. Whathappensifyouincreasetheprefixlength?Doestherandomtextmakemoresense? Onceyourprogramisworking,youmightwanttotryamashup:ifyouanalyzetextfromtwoormorebooks,therandomtextyougeneratewillblend
en.wikibooks.org/wiki/Think_Python/Print_version 136/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

thevocabularyandphrasesfromthesourcesininterestingways.

Datastructures
UsingMarkovanalysistogeneraterandomtextisfun,butthereisalsoapointtothisexercise:datastructureselection.Inyoursolutiontotheprevious exercises,youhadtochoose: Howtorepresenttheprefixes. Howtorepresentthecollectionofpossiblesuffixes. Howtorepresentthemappingfromeachprefixtothecollectionofpossiblesuffixes. Ok,thelastoneistheeasytheonlymappingtypewehaveseenisadictionary,soitisthenaturalchoice. Fortheprefixes,themostobviousoptionsarestring,listofstrings,ortupleofstrings.Forthesuffixes,oneoptionisalistanotherisahistogram(dictionary). Howshouldyouchoose?Thefirststepistothinkabouttheoperationsyouwillneedtoimplementforeachdatastructure.Fortheprefixes,weneedtobeable toremovewordsfromthebeginningandaddtotheend.Forexample,ifthecurrentprefixisHalfa,andthenextwordisbee,youneedtobeabletoform thenextprefix,abee. Yourfirstchoicemightbealist,sinceitiseasytoaddandremoveelements,butwealsoneedtobeabletousetheprefixesaskeysinadictionary,sothat rulesoutlists.Withtuples,youcantappendorremove,butyoucanusetheadditionoperatortoformanewtuple:
d e fs h i f t ( p r e f i x ,w o r d ) : r e t u r np r e f i x [ 1 : ]+( w o r d , )
s h i f t takesatupleofwords, p r e f i x ,andastring, w o r d ,andformsanewtuplethathasallthewordsin p r e f i x exceptthefirst,and w o r d addedtotheend.

Forthecollectionofsuffixes,theoperationsweneedtoperformincludeaddinganewsuffix(orincreasingthefrequencyofanexistingone),andchoosinga randomsuffix. Addinganewsuffixisequallyeasyforthelistimplementationorthehistogram.Choosingarandomelementfromalistiseasychoosingfromahistogramis hardertodoefficiently(seeExercise13.7). Sofarwehavebeentalkingmostlyabouteaseofimplementation,butthereareotherfactorstoconsiderinchoosingdatastructures.Oneisruntime. Sometimesthereisatheoreticalreasontoexpectonedatastructuretobefasterthanotherforexample,Imentionedthatthe i n operatorisfasterfor dictionariesthanforlists,atleastwhenthenumberofelementsislarge. Butoftenyoudontknowaheadoftimewhichimplementationwillbefaster.Oneoptionistoimplementbothofthemandseewhichisbetter.Thisapproach iscalled benchmarking.Apracticalalternativeistochoosethedatastructurethatiseasiesttoimplement,andthenseeifitisfastenoughfortheintended application.Ifso,thereisnoneedtogoon.Ifnot,therearetools,likethe p r o f i l e module,thatcanidentifytheplacesinaprogramthattakethemosttime.

Theotherfactortoconsiderisstoragespace.Forexample,usingahistogramforthecollectionofsuffixesmighttakelessspacebecauseyouonlyhaveto 137/282 en.wikibooks.org/wiki/Think_Python/Print_version

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theotherfactortoconsiderisstoragespace.Forexample,usingahistogramforthecollectionofsuffixesmighttakelessspacebecauseyouonlyhaveto storeeachwordonce,nomatterhowmanytimesitappearsinthetext.Insomecases,savingspacecanalsomakeyourprogramrunfaster,andinthe extreme,yourprogrammightnotrunatallifyourunoutofmemory.Butformanyapplications,spaceisasecondaryconsiderationafterruntime. Onefinalthought:inthisdiscussion,Ihaveimpliedthatweshoulduseonedatastructureforbothanalysisandgeneration.Butsincetheseareseparate phases,itwouldalsobepossibletouseonestructureforanalysisandthenconverttoanotherstructureforgeneration.Thiswouldbeanetwinifthetime savedduringgenerationexceededthetimespentinconversion.

Debugging
Whenyouaredebuggingaprogram,andespeciallyifyouareworkingonahardbug,therearefourthingstotry: reading: Examineyourcode,readitbacktoyourself,andcheckthatitsayswhatyoumeanttosay. running: Experimentbymakingchangesandrunningdifferentversions.Oftenifyoudisplaytherightthingattherightplaceintheprogram,theproblem becomesobvious,butsometimesyouhavetospendsometimetobuildscaffolding. ruminating: Takesometimetothink!Whatkindoferrorisit:syntax,runtime,semantic?Whatinformationcanyougetfromtheerrormessages,orfromtheoutput oftheprogram?Whatkindoferrorcouldcausetheproblemyoureseeing?Whatdidyouchangelast,beforetheproblemappeared? retreating: Atsomepoint,thebestthingtodoisbackoff,undoingrecentchanges,untilyougetbacktoaprogramthatworksandthatyouunderstand.Thenyou canstartingrebuilding. Beginningprogrammerssometimesgetstuckononeoftheseactivitiesandforgettheothers.Eachactivitycomeswithitsownfailuremode. Forexample,readingyourcodemighthelpiftheproblemisatypographicalerror,butnotiftheproblemisaconceptualmisunderstanding.Ifyoudont understandwhatyourprogramdoes,youcanreadit100timesandneverseetheerror,becausetheerrorisinyourhead. Runningexperimentscanhelp,especiallyifyourunsmall,simpletests.Butifyourunexperimentswithoutthinkingorreadingyourcode,youmightfallintoa patternIcallrandomwalkprogramming,whichistheprocessofmakingrandomchangesuntiltheprogramdoestherightthing.Needlesstosay,random walkprogrammingcantakealongtime. Youhavetotaketimetothink.Debuggingislikeanexperimentalscience.Youshouldhaveatleastonehypothesisaboutwhattheproblemis.Iftherearetwo ormorepossibilities,trytothinkofatestthatwouldeliminateoneofthem. Takingabreakhelpswiththethinking.Sodoestalking.Ifyouexplaintheproblemtosomeoneelse(orevenyourself),youwillsometimesfindtheanswer beforeyoufinishaskingthequestion. Buteventhebestdebuggingtechniqueswillfailiftherearetoomanyerrors,orifthecodeyouaretryingtofixistoobigandcomplicated.Sometimesthebest optionistoretreat,simplifyingtheprogramuntilyougettosomethingthatworksandthatyouunderstand.

Beginningprogrammersareoftenreluctanttoretreatbecausetheycantstandtodeletealineofcode(evenifitswrong).Ifitmakesyoufeelbetter,copy 138/282 en.wikibooks.org/wiki/Think_Python/Print_version

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Beginningprogrammersareoftenreluctanttoretreatbecausetheycantstandtodeletealineofcode(evenifitswrong).Ifitmakesyoufeelbetter,copy yourprogramintoanotherfilebeforeyoustartstrippingitdown.Thenyoucanpastethepiecesbackinalittlebitatatime. Findingahardbugrequiresreading,running,ruminating,andsometimesretreating.Ifyougetstuckononeoftheseactivities,trytheothers.

Glossary
deterministic: Pertainingtoaprogramthatdoesthesamethingeachtimeitruns,giventhesameinputs. pseudorandom: Pertainingtoasequenceofnumbersthatappeartoberandom,butaregeneratedbyadeterministicprogram. defaultvalue: Thevaluegiventoanoptionalparameterifnoargumentisprovided. override: Toreplaceadefaultvaluewithanargument. benchmarking: Theprocessofchoosingbetweendatastructuresbyimplementingalternativesandtestingthemonasampleofthepossibleinputs.

Exercises
Exercise9
Therankofawordisitspositioninalistofwordssortedbyfrequency:themostcommonwordhasrank1,thesecondmostcommonhasrank2,etc. Zipfslawdescribesarelationshipbetweentheranksandfrequenciesofwordsinnaturallanguages1.Specifically,itpredictsthatthefrequency,'f',oftheword withrank'r'is:

Writeafunctionnamed'a c k 'thatevaluatesAckermansfunction.Useyourfunctiontoevaluate'a c k ( 3 ,4 ) ',whichshouldbe125.Whathappensforlargervalues of'm 'and'n '?

Exercise6
Apalindromeisawordthatisspelledthesamebackwardandforward,likenoonandredivider.Recursively,awordisapalindromeifthefirstandlast lettersarethesameandthemiddleisapalindrome.
en.wikibooks.org/wiki/Think_Python/Print_version 139/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thefollowingarefunctionsthattakeastringargumentandreturnthefirst,last,andmiddleletters:
d e ff i r s t ( w o r d ) : r e t u r nw o r d [ 0 ] d e fl a s t ( w o r d ) : r e t u r nw o r d [ 1 ] d e fm i d d l e ( w o r d ) : r e t u r nw o r d [ 1 : 1 ]

WellseehowtheyworkinChapter'8'. Typethesefunctionsintoafilenamed'p a l i n d r o m e . p y ' andtestthemout.Whathappensifyoucall'm i d d l e 'withastringwithtwoletters?Oneletter?Whatabouttheemptystring,whichiswritten ' andcontains noletters? Writeafunctioncalled i s _ p a l i n d r o m e thattakes astringargumentandreturns'T r u e 'ifitisapalindromeand'F a l s e 'otherwise.Rememberthatyoucanusethebuiltinfunction'l e n 'tocheckthelengthofa string.

Exercise7
Anumber,'a',isapowerof'b'ifitisdivisibleby'b'and'a/ b'isapowerof'b'.Writeafunctioncalled i s _ p o w e r thattakesparameters'a 'and'b 'andreturns'T r u e ' if'a 'isapowerof'b '.

Exercise8
Thegreatestcommondivisor(GCD)of'a'and'b'isthelargestnumberthatdividesbothofthemwithnoremainder[6]. OnewaytofindtheGCDoftwonumbersisEuclidsalgorithm, whichisbasedontheobservationthatif'r'istheremainderwhen'a'isdividedby'b',then 'gcd(a, b)= gcd(b, r)'.Asabasecase,wecanconsider'gcd(a,0)= a'. Writeafunctioncalled g c d thattakesparameters'a 'and'b 'andreturnstheirgreatestcommondivisor.Ifyouneedhelp,see 'w i k i p e d i a . o r g / w i k i / E u c l i d e a n _ a l g o r i t h m '.

Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.

en.wikibooks.org/wiki/Think_Python/Print_version

140/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Iteration
Multipleassignment
Asyoumayhavediscovered,itislegaltomakemorethanoneassignmenttothesamevariable.Anewassignmentmakesanexistingvariablerefertoanew value(andstopreferringtotheoldvalue).
b r u c e=5 p r i n tb r u c e , b r u c e=7 p r i n tb r u c e

Theoutputofthisprogramis 57 ,becausethefirsttime b r u c e isprinted,itsvalueis5,andthesecondtime,itsvalueis7.Thecommaattheendofthefirst p r i n t statementsuppressesthenewline,whichiswhybothoutputsappearonthesameline. Hereiswhat multipleassignmentlookslikeinastatediagram: <IMGSRC="book010.png"> Withmultipleassignmentitisespeciallyimportanttodistinguishbetweenanassignmentoperationandastatementofequality.BecausePythonusesthe equalsign(= )forassignment,itistemptingtointerpretastatementlike a=b asastatementofequality.Itisnot! First,equalityisasymmetricrelationandassignmentisnot.Forexample,inmathematics,if a=7then7= a.ButinPython,thestatement a=7 islegaland 7=a isnot. Furthermore,inmathematics,astatementofequalityiseithertrueorfalse,foralltime.If a= bnow,then awillalwaysequal b.InPython,anassignment statementcanmaketwovariablesequal,buttheydonthavetostaythatway:
a=5 b=a a=3

#aa n dba r en o we q u a l #aa n dba r en ol o n g e re q u a l

Thethirdlinechangesthevalueof a butdoesnotchangethevalueof b ,sotheyarenolongerequal. Althoughmultipleassignmentisfrequentlyhelpful,youshoulduseitwithcaution.Ifthevaluesofvariableschangefrequently,itcanmakethecodedifficult toreadanddebug.

Updatingvariables
Oneofthemostcommonformsofmultipleassignmentisan update,wherethenewvalueofthevariabledependsontheold.
x=x + 1
en.wikibooks.org/wiki/Think_Python/Print_version 141/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thismeansgetthecurrentvalueof x ,addone,andthenupdate x withthenewvalue. Ifyoutrytoupdateavariablethatdoesntexist,yougetanerror,becausePythonevaluatestherightsidebeforeitassignsavalueto x :


> > >x=x + 1 N a m e E r r o r :n a m e' x 'i sn o td e f i n e d

Beforeyoucanupdateavariable,youhaveto initializeit,usuallywithasimpleassignment:
> > >x=0 > > >x=x + 1

Updatingavariablebyadding1iscalledan incrementsubtracting1iscalleda decrement.

Thew h i l e statement
Computersareoftenusedtoautomaterepetitivetasks.Repeatingidenticalorsimilartaskswithoutmakingerrorsissomethingthatcomputersdowelland peopledopoorly. Wehaveseentwoprograms, c o u n t d o w n and p r i n t _ n ,thatuserecursiontoperformrepetition,whichisalsocalled iteration.Becauseiterationissocommon, Pythonprovidesseverallanguagefeaturestomakeiteasier.Oneisthe f o r statementwesawinSection4.2.Wellgetbacktothatlater. Anotheristhe w h i l e statement.Hereisaversionof c o u n t d o w n thatusesa w h i l e statement:
d e fc o u n t d o w n ( n ) : w h i l en>0 : p r i n tn n=n 1 p r i n t' B l a s t o f f ! '

Youcanalmostreadthe w h i l e statementasifitwereEnglish.Itmeans,While n isgreaterthan0,displaythevalueof n andthenreducethevalueof n by1. Whenyougetto0,displaytheword B l a s t o f f ! Moreformally,hereistheflowofexecutionfora w h i l e statement: Evaluatethecondition,yielding T r u e or F a l s e . Iftheconditionisfalse,exitthe w h i l e statementandcontinueexecutionatthenextstatement. Iftheconditionistrue,executethebodyandthengobacktostep1. Thistypeofflowiscalleda loopbecausethethirdsteploopsbackaroundtothetop.
en.wikibooks.org/wiki/Think_Python/Print_version 142/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thebodyoftheloopshouldchangethevalueofoneormorevariablessothateventuallytheconditionbecomesfalseandtheloopterminates.Otherwisethe loopwillrepeatforever,whichiscalledan infiniteloop.Anendlesssourceofamusementforcomputerscientistsistheobservationthatthedirectionson shampoo,Lather,rinse,repeat,areaninfiniteloop. Inthecaseof c o u n t d o w n ,wecanprovethattheloopterminatesbecauseweknowthatthevalueof n isfinite,andwecanseethatthevalueof n getssmaller eachtimethroughtheloop,soeventuallywehavetogetto0.Inothercases,itisnotsoeasytotell:


d e fs e q u e n c e ( n ) : w h i l en! =1 : p r i n tn , i fn % 2= =0 : n=n / 2 e l s e : n=n * 3 + 1

#ni se v e n #ni so d d

Theconditionforthisloopis n! =1 ,sotheloopwillcontinueuntil n is 1 ,whichmakestheconditionfalse. Eachtimethroughtheloop,theprogramoutputsthevalueof n andthencheckswhetheritisevenorodd.Ifitiseven, n isdividedby2.Ifitisodd,thevalue of n isreplacedwith n * 3 + 1 .Forexample,iftheargumentpassedto s e q u e n c e is3,theresultingsequenceis3,10,5,16,8,4,2,1. Since n sometimesincreasesandsometimesdecreases,thereisnoobviousproofthat n willeverreach1,orthattheprogramterminates.Forsomeparticular valuesof n ,wecanprovetermination.Forexample,ifthestartingvalueisapoweroftwo,thenthevalueof n willbeeveneachtimethroughtheloopuntilit reaches1.Thepreviousexampleendswithsuchasequence,startingwith16. Thehardquestioniswhetherwecanprovethatthisprogramterminatesfor allpositivevaluesof n .Sofar1,noonehasbeenabletoproveit ordisproveit! Exercise1 Rewritethefunction p r i n t _ n fromSection'5.8'usingiterationinsteadofrecursion.

b r e a k
Sometimesyoudontknowitstimetoendaloopuntilyougethalfwaythroughthebody.Inthatcaseyoucanusethe b r e a k statementtojumpoutofthe loop. Forexample,supposeyouwanttotakeinputfromtheuseruntiltheytype d o n e .Youcouldwrite:
w h i l eT r u e : l i n e=r a w _ i n p u t ( ' >' ) i fl i n e= =' d o n e ' : b r e a k p r i n tl i n e p r i n t' D o n e ! '
en.wikibooks.org/wiki/Think_Python/Print_version 143/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theloopconditionis T r u e ,whichisalwaystrue,sothelooprunsuntilithitsthebreakstatement. Eachtimethrough,itpromptstheuserwithananglebracket.Iftheusertypes d o n e ,the b r e a k statementexitstheloop.Otherwisetheprogramechoes whatevertheusertypesandgoesbacktothetopoftheloop.Heresasamplerun:


>n o td o n e n o td o n e >d o n e D o n e !

Thiswayofwriting w h i l e loopsiscommonbecauseyoucanchecktheconditionanywhereintheloop(notjustatthetop)andyoucanexpressthestop conditionaffirmatively(stopwhenthishappens)ratherthannegatively(keepgoinguntilthathappens.).

Squareroots
Loopsareoftenusedinprogramsthatcomputenumericalresultsbystartingwithanapproximateansweranditerativelyimprovingit. Forexample,onewayofcomputingsquarerootsisNewtonsmethod.Supposethatyouwanttoknowthesquarerootof a.Ifyoustartwithalmostany estimate, x,youcancomputeabetterestimatewiththefollowingformula: x+ a/ x 2

y=

Forexample,if ais4and xis3:


> > >a=4 . 0 > > >x=3 . 0 > > >y=( x+a / x )/2 > > >p r i n ty 2 . 1 6 6 6 6 6 6 6 6 6 7

Whichisclosertothecorrectanswer(4=2).Ifwerepeattheprocesswiththenewestimate,itgetsevencloser:
> > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 0 6 4 1 0 2 5 6 4 1

Afterafewmoreupdates,theestimateisalmostexact:

en.wikibooks.org/wiki/Think_Python/Print_version

144/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 0 0 0 1 0 2 4 0 0 3 > > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 0 0 0 0 0 0 0 0 0 3

Ingeneralwedontknowaheadoftimehowmanystepsittakestogettotherightanswer,butweknowwhenwegettherebecausetheestimatestops changing:
> > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 > > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0

When y= =x ,wecanstop.Hereisaloopthatstartswithaninitialestimate, x ,andimprovesituntilitstopschanging:


w h i l eT r u e : p r i n tx y=( x+a / x )/2 i fy= =x : b r e a k x=y

Formostvaluesof a thisworksfine,butingeneralitisdangeroustotest f l o a t equality.Floatingpointvaluesareonlyapproximatelyright:mostrational numbers,like1/3,andirrationalnumbers,like2,cantberepresentedexactlywitha f l o a t . Ratherthancheckingwhether x and y areexactlyequal,itissafertousethebuiltinfunction a b s tocomputetheabsolutevalue,ormagnitude,ofthe differencebetweenthem:


i fa b s ( y x )<e p s i l o n : b r e a k

Where e p s i l o n hasavaluelike 0 . 0 0 0 0 0 0 1 thatdetermineshowcloseiscloseenough. Exercise2


en.wikibooks.org/wiki/Think_Python/Print_version 145/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

' Encapsulatethisloopinafunctioncalled s q u a r e _ r o o t thattakes'a 'asaparameter,choosesareasonablevalueof'x ',andreturnsanestimateofthesquare rootof'a '.

Algorithms
Newtonsmethodisanexampleofan algorithm:itisamechanicalprocessforsolvingacategoryofproblems(inthiscase,computingsquareroots). Itisnoteasytodefineanalgorithm.Itmighthelptostartwithsomethingthatisnotanalgorithm.Whenyoulearnedtomultiplysingledigitnumbers,you probablymemorizedthemultiplicationtable.Ineffect,youmemorized100specificsolutions.Thatkindofknowledgeisnotalgorithmic. Butifyouwerelazy,youprobablycheatedbylearningafewtricks.Forexample,tofindtheproductof nand9,youcanwrite n1asthefirstdigitand10n astheseconddigit.Thistrickisageneralsolutionformultiplyinganysingledigitnumberby9.Thatsanalgorithm! Similarly,thetechniquesyoulearnedforadditionwithcarrying,subtractionwithborrowing,andlongdivisionareallalgorithms.Oneofthecharacteristicsof algorithmsisthattheydonotrequireanyintelligencetocarryout.Theyaremechanicalprocessesinwhicheachstepfollowsfromthelastaccordingtoa simplesetofrules. Inmyopinion,itisembarrassingthathumansspendsomuchtimeinschoollearningtoexecutealgorithmsthat,quiteliterally,requirenointelligence. Ontheotherhand,theprocessofdesigningalgorithmsisinteresting,intellectuallychallenging,andacentralpartofwhatwecallprogramming. Someofthethingsthatpeopledonaturally,withoutdifficultyorconsciousthought,arethehardesttoexpressalgorithmically.Understandingnatural languageisagoodexample.Wealldoit,butsofarnoonehasbeenabletoexplain howwedoit,atleastnotintheformofanalgorithm.

Debugging
Asyoustartwritingbiggerprograms,youmightfindyourselfspendingmoretimedebugging.Morecodemeansmorechancestomakeanerrorandmore placeforbugstohide. Onewaytocutyourdebuggingtimeisdebuggingbybisection.Forexample,ifthereare100linesinyourprogramandyoucheckthemoneatatime,it wouldtake100steps. Instead,trytobreaktheprobleminhalf.Lookatthemiddleoftheprogram,ornearit,foranintermediatevalueyoucancheck.Adda p r i n t statement(or somethingelsethathasaverifiableeffect)andruntheprogram. Ifthemidpointcheckisincorrect,theproblemmustbeinthefirsthalfoftheprogram.Ifitiscorrect,theproblemisinthesecondhalf. Everytimeyouperformachecklikethis,youhalvethenumberoflinesyouhavetosearch.Aftersixsteps(whichismuchlessthan100),youwouldbedown tooneortwolinesofcode,atleastintheory. Inpracticeitisnotalwaysclearwhatthemiddleoftheprogramisandnotalwayspossibletocheckit.Itdoesntmakesensetocountlinesandfindthe exactmidpoint.Instead,thinkaboutplacesintheprogramwheretheremightbeerrorsandplaceswhereitiseasytoputacheck.Thenchooseaspotwhere youthinkthechancesareaboutthesamethatthebugisbeforeorafterthecheck.

Glossary
en.wikibooks.org/wiki/Think_Python/Print_version 146/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

multipleassignment: Makingmorethanoneassignmenttothesamevariableduringtheexecutionofaprogram. update: Anassignmentwherethenewvalueofthevariabledependsontheold. initialize: Anassignmentthatgivesaninitialvaluetoavariablethatwillbeupdated. increment: Anupdatethatincreasesthevalueofavariable(oftenbyone). decrement: Anupdatethatdecreasesthevalueofavariable. iteration: Repeatedexecutionofasetofstatementsusingeitherarecursivefunctioncalloraloop. infiniteloop: Aloopinwhichtheterminatingconditionisneversatisfied.

Exercises
Exercise3
Totestthesquarerootalgorithminthischapter,youcouldcompareitwith'm a t h . s q r t '.Writeafunctionnamed t e s t _ s q u a r e _ r o o t thatprintsatablelikethis:
' ' 1 . 01 . 0 1 . 0 0 . 0 2 . 01 . 4 1 4 2 1 3 5 6 2 3 71 . 4 1 4 2 1 3 5 6 2 3 72 . 2 2 0 4 4 6 0 4 9 2 5 e 1 6 3 . 01 . 7 3 2 0 5 0 8 0 7 5 71 . 7 3 2 0 5 0 8 0 7 5 70 . 0 4 . 02 . 0 2 . 0 0 . 0 5 . 02 . 2 3 6 0 6 7 9 7 7 5 2 . 2 3 6 0 6 7 9 7 7 5 0 . 0 6 . 02 . 4 4 9 4 8 9 7 4 2 7 82 . 4 4 9 4 8 9 7 4 2 7 80 . 0 7 . 02 . 6 4 5 7 5 1 3 1 1 0 62 . 6 4 5 7 5 1 3 1 1 0 60 . 0 8 . 02 . 8 2 8 4 2 7 1 2 4 7 52 . 8 2 8 4 2 7 1 2 4 7 54 . 4 4 0 8 9 2 0 9 8 5 e 1 6 9 . 03 . 0 3 . 0 0 . 0 ' '

Thefirstcolumnisanumber,'a'thesecondcolumnisthesquarerootof'a'computedwiththefunctionfromExercise'7.2'thethirdcolumnisthesquare rootcomputedby'm a t h . s q r t 'thefourthcolumnistheabsolutevalueofthedifferencebetweenthetwoestimates.

Exercise4
Thebuiltinfunction'e v a l 'takesastringandevaluatesitusingthePythoninterpreter.Forexample:

en.wikibooks.org/wiki/Think_Python/Print_version

147/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

' ' > > >e v a l ( ' 1+2*3 ' ) 7 > > >i m p o r tm a t h > > >e v a l ( ' m a t h . s q r t ( 5 ) ' ) 2 . 2 3 6 0 6 7 9 7 7 4 9 9 7 8 9 8 > > >e v a l ( ' t y p e ( m a t h . p i ) ' ) < t y p e' f l o a t ' > ' '

Writeafunctioncalled e v a l _ l o o p thatiterativelypromptstheuser,takestheresultinginputandevaluatesitusing'e v a l ',andprintstheresult. Itshouldcontinueuntiltheuserenters d o n e ,andthenreturnthevalueofthelastexpressionitevaluated.

Exercise5
ThebrilliantmathematicianSrinivasaRamanujanfoundaninfiniteseries2thatcanbeusedtogenerateanumericalapproximationof :

Writeafunctioncalled e s t i m a t e _ p i thatusesthisformulatocomputeandreturnanestimateof''.Itshouldusea'w h i l e 'looptocomputetermsofthe summationuntilthelasttermissmallerthan'1 e 1 5 '(whichisPythonnotationfor'1015). Youcanchecktheresultbycomparingitto'm a t h . p i '. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / p i . p y '. f=crs where's'and'c'areparametersthatdependonthelanguageandthetext.Ifyoutakethelogarithmofbothsidesofthisequation,youget: log'f='log'cs'log'r Soifyouplot'log'f ' versus'log'r',youshouldgetastraightlinewithslope''s' andintercept'log'c'. Writeaprogramthatreadsatextfromafile,countswordfrequencies,andprintsonelineforeachword,indescendingorderoffrequency,with'log'f ' and 'log'r'.Usethegraphingprogramofyourchoicetoplottheresultsandcheckwhethertheyformastraightline.Canyouestimatethevalueof's'?

Notes
1 See w i k i p e d i a . o r g / w i k i / Z i p f ' s _ l a w
en.wikibooks.org/wiki/Think_Python/Print_version 148/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Files
Persistence
Mostoftheprogramswehaveseensofararetransientinthesensethattheyrunforashorttimeandproducesomeoutput,butwhentheyend,theirdata disappears.Ifyouruntheprogramagain,itstartswithacleanslate. Otherprogramsare persistent:theyrunforalongtime(orallthetime)theykeepatleastsomeoftheirdatainpermanentstorage(aharddrive,for example)andiftheyshutdownandrestart,theypickupwheretheyleftoff. Examplesofpersistentprogramsareoperatingsystems,whichrunprettymuchwheneveracomputerison,andwebservers,whichrunallthetime,waitingfor requeststocomeinonthenetwork. Oneofthesimplestwaysforprogramstomaintaintheirdataisbyreadingandwritingtextfiles.Wehavealreadyseenprogramsthatreadtextfilesinthis chapterswewillseeprogramsthatwritethem. Analternativeistostorethestateoftheprograminadatabase.InthischapterIwillpresentasimpledatabaseandamodule, p i c k l e ,thatmakesiteasyto storeprogramdata.

Readingandwriting
Atextfileisasequenceofcharactersstoredonapermanentmediumlikeaharddrive,flashmemory,orCDROM.Wesawhowtoopenandreadafilein Section9.1. Towriteafile,youhavetoopenitwithmode ' w ' asasecondparameter:
> > >f o u t=o p e n ( ' o u t p u t . t x t ' ,' w ' ) > > >p r i n tf o u t < o p e nf i l e' o u t p u t . t x t ' ,m o d e' w 'a t0 x b 7 e b 2 4 1 0 >

Ifthefilealreadyexists,openingitinwritemodeclearsouttheolddataandstartsfresh,sobecareful!Ifthefiledoesntexist,anewoneiscreated. The w r i t e methodputsdataintothefile.


> > >l i n e 1=" T h i sh e r e ' st h ew a t t l e , \ n " > > >f o u t . w r i t e ( l i n e 1 )

Again,thefileobjectkeepstrackofwhereitis,soifyoucall w r i t e again,itaddsthenewdatatotheend.
> > >l i n e 2=" t h ee m b l e mo fo u rl a n d . \ n " > > >f o u t . w r i t e ( l i n e 2 )
en.wikibooks.org/wiki/Think_Python/Print_version 149/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Whenyouaredonewriting,youhavetoclosethefile.
> > >f o u t . c l o s e ( )

Formatoperator
Theargumentof w r i t e hastobeastring,soifwewanttoputothervaluesinafile,wehavetoconvertthemtostrings.Theeasiestwaytodothatiswith s t r :
> > >x=5 2 > > >f . w r i t e ( s t r ( x ) )

Analternativeistousethe formatoperator, % .Whenappliedtointegers, % isthemodulusoperator.Butwhenthefirstoperandisastring, % istheformat operator. Thefirstoperandisthe formatstring,andthesecondoperandisatupleofexpressions.Theresultisastringthatcontainsthevaluesoftheexpressions, formattedaccordingtotheformatstring. Asanexample,the formatsequence ' % d ' meansthatthefirstexpressioninthetupleshouldbeformattedasaninteger(d standsfordecimal):
> > >c a m e l s=4 2 > > >' % d '%c a m e l s ' 4 2 '

Theresultisthestring ' 4 2 ' ,whichisnottobeconfusedwiththeintegervalue 4 2 . Aformatsequencecanappearanywhereintheformatstring,soyoucanembedavalueinasentence:


> > >c a m e l s=4 2 > > >' Ih a v es p o t t e d% dc a m e l s . '%c a m e l s ' Ih a v es p o t t e d4 2c a m e l s . '

Theformatsequence ' % g ' formatsthenextelementinthetupleasafloatingpointnumber(dontaskwhy),and ' % s ' formatsthenextitemasastring:


> > >' I n% dy e a r sIh a v es p o t t e d% g% s . '%( 3 ,0 . 1 ,' c a m e l s ' ) ' I n3y e a r sIh a v es p o t t e d0 . 1c a m e l s . '

Thenumberofelementsinthetuplehastomatchthenumberofformatsequencesinthestring.Also,thetypesoftheelementshavetomatchtheformat sequences:

en.wikibooks.org/wiki/Think_Python/Print_version

150/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >' % d% d% d '%( 1 ,2 ) T y p e E r r o r :n o te n o u g ha r g u m e n t sf o rf o r m a ts t r i n g > > >' % d '%' d o l l a r s ' T y p e E r r o r :i l l e g a la r g u m e n tt y p ef o rb u i l t i no p e r a t i o n

Inthefirstexample,therearentenoughelementsinthesecond,theelementisthewrongtype. Theformatoperatorispowerfulbutdifficulttouse.Youcanreadmoreaboutitat d o c s . p y t h o n . o r g / l i b / t y p e s s e q s t r i n g s . h t m l .

Filenamesandpaths
Filesareorganizedinto directories(alsocalledfolders).Everyrunningprogramhasacurrentdirectory,whichisthedefaultdirectoryformostoperations. Forexample,whenyouopenafileforreading,Pythonlooksforitinthecurrentdirectory. The o s moduleprovidesfunctionsforworkingwithfilesanddirectories(osstandsforoperatingsystem). o s . g e t c w d returnsthenameofthecurrentdirectory:
> > >i m p o r to s > > >c w d=o s . g e t c w d ( ) > > >p r i n tc w d / h o m e / d i n s d a l e
c w d standsforcurrentworkingdirectory.Theresultinthisexampleis / h o m e / d i n s d a l e ,whichisthehomedirectoryofausernamed d i n s d a l e .

Astringlike c w d thatidentifiesafileiscalleda path.A relativepathstartsfromthecurrentdirectoryan absolutepathstartsfromthetopmostdirectoryin thefilesystem. Thepathswehaveseensofararesimplefilenames,sotheyarerelativetothecurrentdirectory.Tofindtheabsolutepathtoafile,youcanuse o s . p a t h . a b s p a t h :


> > >o s . p a t h . a b s p a t h ( ' m e m o . t x t ' ) ' / h o m e / d i n s d a l e / m e m o . t x t '
o s . p a t h . e x i s t s checkswhetherafileordirectoryexists:

> > >o s . p a t h . e x i s t s ( ' m e m o . t x t ' ) T r u e

Ifitexists, o s . p a t h . i s d i r checkswhetheritsadirectory:
> > >o s . p a t h . i s d i r ( ' m e m o . t x t ' ) F a l s e > > >o s . p a t h . i s d i r ( ' m u s i c ' )
en.wikibooks.org/wiki/Think_Python/Print_version 151/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

T r u e

Similarly, o s . p a t h . i s f i l e checkswhetheritsafile.
o s . l i s t d i r returnsalistofthefiles(andotherdirectories)inthegivendirectory:

> > >o s . l i s t d i r ( c w d ) [ ' m u s i c ' ,' p h o t o s ' ,' m e m o . t x t ' ]

Todemonstratethesefunctions,thefollowingexamplewalksthroughadirectory,printsthenamesofallthefiles,andcallsitselfrecursivelyonallthe directories.
d e fw a l k ( d i r ) : f o rn a m ei no s . l i s t d i r ( d i r ) : p a t h=o s . p a t h . j o i n ( d i r ,n a m e ) i fo s . p a t h . i s f i l e ( p a t h ) : p r i n tp a t h e l s e : w a l k ( p a t h )
o s . p a t h . j o i n takesadirectoryandafilenameandjoinsthemintoacompletepath.

Exercise1
Modify'w a l k 'sothatinsteadofprintingthenamesofthefiles,itreturnsalistofnames. Exercise2 The'o s 'moduleprovidesafunctioncalled'w a l k 'thatissimilartothisonebutmoreversatile.Readthedocumentationanduseittoprintthenamesofthefiles inagivendirectoryanditssubdirectories.

Catchingexceptions
Alotofthingscangowrongwhenyoutrytoreadandwritefiles.Ifyoutrytoopenafilethatdoesntexist,yougetan I O E r r o r :
> > >f i n=o p e n ( ' b a d _ f i l e ' ) I O E r r o r :[ E r r n o2 ]N os u c hf i l eo rd i r e c t o r y :' b a d _ f i l e '

Ifyoudonthavepermissiontoaccessafile:

en.wikibooks.org/wiki/Think_Python/Print_version

152/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >f o u t=o p e n ( ' / e t c / p a s s w d ' ,' w ' ) I O E r r o r :[ E r r n o1 3 ]P e r m i s s i o nd e n i e d :' / e t c / p a s s w d '

Andifyoutrytoopenadirectoryforreading,youget
> > >f i n=o p e n ( ' / h o m e ' ) I O E r r o r :[ E r r n o2 1 ]I sad i r e c t o r y

Toavoidtheseerrors,youcouldusefunctionslike o s . p a t h . e x i s t s and o s . p a t h . i s f i l e ,butitwouldtakealotoftimeandcodetocheckallthepossibilities(ifE r r n o 2 1 isanyindication,thereareatleast21thingsthatcangowrong). Itisbettertogoaheadandtry,anddealwithproblemsiftheyhappen,whichisexactlywhatthe t r y statementdoes.Thesyntaxissimilartoan i f statement:


t r y : f i n=o p e n ( ' b a d _ f i l e ' ) f o rl i n ei nf i n : p r i n tl i n e f i n . c l o s e ( ) e x c e p t : p r i n t' S o m e t h i n gw e n tw r o n g . '

Pythonstartsbyexecutingthe t r y clause.Ifallgoeswell,itskipsthe e x c e p t clauseandproceeds.Ifanexceptionoccurs,itjumpsoutofthe t r y clauseand executesthe e x c e p t clause. Handlinganexceptionwitha t r y statementiscalled catchinganexception.Inthisexample,the e x c e p t clauseprintsanerrormessagethatisnotveryhelpful. Ingeneral,catchinganexceptiongivesyouachancetofixtheproblem,ortryagain,oratleastendtheprogramgracefully.

Databases
A databaseisafilethatisorganizedforstoringdata.Mostdatabasesareorganizedlikeadictionaryinthesensethattheymapfromkeystovalues.The biggestdifferenceisthatthedatabaseisondisk(orotherpermanentstorage),soitpersistsaftertheprogramends. Themodule a n y d b m providesaninterfaceforcreatingandupdatingdatabasefiles.Asanexample,Illcreateadatabasethatcontainscaptionsforimagefiles. Openingadatabaseissimilartoopeningotherfiles:
> > >i m p o r ta n y d b m > > >d b=a n y d b m . o p e n ( ' c a p t i o n s . d b ' ,' c ' )

Themode ' c ' meansthatthedatabaseshouldbecreatedifitdoesntalreadyexist.Theresultisadatabaseobjectthatcanbeused(formostoperations)like adictionary.Ifyoucreateanewitem, a n y d b m updatesthedatabasefile.


en.wikibooks.org/wiki/Think_Python/Print_version 153/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >d b [ ' c l e e s e . p n g ' ]=' P h o t oo fJ o h nC l e e s e . '

Whenyouaccessoneoftheitems, a n y d b m readsthefile:
> > >p r i n td b [ ' c l e e s e . p n g ' ] P h o t oo fJ o h nC l e e s e .

Ifyoumakeanotherassignmenttoanexistingkey, a n y d b m replacestheoldvalue:
> > >d b [ ' c l e e s e . p n g ' ]=' P h o t oo fJ o h nC l e e s ed o i n gas i l l yw a l k . ' > > >p r i n td b [ ' c l e e s e . p n g ' ] P h o t oo fJ o h nC l e e s ed o i n gas i l l yw a l k .

Manydictionarymethods,like k e y s and i t e m s ,alsoworkwithdatabaseobjects.Sodoesiterationwitha f o r statement.


f o rk e yi nd b : p r i n tk e y

Aswithotherfiles,youshouldclosethedatabasewhenyouaredone:
> > >d b . c l o s e ( )

Pickling
Alimitationof a n y d b m isthatthekeysandvalueshavetobestrings.Ifyoutrytouseanyothertype,yougetanerror. The p i c k l e modulecanhelp.Ittranslatesalmostanytypeofobjectintoastringsuitableforstorageinadatabase,andthentranslatesstringsbackintoobjects.
p i c k l e . d u m p s takesanobjectasaparameterandreturnsastringrepresentation(d u m p s isshortfordumpstring):

> > >i m p o r tp i c k l e > > >t=[ 1 ,2 ,3 ] > > >p i c k l e . d u m p s ( t ) ' ( l p 0 \ n I 1 \ n a I 2 \ n a I 3 \ n a . '

Theformatisntobvioustohumanreadersitismeanttobeeasyfor p i c k l e tointerpret. p i c k l e . l o a d s (loadstring)reconstitutestheobject:


> > >t 1=[ 1 ,2 ,3 ]
en.wikibooks.org/wiki/Think_Python/Print_version 154/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >s=p i c k l e . d u m p s ( t 1 ) > > >t 2=p i c k l e . l o a d s ( s ) > > >p r i n tt 2 [ 1 ,2 ,3 ]

Althoughthenewobjecthasthesamevalueastheold,itisnot(ingeneral)thesameobject:
> > >t= =t 2 T r u e > > >ti st 2 F a l s e

Inotherwords,picklingandthenunpicklinghasthesameeffectascopyingtheobject. Youcanuse p i c k l e tostorenonstringsinadatabase.Infact,thiscombinationissocommonthatithasbeenencapsulatedinamodulecalled s h e l v e . Exercise3 IfyoudidExercise'12.4',modifyyoursolutionsothat itcreatesadatabasethatmapsfromeachwordinthelisttoalistofwordsthatusethesamesetof letters. Writeadifferentprogramthatopensthedatabaseandprintsthecontentsinahumanreadableformat.

Pipes
Mostoperatingsystemsprovideacommandlineinterface,alsoknownasa shell .Shellsusuallyprovidecommandstonavigatethefilesystemandlaunch applications.Forexample,inUnix,youcanchangedirectorieswith c d ,displaythecontentsofadirectorywith l s ,andlaunchawebbrowserbytyping(for example) f i r e f o x . AnyprogramthatyoucanlaunchfromtheshellcanalsobelaunchedfromPythonusinga pipe.Apipeisanobjectthatrepresentsarunningprocess. Forexample,theUnixcommand l sl normallydisplaysthecontentsofthecurrentdirectory(inlongformat).Youcanlaunch l s with o s . p o p e n :
> > >c m d=' l sl ' > > >f p=o s . p o p e n ( c m d )

Theargumentisastringthatcontainsashellcommand.Thereturnvalueisafilepointerthatbehavesjustlikeanopenfile.Youcanreadtheoutputfromthe l s processonelineatatimewith r e a d l i n e orgetthewholethingatoncewith r e a d :


> > >r e s=f p . r e a d ( )

Whenyouaredone,youclosethepipelikeafile:
en.wikibooks.org/wiki/Think_Python/Print_version 155/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >s t a t=f p . c l o s e ( ) > > >p r i n ts t a t N o n e

Thereturnvalueisthefinalstatusofthe l s process N o n e meansthatitendednormally(withnoerrors). Acommonuseofpipesistoreadacompressedfileincrementallythatis,withoutuncompressingthewholethingatonce.Thefollowingfunctiontakesthe nameofacompressedfileasaparameterandreturnsapipethatuses g z i p todecompressthecontents:


d e fo p e n _ g z i p ( f i l e n a m e ) : c m d=' g u n z i pc'+f i l e n a m e f p=o s . p o p e n ( c m d ) r e t u r nf p

Ifyoureadlinesfrom f p oneatatime,youneverhavetostoretheuncompressedfileinmemoryorondisk.

Writingmodules
AnyfilethatcontainsPythoncodecanbeimportedasamodule.Forexample,supposeyouhaveafilenamed w c . p y withthefollowingcode:
d e fl i n e c o u n t ( f i l e n a m e ) : c o u n t=0 f o rl i n ei no p e n ( f i l e n a m e ) : c o u n t+ =1 r e t u r nc o u n t p r i n tl i n e c o u n t ( ' w c . p y ' )

Ifyourunthisprogram,itreadsitselfandprintsthenumberoflinesinthefile,whichis7.Youcanalsoimportitlikethis:
> > >i m p o r tw c 7

Nowyouhaveamoduleobject w c :
> > >p r i n tw c < m o d u l e' w c 'f r o m' w c . p y ' >

Thatprovidesafunctioncalled l i n e c o u n t :

en.wikibooks.org/wiki/Think_Python/Print_version

156/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >w c . l i n e c o u n t ( ' w c . p y ' ) 7

SothatshowyouwritemodulesinPython. Theonlyproblemwiththisexampleisthatwhenyouimportthemoduleitexecutesthetestcodeatthebottom.Normallywhenyouimportamodule,it definesnewfunctionsbutitdoesntexecutethem. Programsthatwillbeimportedasmodulesoftenusethefollowingidiom:


i f_ _ n a m e _ _= =' _ _ m a i n _ _ ' : p r i n tl i n e c o u n t ( ' w c . p y ' )
_ _ n a m e _ _ isabuiltinvariablethatissetwhentheprogramstarts.Iftheprogramisrunningasascript, _ _ n a m e _ _ hasthevalue _ _ m a i n _ _ inthatcase,thetestcode

isexecuted.Otherwise,ifthemoduleisbeingimported,thetestcodeisskipped. Exercise4 Typethisexampleintoafilenamed'w c . p y 'andrunitasascript.ThenrunthePythoninterpreterand'i m p o r tw c '.Whatisthevalueof _ _ n a m e _ _ whenthemodule isbeingimported? Warning:Ifyouimportamodulethathasalreadybeenimported, Pythondoesnothing.Itdoesnotrereadthefile,evenifithaschanged. Ifyouwanttoreloadamodule,youcanusethebuiltinfunction'r e l o a d ',butitcanbetricky,sothesafestthingtodoisrestarttheinterpreterandthenimport themoduleagain.

Debugging
Whenyouarereadingandwritingfiles,youmightrunintoproblemswithwhitespace.Theseerrorscanbehardtodebugbecausespaces,tabsandnewlines arenormallyinvisible:
> > >s=' 12 \ t3 \ n4 ' > > >p r i n ts 12 3 4

Thebuiltinfunction r e p r canhelp.Ittakesanyobjectasanargumentandreturnsastringrepresentationoftheobject.Forstrings,itrepresentswhitespace characterswithbackslashsequences:


> > >p r i n tr e p r ( s ) ' 12 \ t3 \ n4 '

Thiscanbehelpfulfordebugging.
en.wikibooks.org/wiki/Think_Python/Print_version 157/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Oneotherproblemyoumightrunintoisthatdifferentsystemsusedifferentcharacterstoindicatetheendofaline.Somesystemsuseanewline,represented \ n .Othersuseareturncharacter,represented \ r .Someuseboth.Ifyoumovefilesbetweendifferentsystems,theseinconsistenciesmightcauseproblems. Formostsystems,thereareapplicationstoconvertfromoneformattoanother.Youcanfindthem(andreadmoreaboutthisissue)at w i k i p e d i a . o r g / w i k i / N e w l i n e . Or,ofcourse,youcouldwriteoneyourself.

Glossary
persistent: Pertainingtoaprogramthatrunsindefinitelyandkeepsatleastsomeofitsdatainpermanentstorage. formatoperator: Anoperator, % ,thattakesaformatstringandatupleandgeneratesastringthatincludestheelementsofthetupleformattedasspecifiedbytheformat string. formatstring: Astring,usedwiththeformatoperator,thatcontainsformatsequences. formatsequence: Asequenceofcharactersinaformatstring,like % d ,thatspecifieshowavalueshouldbeformatted. textfile: Asequenceofcharactersstoredinpermanentstoragelikeaharddrive. directory: Anamedcollectionoffiles,alsocalledafolder. path: Astringthatidentifiesafile. relativepath: Apaththatstartsfromthecurrentdirectory. absolutepath: Apaththatstartsfromthetopmostdirectoryinthefilesystem. catch: Topreventanexceptionfromterminatingaprogramusingthe t r y and e x c e p t statements. database: Afilewhosecontentsareorganizedlikeadictionarywithkeysthatcorrespondtovalues.

Exercises
Exercise5 The'u r l l i b 'moduleprovidesmethodsformanipulatingURLsanddownloadinginformationfromtheweb.Thefollowingexampledownloadsandprintsasecret messagefrom't h i n k p y t h o n . c o m ':
en.wikibooks.org/wiki/Think_Python/Print_version 158/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

i m p o r tu r l l i b c o n n=u r l l i b . u r l o p e n ( ' h t t p : / / t h i n k p y t h o n . c o m / s e c r e t . h t m l ' ) f o rl i n ei nc o n n . f p : p r i n tl i n e . s t r i p ( )

Runthiscodeandfollowtheinstructionsyouseethere. Exercise6 InalargecollectionofMP3files,theremaybemorethanonecopyofthesamesong,storedindifferentdirectoriesorwithdifferentfilenames.Thegoalof thisexerciseistosearchfortheseduplicates. Writeaprogramthatsearchesadirectoryandallofits subdirectories,recursively,andreturnsalistofcompletepathsforallfileswithagivensuffix(like'. m p 3 ').Hint:'o s . p a t h 'providesseveralusefulfunctionsfor manipulatingfileandpathnames. Torecognizeduplicates,youcanuseahashfunctionthat readsthefileandgeneratesashortsummaryofthecontents.Forexample,MD5(MessageDigestalgorithm5)takesanarbitrarilylongmessageandreturns a128bitchecksum.Theprobabilityisverysmallthattwofileswithdifferentcontentswillreturnthesamechecksum. YoucanreadaboutMD5at 'w i k i p e d i a . o r g / w i k i / M d 5 '.OnaUnixsystemyoucanusetheprogram'm d 5 s u m 'andapipetocomputechecksumsfromPython. Exercise7 ' TheInternetMovieDatabase(IMDb)isanonlinecollectionof informationaboutmovies.Theirdatabaseisavailableinplaintextformat,soitisreasonably easytoreadfromPython.Forthisexercise,thefilesyouneedare'a c t o r s . l i s t . g z 'and'a c t r e s s e s . l i s t . g z 'youcandownloadthemfrom 'w w w . i m d b . c o m / i n t e r f a c e s # p l a i n '. ' Ihavewrittenaprogramthatparsesthesefilesandsplitsthemintoactornames,movietitles,etc.Youcandownloaditfrom't h i n k p y t h o n . c o m / c o d e / i m d b . p y '. Ifyourun'i m d b . p y 'asascript,itreads'a c t o r s . l i s t . g z 'andprintsoneactormoviepairperline.Or,ifyou'i m p o r t i m d b ' youcanusethefunction p r o c e s s _ f i l e to, well, processthefile.Theargumentsareafilename,afunctionobjectandanoptionalnumberoflinestoprocess.Hereisanexample:
' ' i m p o r ti m d b d e fp r i n t _ i n f o ( a c t o r ,d a t e ,t i t l e ,r o l e ) : p r i n ta c t o r ,d a t e ,t i t l e ,r o l e i m d b . p r o c e s s _ f i l e ( ' a c t o r s . l i s t . g z ' ,p r i n t _ i n f o )
en.wikibooks.org/wiki/Think_Python/Print_version 159/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

' '

Whenyoucall p r o c e s s _ f i l e ,itopens'f i l e n a m e ',readsthecontents,andcalls p r i n t _ i n f o onceforeachlineinthefile. p r i n t _ i n f o takesanactor,date,movietitleand roleasargumentsandprintsthem. Writeaprogramthatreads'a c t o r s . l i s t . g z 'and'a c t r e s s e s . l i s t . g z 'anduses's h e l v e 'tobuildadatabase thatmapsfromeachactortoalistofhisorherfilms. Twoactorsarecostarsiftheyhavebeeninatleastone movietogether.Processthedatabaseyoubuiltinthepreviousstepandbuildaseconddatabasethatmapsfromeachactortoalistofhisorhercostars. WriteaprogramthatcanplaytheSixDegreesofKevin Bacon,whichyoucanreadaboutat'w i k i p e d i a . o r g / w i k i / S i x _ D e g r e e s _ o f _ K e v i n _ B a c o n '.Thisproblemischallengingbecauseitrequiresyoutofindtheshortestpathin agraph.Youcanreadaboutshortestpathalgorithmsat'w i k i p e d i a . o r g / w i k i / S h o r t e s t _ p a t h _ p r o b l e m '.

Classesandobjects
Userdefinedtypes
WehaveusedmanyofPythonsbuiltintypesnowwearegoingtodefineanewtype.Asanexample,wewillcreateatypecalled P o i n t thatrepresentsapoint intwodimensionalspace. Inmathematicalnotation,pointsareoftenwritteninparentheseswithacommaseparatingthecoordinates.Forexample,(0,0)representstheorigin,and(x, y)representsthepoint xunitstotherightand yunitsupfromtheorigin. ThereareseveralwayswemightrepresentpointsinPython: Wecouldstorethecoordinatesseparatelyintwovariables, x and y . Wecouldstorethecoordinatesaselementsinalistortuple. Wecouldcreateanewtypetorepresentpointsasobjects. Creatinganewtypeis(alittle)morecomplicatedthantheotheroptions,butithasadvantagesthatwillbeapparentsoon. Auserdefinedtypeisalsocalleda class.Aclassdefinitionlookslikethis:
c l a s sP o i n t ( o b j e c t ) : " " " r e p r e s e n t sap o i n ti n2 Ds p a c e " " "

Thisheaderindicatesthatthenewclassisa P o i n t ,whichisakindof o b j e c t ,whichisabuiltintype.


en.wikibooks.org/wiki/Think_Python/Print_version 160/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thebodyisadocstringthatexplainswhattheclassisfor.Youcandefinevariablesandfunctionsinsideaclassdefinition,butwewillgetbacktothatlater. Definingaclassnamed P o i n t createsaclassobject.


> > >p r i n tP o i n t < c l a s s' _ _ m a i n _ _ . P o i n t ' >

Because P o i n t isdefinedatthetoplevel,itsfullnameis _ _ m a i n _ _ . P o i n t . Theclassobjectislikeafactoryforcreatingobjects.TocreateaPoint,youcall P o i n t asifitwereafunction.


> > >b l a n k=P o i n t ( ) > > >p r i n tb l a n k < _ _ m a i n _ _ . P o i n ti n s t a n c ea t0 x b 7 e 9 d 3 a c >

ThereturnvalueisareferencetoaPointobject,whichweassignto b l a n k .Creatinganewobjectiscalled instantiation,andtheobjectisan instanceofthe class. Whenyouprintaninstance,Pythontellsyouwhatclassitbelongstoandwhereitisstoredinmemory(theprefix 0 x meansthatthefollowingnumberisin hexadecimal).

Attributes
Youcanassignvaluestoaninstanceusingdotnotation:
> > >b l a n k . x=3 . 0 > > >b l a n k . y=4 . 0

Thissyntaxissimilartothesyntaxforselectingavariablefromamodule,suchas m a t h . p i or s t r i n g . w h i t e s p a c e .Inthiscase,though,weareassigningvaluesto namedelementsofanobject.Theseelementsarecalled attributes. Asanoun,ATtributeispronouncedwithemphasisonthefirstsyllable,asopposedtoaTRIBute,whichisaverb. Thefollowingdiagramshowstheresultoftheseassignments.Astatediagramthatshowsanobjectanditsattributesiscalledan objectdiagram: <IMGSRC="book022.png"> Thevariable b l a n k referstoaPointobject,whichcontainstwoattributes.Eachattributereferstoafloatingpointnumber. Youcanreadthevalueofanattributeusingthesamesyntax:
> > >p r i n tb l a n k . y
en.wikibooks.org/wiki/Think_Python/Print_version 161/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

4 . 0 > > >x=b l a n k . x > > >p r i n tx 3 . 0

Theexpression b l a n k . x means,Gototheobject b l a n k referstoandgetthevalueof x .Inthiscase,weassignthatvaluetoavariablenamed x .Thereisno conflictbetweenthevariable x andtheattribute x . Youcanusedotnotationaspartofanyexpression.Forexample:


> > >p r i n t' ( % g ,% g ) '%( b l a n k . x ,b l a n k . y ) ( 3 . 0 ,4 . 0 ) > > >d i s t a n c e=m a t h . s q r t ( b l a n k . x * * 2+b l a n k . y * * 2 ) > > >p r i n td i s t a n c e 5 . 0

Youcanpassaninstanceasanargumentintheusualway.Forexample:
d e fp r i n t _ p o i n t ( p ) : p r i n t' ( % g ,% g ) '%( p . x ,p . y )
p r i n t _ p o i n t takesapointasanargumentanddisplaysitinmathematicalnotation.Toinvokeit,youcanpass b l a n k asanargument:

> > >p r i n t _ p o i n t ( b l a n k ) ( 3 . 0 ,4 . 0 )

Insidethefunction, p isanaliasfor b l a n k ,soifthefunctionmodifies p , b l a n k changes.

Exercise1
Writeafunctioncalled'd i s t a n c e 'thatittakestwoPointsasargumentsandreturnsthedistancebetweenthem.

Rectangles
Sometimesitisobviouswhattheattributesofanobjectshouldbe,butothertimesyouhavetomakedecisions.Forexample,imagineyouaredesigninga classtorepresentrectangles.Whatattributeswouldyouusetospecifythelocationandsizeofarectangle?Youcanignoreangletokeepthingssimple, assumethattherectangleiseitherverticalorhorizontal. Thereareatleasttwopossibilities: Youcouldspecifyonecorneroftherectangle(orthecenter),thewidth,andtheheight.
en.wikibooks.org/wiki/Think_Python/Print_version 162/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Youcouldspecifytwoopposingcorners. Atthispointitishardtosaywhethereitherisbetterthantheother,sowellimplementthefirstone,justasanexample. Hereistheclassdefinition:


c l a s sR e c t a n g l e ( o b j e c t ) : " " " r e p r e s e n tar e c t a n g l e . a t t r i b u t e s :w i d t h ,h e i g h t ,c o r n e r . " " "

Thedocstringliststheattributes: w i d t h and h e i g h t arenumbers c o r n e r isaPointobjectthatspecifiesthelowerleftcorner. Torepresentarectangle,youhavetoinstantiateaRectangleobjectandassignvaluestotheattributes:


b o x=R e c t a n g l e ( ) b o x . w i d t h=1 0 0 . 0 b o x . h e i g h t=2 0 0 . 0 b o x . c o r n e r=P o i n t ( ) b o x . c o r n e r . x=0 . 0 b o x . c o r n e r . y=0 . 0

Theexpression b o x . c o r n e r . x means,Gototheobject b o x referstoandselecttheattributenamed c o r n e r thengotothatobjectandselecttheattributenamed x . Thefigureshowsthestateofthisobject: <IMGSRC="book023.png"> Anobjectthatisanattributeofanotherobjectis embedded.

Instancesasreturnvalues
Functionscanreturninstances.Forexample, f i n d _ c e n t e r takesa R e c t a n g l e asanargumentandreturnsa P o i n t thatcontainsthecoordinatesofthecenterofthe R e c t a n g l e :
d e ff i n d _ c e n t e r ( b o x ) : p=P o i n t ( ) p . x=b o x . c o r n e r . x+b o x . w i d t h / 2 . 0 p . y=b o x . c o r n e r . y+b o x . h e i g h t / 2 . 0 r e t u r np

Hereisanexamplethatpasses b o x asanargumentandassignstheresultingPointto c e n t e r :
en.wikibooks.org/wiki/Think_Python/Print_version 163/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >c e n t e r=f i n d _ c e n t e r ( b o x ) > > >p r i n t _ p o i n t ( c e n t e r ) ( 5 0 . 0 ,1 0 0 . 0 )

Objectsaremutable
Youcanchangethestateofanobjectbymakinganassignmenttooneofitsattributes.Forexample,tochangethesizeofarectanglewithoutchangingits position,youcanmodifythevaluesof w i d t h and h e i g h t :
b o x . w i d t h=b o x . w i d t h+5 0 b o x . h e i g h t=b o x . h e i g h t+1 0 0

Youcanalsowritefunctionsthatmodifyobjects.Forexample, g r o w _ r e c t a n g l e takesaRectangleobjectandtwonumbers, d w i d t h and d h e i g h t ,andaddsthe numberstothewidthandheightoftherectangle:


d e fg r o w _ r e c t a n g l e ( r e c t ,d w i d t h ,d h e i g h t ): r e c t . w i d t h+ =d w i d t h r e c t . h e i g h t+ =d h e i g h t

Hereisanexamplethatdemonstratestheeffect:
> > >p r i n tb o x . w i d t h 1 0 0 . 0 > > >p r i n tb o x . h e i g h t 2 0 0 . 0 > > >g r o w _ r e c t a n g l e ( b o x ,5 0 ,1 0 0 ) > > >p r i n tb o x . w i d t h 1 5 0 . 0 > > >p r i n tb o x . h e i g h t 3 0 0 . 0

Insidethefunction, r e c t isanaliasfor b o x ,soifthefunctionmodifies r e c t , b o x changes.

Exercise2
Writeafunctionnamed m o v e _ r e c t a n g l e thattakesaRectangleandtwonumbersnamed'd x 'and'd y '.Itshouldchangethelocationoftherectanglebyadding'd x ' tothe'x 'coordinateof'c o r n e r 'andadding'd y 'tothe'y 'coordinateof'c o r n e r '.

Copying
Aliasingcanmakeaprogramdifficulttoreadbecausechangesinoneplacemighthaveunexpectedeffectsinanotherplace.Itishardtokeeptrackofallthe en.wikibooks.org/wiki/Think_Python/Print_version 164/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Aliasingcanmakeaprogramdifficulttoreadbecausechangesinoneplacemighthaveunexpectedeffectsinanotherplace.Itishardtokeeptrackofallthe variablesthatmightrefertoagivenobject. Copyinganobjectisoftenanalternativetoaliasing.The c o p y modulecontainsafunctioncalled c o p y thatcanduplicateanyobject:


> > >p 1=P o i n t ( ) > > >p 1 . x=3 . 0 > > >p 1 . y=4 . 0 > > >i m p o r tc o p y > > >p 2=c o p y . c o p y ( p 1 )
p 1 and p 2 containthesamedata,buttheyarenotthesamePoint.

> > >p r i n t _ p o i n t ( p 1 ) ( 3 . 0 ,4 . 0 ) > > >p r i n t _ p o i n t ( p 2 ) ( 3 . 0 ,4 . 0 ) > > >p 1i sp 2 F a l s e > > >p 1= =p 2 F a l s e

The i s operatorindicatesthat p 1 and p 2 arenotthesameobject,whichiswhatweexpected.Butyoumighthaveexpected = = toyield T r u e becausethesepoints containthesamedata.Inthatcase,youwillbedisappointedtolearnthatforinstances,thedefaultbehaviorofthe = = operatoristhesameasthe i s operator itchecksobjectidentity,notobjectequivalence.Thisbehaviorcanbechangedwellseehowlater. Ifyouuse c o p y . c o p y toduplicateaRectangle,youwillfindthatitcopiestheRectangleobjectbutnottheembeddedPoint.
> > >b o x 2=c o p y . c o p y ( b o x ) > > >b o x 2i sb o x F a l s e > > >b o x 2 . c o r n e ri sb o x . c o r n e r T r u e

Hereiswhattheobjectdiagramlookslike: <IMGSRC="book024.png"> Thisoperationiscalleda shallowcopybecauseitcopiestheobjectandanyreferencesitcontains,butnottheembeddedobjects. Formostapplications,thisisnotwhatyouwant.Inthisexample,invoking g r o w _ r e c t a n g l e ononeoftheRectangleswouldnotaffecttheother,butinvoking m o v e _ r e c t a n g l e oneitherwouldaffectboth!Thisbehaviorisconfusinganderrorprone.


en.wikibooks.org/wiki/Think_Python/Print_version 165/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Fortunately,the c o p y modulecontainsamethodnamed d e e p c o p y thatcopiesnotonlytheobjectbutalsotheobjectsitrefersto,andtheobjects theyreferto, andsoon.Youwillnotbesurprisedtolearnthatthisoperationiscalleda deepcopy.


> > >b o x 3=c o p y . d e e p c o p y ( b o x ) > > >b o x 3i sb o x F a l s e > > >b o x 3 . c o r n e ri sb o x . c o r n e r F a l s e
b o x 3 and b o x arecompletelyseparateobjects.

Exercise3
Writeaversionof m o v e _ r e c t a n g l e thatcreatesandreturnsanewRectangleinsteadofmodifyingtheoldone.

Debugging
Whenyoustartworkingwithobjects,youarelikelytoencountersomenewexceptions.Ifyoutrytoaccessanattributethatdoesntexist,yougetan A t t r i b u t e E r r o r :
> > >p=P o i n t ( ) > > >p r i n tp . z A t t r i b u t e E r r o r :P o i n ti n s t a n c eh a sn oa t t r i b u t e' z '

Ifyouarenotsurewhattypeanobjectis,youcanask:
> > >t y p e ( p ) < t y p e' _ _ m a i n _ _ . P o i n t ' >

Ifyouarenotsurewhetheranobjecthasaparticularattribute,youcanusethebuiltinfunction h a s a t t r :
> > >h a s a t t r ( p ,' x ' ) T r u e > > >h a s a t t r ( p ,' z ' ) F a l s e

Thefirstargumentcanbeanyobjectthesecondargumentisa stringthatcontainsthenameoftheattribute.

Glossary
en.wikibooks.org/wiki/Think_Python/Print_version 166/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

class: Auserdefinedtype.Aclassdefinitioncreatesanewclassobject. classobject: Anobjectthatcontainsinformationaboutauserdefinedtype.Theclassobjectcanbeusedtocreateinstancesofthetype. instance: Anobjectthatbelongstoaclass. attribute: Oneofthenamedvaluesassociatedwithanobject. embedded(object): Anobjectthatisstoredasanattributeofanotherobject. shallowcopy: Tocopythecontentsofanobject,includinganyreferencestoembeddedobjectsimplementedbythe c o p y functioninthe c o p y module. deepcopy: Tocopythecontentsofanobjectaswellasanyembeddedobjects,andanyobjectsembeddedinthem,andsoonimplementedbythe d e e p c o p y functioninthe c o p y module. objectdiagram: Adiagramthatshowsobjects,theirattributes,andthevaluesoftheattributes.

Exercises
Exercise4
W o r l d . p y '',whichispartofSwampy(seeChapter'4'),containsaclassdefinitionforauserdefinedtypecalled'W o r l d '.Ifyourunthiscode:

' ' f r o mW o r l di m p o r t* w o r l d=W o r l d ( ) w a i t _ f o r _ u s e r ( ) ' '

Awindowshouldappearwithatitlebarandanemptysquare. InthisexercisewewillusethiswindowtodrawPoints,Rectanglesandothershapes.Addthe followinglinesbefore w a i t _ f o r _ u s e r andruntheprogramagain


' ' c a n v a s=w o r l d . c a ( w i d t h = 5 0 0 ,h e i g h t = 5 0 0 ,b a c k g r o u n d = ' w h i t e ' ) b b o x=[ [ 1 5 0 , 1 0 0 ] ,[ 1 5 0 ,1 0 0 ] ] c a n v a s . r e c t a n g l e ( b b o x ,o u t l i n e = ' b l a c k ' ,w i d t h = 2 ,f i l l = ' g r e e n 4 ' ) ' '

Youshouldseeagreenrectanglewithablackoutline. ThefirstlinecreatesaCanvas,whichappearsinthewindowasawhitesquare.TheCanvasobject 167/282 en.wikibooks.org/wiki/Think_Python/Print_version

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Youshouldseeagreenrectanglewithablackoutline. ThefirstlinecreatesaCanvas,whichappearsinthewindowasawhitesquare.TheCanvasobject providesmethodslike'r e c t a n g l e 'fordrawingvariousshapes.


b b o x ''isalistofliststhatrepresentstheboundingboxoftherectangle.Thefirstpairofcoordinatesisthelowerleftcorneroftherectanglethesecondpairis

theupperrightcorner. Youcandrawacirclelikethis:
' ' c a n v a s . c i r c l e ( [ 2 5 , 0 ] ,7 0 ,o u t l i n e = N o n e ,f i l l = ' r e d ' ) ' '

Thefirstparameteristhecoordinatepairforthecenterofthecirclethesecondparameteristheradius. Ifyouaddthislinetotheprogram, theresultshouldresemblethenationalflagofBangladesh(see'w i k i p e d i a . o r g / w i k i / G a l l e r y _ o f _ s o v e r e i g n s t a t e _ f l a g s '). Writeafunctioncalled d r a w _ r e c t a n g l e thattakesa CanvasandaRectangleasargumentsanddrawsarepresentationoftheRectangleontheCanvas. Addanattributenamed'c o l o r 'toyourRectangleobjectsand modify d r a w _ r e c t a n g l e sothatitusesthecolorattributeasthefillcolor. Writeafunctioncalled d r a w _ p o i n t thattakesa CanvasandaPointasargumentsanddrawsarepresentationofthePointontheCanvas. DefineanewclasscalledCirclewithappropriateattributesand instantiateafewCircleobjects.Writeafunctioncalled d r a w _ c i r c l e thatdrawscirclesonthecanvas. WriteaprogramthatdrawsthenationalflagofoftheCzechRepublic(http://en.wikipedia.org/wiki/File:Flag_of_the_Czech_Republic.svg). Hint:youcandrawapolygonlikethis:
' ' p o i n t s=[ [ 1 5 0 , 1 0 0 ] ,[ 1 5 0 ,1 0 0 ] ,[ 1 5 0 ,1 0 0 ] ] c a n v a s . p o l y g o n ( p o i n t s ,f i l l = ' b l u e ' ) ' '

Ihavewrittenasmallprogramthatliststheavailablecolors youcandownloaditfrom't h i n k p y t h o n . c o m / c o d e / c o l o r _ l i s t . p y '.

Classesandfunctions
en.wikibooks.org/wiki/Think_Python/Print_version 168/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Time
Asanotherexampleofauserdefinedtype,we'lldefineaclasscalled T i m e thatrecordsthetimeofday.Theclassdefinitionlookslikethis:
c l a s sT i m e ( o b j e c t ) : " " " r e p r e s e n t st h et i m eo fd a y . a t t r i b u t e s :h o u r ,m i n u t e ,s e c o n d " " "

Wecancreateanew T i m e objectandassignattributesforhours,minutes,andseconds:
t i m e=T i m e ( ) t i m e . h o u r=1 1 t i m e . m i n u t e=5 9 t i m e . s e c o n d=3 0

Thestatediagramforthe T i m e objectlookslikethis:

<IMGSRC="book025.png">

Exercise1
Writeafunctioncalled p r i n t _ t i m e thattakesaTimeobjectandprintsitintheform h o u r : m i n u t e : s e c o n d . Hint:theformatsequence % . 2 d printsanintegerusingatleasttwodigits,includingaleadingzeroifnecessary.

Exercise2
Writeabooleanfunctioncalled i s _ a f t e r thattakestwoTimeobjects, t 1 and t 2 ,andreturns T r u e if t 1 follows t 2 chronologicallyand F a l s e otherwise. Challenge:don'tusean i f statement.

Purefunctions
Inthenextfewsections,wellwritetwofunctionsthataddtimevalues.Theydemonstratetwokindsoffunctions:purefunctionsandmodifiers.Theyalso demonstrateadevelopmentplanIllcall prototypeandpatch,whichisawayoftacklingacomplexproblembystartingwithasimpleprototypeand incrementallydealingwiththecomplications. Hereisasimpleprototypeof a d d _ t i m e :
d e fa d d _ t i m e ( t 1 ,t 2 ) :
en.wikibooks.org/wiki/Think_Python/Print_version 169/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

s u m=T i m e ( ) s u m . h o u r=t 1 . h o u r+t 2 . h o u r s u m . m i n u t e=t 1 . m i n u t e+t 2 . m i n u t e s u m . s e c o n d=t 1 . s e c o n d+t 2 . s e c o n d r e t u r ns u m

Thefunctioncreatesanew T i m e object,initializesitsattributes,andreturnsareferencetothenewobject.Thisiscalleda purefunctionbecauseitdoesnot modifyanyoftheobjectspassedtoitasargumentsandithasnoeffect,likedisplayingavalueorgettinguserinput,otherthanreturningavalue. Totestthisfunction,IllcreatetwoTimeobjects: s t a r t containsthestarttimeofamovie,like MontyPythonandtheHolyGrail,and d u r a t i o n containstherun timeofthemovie, whichisonehour35minutes.
a d d _ t i m e figuresoutwhenthemoviewillbedone.

> > >s t a r t=T i m e ( ) > > >s t a r t . h o u r=9 > > >s t a r t . m i n u t e=4 5 > > >s t a r t . s e c o n d= 0 > > >d u r a t i o n=T i m e ( ) > > >d u r a t i o n . h o u r=1 > > >d u r a t i o n . m i n u t e=3 5 > > >d u r a t i o n . s e c o n d=0 > > >d o n e=a d d _ t i m e ( s t a r t ,d u r a t i o n ) > > >p r i n t _ t i m e ( d o n e ) 1 0 : 8 0 : 0 0

Theresult, 1 0 : 8 0 : 0 0 mightnotbewhatyouwerehopingfor.Theproblemisthatthisfunctiondoesnotdealwithcaseswherethenumberofsecondsorminutes addsuptomorethansixty.Whenthathappens,wehavetocarrytheextrasecondsintotheminutecolumnortheextraminutesintothehourcolumn. Heresanimprovedversion:


d e fa d d _ t i m e ( t 1 ,t 2 ) : s u m=T i m e ( ) s u m . h o u r=t 1 . h o u r+t 2 . h o u r s u m . m i n u t e=t 1 . m i n u t e+t 2 . m i n u t e s u m . s e c o n d=t 1 . s e c o n d+t 2 . s e c o n d i fs u m . s e c o n d> =6 0 : s u m . s e c o n d=6 0 s u m . m i n u t e+ =1 i fs u m . m i n u t e> =6 0 : s u m . m i n u t e=6 0 s u m . h o u r+ =1
en.wikibooks.org/wiki/Think_Python/Print_version 170/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r ns u m

Althoughthisfunctioniscorrect,itisstartingtogetbig.Wewillseeashorteralternativelater.

Modifiers
Sometimesitisusefulforafunctiontomodifytheobjectsitgetsasparameters.Inthatcase,thechangesarevisibletothecaller.Functionsthatworkthis wayarecalled modifiers.
i n c r e m e n t ,whichaddsagivennumberofsecondstoa T i m e object,canbewrittennaturallyasamodifier.Hereisaroughdraft:

d e fi n c r e m e n t ( t i m e ,s e c o n d s ) : t i m e . s e c o n d+ =s e c o n d s i ft i m e . s e c o n d> =6 0 : t i m e . s e c o n d=6 0 t i m e . m i n u t e+ =1 i ft i m e . m i n u t e> =6 0 : t i m e . m i n u t e=6 0 t i m e . h o u r+ =1

Thefirstlineperformsthebasicoperationtheremainderdealswiththespecialcaseswesawbefore. Isthisfunctioncorrect?Whathappensiftheparameter s e c o n d s ismuchgreaterthansixty? Inthatcase,itisnotenoughtocarryoncewehavetokeepdoingituntil t i m e . s e c o n d islessthansixty.Onesolutionistoreplacethe i f statementswith w h i l e statements.Thatwouldmakethefunctioncorrect,butnotveryefficient. Exercise3 Writeacorrectversionof'i n c r e m e n t 'thatdoesntcontainanyloops. Anythingthatcanbedonewithmodifierscanalsobedonewithpurefunctions.Infact,someprogramminglanguagesonlyallowpurefunctions.Thereissome evidencethatprogramsthatusepurefunctionsarefastertodevelopandlesserrorpronethanprogramsthatusemodifiers.Butmodifiersareconvenientat times,andfunctionalprogramstendtobelessefficient. Ingeneral,Irecommendthatyouwritepurefunctionswheneveritisreasonableandresorttomodifiersonlyifthereisacompellingadvantage.Thisapproach mightbecalleda functional programmingstyle. Exercise4 Writeapureversionof'i n c r e m e n t 'thatcreatesandreturnsanewTimeobjectratherthanmodifyingtheparameter.

en.wikibooks.org/wiki/Think_Python/Print_version

171/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Prototypingversusplanning
ThedevelopmentplanIamdemonstratingiscalledprototypeandpatch.Foreachfunction,Iwroteaprototypethatperformedthebasiccalculationandthen testedit,patchingerrorsalongtheway. Thisapproachcanbeeffective,especiallyifyoudontyethaveadeepunderstandingoftheproblem.Butincrementalcorrectionscangeneratecodethatis unnecessarilycomplicatedsinceitdealswithmanyspecialcasesandunreliablesinceitishardtoknowifyouhavefoundalltheerrors. Analternativeis planneddevelopment,inwhichhighlevelinsightintotheproblemcanmaketheprogrammingmucheasier.Inthiscase,theinsightisthata Timeobjectisreallyathreedigitnumberinbase60(see w i k i p e d i a . o r g / w i k i / S e x a g e s i m a l )!The s e c o n d attributeistheonescolumn,the m i n u t e attributeisthe sixtiescolumn,andthe h o u r attributeisthethirtysixhundredscolumn. Whenwewrote a d d _ t i m e and i n c r e m e n t ,wewereeffectivelydoingadditioninbase60,whichiswhywehadtocarryfromonecolumntothenext. ThisobservationsuggestsanotherapproachtothewholeproblemwecanconvertTimeobjectstointegersandtakeadvantageofthefactthatthecomputer knowshowtodointegerarithmetic. HereisafunctionthatconvertsTimestointegers:
d e ft i m e _ t o _ i n t ( t i m e ) : m i n u t e s=t i m e . h o u r*6 0+t i m e . m i n u t e s e c o n d s=m i n u t e s*6 0+t i m e . s e c o n d r e t u r ns e c o n d s

AndhereisthefunctionthatconvertsintegerstoTimes(recallthat d i v m o d dividesthefirstargumentbythesecondandreturnsthequotientandremainderasa tuple).


d e fi n t _ t o _ t i m e ( s e c o n d s ) : t i m e=T i m e ( ) m i n u t e s ,t i m e . s e c o n d=d i v m o d ( s e c o n d s ,6 0 ) t i m e . h o u r ,t i m e . m i n u t e=d i v m o d ( m i n u t e s ,6 0 ) r e t u r nt i m e

Youmighthavetothinkabit,andrunsometests,toconvinceyourselfthatthesefunctionsarecorrect.Onewaytotestthemistocheckthat t i m e _ t o _ i n t ( i n t _ t o _ t i m e ( x ) )= =x formanyvaluesof x .Thisisanexampleofaconsistencycheck. Onceyouareconvincedtheyarecorrect,youcanusethemtorewrite a d d _ t i m e :


d e fa d d _ t i m e ( t 1 ,t 2 ) : s e c o n d s=t i m e _ t o _ i n t ( t 1 )+t i m e _ t o _ i n t ( t 2 ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )

Thisversionisshorterthantheoriginal,andeasiertoverify.
en.wikibooks.org/wiki/Think_Python/Print_version 172/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise5 Rewrite'i n c r e m e n t 'using t i m e _ t o _ i n t and i n t _ t o _ t i m e . Insomeways,convertingfrombase60tobase10andbackisharderthanjustdealingwithtimes.Baseconversionismoreabstractourintuitionfordealing withtimevaluesisbetter. Butifwehavetheinsighttotreattimesasbase60numbersandmaketheinvestmentofwritingtheconversionfunctions(t i m e _ t o _ i n t and i n t _ t o _ t i m e ),wegeta programthatisshorter,easiertoreadanddebug,andmorereliable. Itisalsoeasiertoaddfeatureslater.Forexample,imaginesubtractingtwoTimestofindthedurationbetweenthem.Thenaveapproachwouldbeto implementsubtractionwithborrowing.Usingtheconversionfunctionswouldbeeasierandmorelikelytobecorrect. Ironically,sometimesmakingaproblemharder(ormoregeneral)makesiteasier(becausetherearefewerspecialcasesandfeweropportunitiesforerror).

Debugging
ATimeobjectiswellformedifthevaluesof m i n u t e s and s e c o n d s arebetween0and60(including0butnot60)andif h o u r s ispositive. h o u r s and m i n u t e s shouldbe integralvalues,butwemightallow s e c o n d s tohaveafractionpart. Thesekindofrequirementsarecalled invariantsbecausetheyshouldalwaysbetrue.Toputitadifferentway,iftheyarenottrue,thensomethinghasgone wrong. Writingcodetocheckyourinvariantscanhelpyoudetecterrorsandfindtheircauses.Forexample,youmighthaveafunctionlike v a l i d _ t i m e thattakesaTime objectandreturns F a l s e ifitviolatesaninvariant:
d e fv a l i d _ t i m e ( t i m e ) : i ft i m e . h o u r s<0o rt i m e . m i n u t e s<0o rt i m e . s e c o n d s<0 : r e t u r nF a l s e i ft i m e . m i n u t e s> =6 0o rt i m e . s e c o n d s> =6 0 : r e t u r nF a l s e r e t u r nT r u e

Thenatthebeginningofeachfunctionyoucouldchecktheargumentstomakesuretheyarevalid:

d e fa d d _ t i m e ( t 1 ,t 2 ) : i fn o tv a l i d _ t i m e ( t 1 )o rn o tv a l i d _ t i m e ( t 2 ) : r a i s eV a l u e E r r o r ,' i n v a l i dT i m eo b j e c ti na d d _ t i m e ' s e c o n d s=t i m e _ t o _ i n t ( t 1 )+t i m e _ t o _ i n t ( t 2 ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )

Oryoucouldusean a s s e r t statement,whichchecksagiveninvariantandraisesanexceptionifitfails:
en.wikibooks.org/wiki/Think_Python/Print_version 173/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fa d d _ t i m e ( t 1 ,t 2 ) : a s s e r tv a l i d _ t i m e ( t 1 )a n dv a l i d _ t i m e ( t 2 ) s e c o n d s=t i m e _ t o _ i n t ( t 1 )+t i m e _ t o _ i n t ( t 2 ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )
a s s e r t statementsareusefulbecausetheydistinguishcodethatdealswithnormalconditionsfromcodethatchecksforerrors.

Glossary
prototypeandpatch: Adevelopmentplanthatinvolveswritingaroughdraftofaprogram,testing,andcorrectingerrorsastheyarefound. planneddevelopment: Adevelopmentplanthatinvolveshighlevelinsightintotheproblemandmoreplanningthanincrementaldevelopmentorprototypedevelopment. purefunction: Afunctionthatdoesnotmodifyanyoftheobjectsitreceivesasarguments.Mostpurefunctionsarefruitful. modifier: Afunctionthatchangesoneormoreoftheobjectsitreceivesasarguments.Mostmodifiersarefruitless. functionalprogrammingstyle: Astyleofprogramdesigninwhichthemajorityoffunctionsarepure. invariant: Aconditionthatshouldalwaysbetrueduringtheexecutionofaprogram.

Exercises
Exercise6
Writeafunctioncalled m u l _ t i m e thattakesaTimeobjectandanumberandreturnsanewTimeobjectthatcontainstheproductoftheoriginalTimeandthe number. Thenuse m u l _ t i m e towriteafunctionthattakesaTimeobjectthatrepresentsthefinishingtimeinarace,andanumberthatrepresentsthedistance, andreturnsaTimeobjectthatrepresentstheaveragepace(timepermile).

Exercise7
WriteaclassdefinitionforaDateobjectthathasattributes'd a y ','m o n t h 'and'y e a r '.Writeafunctioncalled i n c r e m e n t _ d a t e thattakesaDateobject,'d a t e 'andan integer,'n ',andreturnsanewDateobjectthatrepresentstheday'n 'daysafter'd a t e '.Hint:ThirtydayshathSeptember...Challenge:doesyourfunctiondeal withleapyearscorrectly?See''w i k i p e d i a . o r g / w i k i / L e a p _ y e a r

Exercise8
en.wikibooks.org/wiki/Think_Python/Print_version 174/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

The'd a t e t i m e 'moduleprovides'd a t e 'and't i m e 'objectsthataresimilartotheDateandTimeobjectsinthischapter,buttheyprovidearichsetofmethodsand operators.Readthedocumentationat'd o c s . p y t h o n . o r g / l i b / d a t e t i m e d a t e . h t m l '. Usethe'd a t e t i m e 'moduletowriteaprogramthatgetsthecurrentdateandprintsthedayoftheweek. Writeaprogramthattakesabirthdayasinputandprintstheusersageandthenumberofdays,hours,minutesandsecondsuntiltheirnextbirthday.

Classesandmethods
Objectorientedfeatures
Pythonisan objectorientedprogramminglanguage,whichmeansthatitprovidesfeaturesthatsupportobjectorientedprogramming. Itisnoteasytodefineobjectorientedprogramming,butwehavealreadyseensomeofitscharacteristics: Programsaremadeupofobjectdefinitionsandfunction definitions,andmostofthecomputationisexpressedintermsofoperationsonobjects. Eachobjectdefinitioncorrespondstosomeobjectorconcept intherealworld,andthefunctionsthatoperateonthatobjectcorrespondtothewaysrealworldobjectsinteract. Forexample,the T i m e classdefinedinChapter16correspondstothewaypeoplerecordthetimeofday,andthefunctionswedefinedcorrespondtothekinds ofthingspeopledowithtimes.Similarly,the P o i n t and R e c t a n g l e classescorrespondtothemathematicalconceptsofapointandarectangle. Sofar,wehavenottakenadvantageofthefeaturesPythonprovidestosupportobjectorientedprogramming.Thesefeaturesarenotstrictlynecessarymost ofthemprovidealternativesyntaxforthingswehavealreadydone.Butinmanycases,thealternativeismoreconciseandmoreaccuratelyconveysthe structureoftheprogram. Forexample,inthe T i m e program,thereisnoobviousconnectionbetweentheclassdefinitionandthefunctiondefinitionsthatfollow.Withsomeexamination, itisapparentthateveryfunctiontakesatleastone T i m e objectasanargument. Thisobservationisthemotivationfor methodsamethodisafunctionthatisassociatedwithaparticularclass.Wehaveseenmethodsforstrings,lists, dictionariesandtuples.Inthischapter,wewilldefinemethodsforuserdefinedtypes. Methodsaresemanticallythesameasfunctions,buttherearetwosyntacticdifferences: Methodsaredefinedinsideaclassdefinitioninordertomaketherelationshipbetweentheclassandthemethodexplicit. Thesyntaxforinvokingamethodisdifferentfromthesyntaxforcallingafunction. Inthenextfewsections,wewilltakethefunctionsfromtheprevioustwochaptersandtransformthemintomethods.Thistransformationispurelymechanical youcandoitsimplybyfollowingasequenceofsteps.Ifyouarecomfortableconvertingfromoneformtoanother,youwillbeabletochoosethebestformfor whateveryouaredoing.
en.wikibooks.org/wiki/Think_Python/Print_version 175/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Printingobjects
InChapter16,wedefinedaclassnamed T i m e andinExercise16.1,youwroteafunctionnamed p r i n t _ t i m e :
c l a s sT i m e ( o b j e c t ) : " " " r e p r e s e n t st h et i m eo fd a y . a t t r i b u t e s :h o u r ,m i n u t e ,s e c o n d " " " d e fp r i n t _ t i m e ( t i m e ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( t i m e . h o u r ,t i m e . m i n u t e ,t i m e . s e c o n d )

Tocallthisfunction,youhavetopassa T i m e objectasanargument:
> > >s t a r t=T i m e ( ) > > >s t a r t . h o u r=9 > > >s t a r t . m i n u t e=4 5 > > >s t a r t . s e c o n d=0 0 > > >p r i n t _ t i m e ( s t a r t ) 0 9 : 4 5 : 0 0

Tomake p r i n t _ t i m e amethod,allwehavetodoismovethefunctiondefinitioninsidetheclassdefinition.Noticethechangeinindentation.
c l a s sT i m e ( o b j e c t ) : d e fp r i n t _ t i m e ( t i m e ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( t i m e . h o u r ,t i m e . m i n u t e ,t i m e . s e c o n d )

Nowtherearetwowaystocall p r i n t _ t i m e .Thefirst(andlesscommon)wayistousefunctionsyntax:
> > >T i m e . p r i n t _ t i m e ( s t a r t ) 0 9 : 4 5 : 0 0

Inthisuseofdotnotation, T i m e isthenameoftheclass,and p r i n t _ t i m e isthenameofthemethod. s t a r t ispassedasaparameter. Thesecond(andmoreconcise)wayistousemethodsyntax:


> > >s t a r t . p r i n t _ t i m e ( ) 0 9 : 4 5 : 0 0

Inthisuseofdotnotation, p r i n t _ t i m e isthenameofthemethod(again),and s t a r t istheobjectthemethodisinvokedon,whichiscalledthe subject.Justas thesubjectofasentenceiswhatthesentenceisabout,thesubjectofamethodinvocationiswhatthemethodisabout.


en.wikibooks.org/wiki/Think_Python/Print_version 176/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Insidethemethod,thesubjectisassignedtothefirstparameter,sointhiscase s t a r t isassignedto t i m e . Byconvention,thefirstparameterofamethodiscalled s e l f ,soitwouldbemorecommontowrite p r i n t _ t i m e likethis:


c l a s sT i m e ( o b j e c t ) : d e fp r i n t _ t i m e ( s e l f ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( s e l f . h o u r ,s e l f . m i n u t e ,s e l f . s e c o n d )

Thereasonforthisconventionisanimplicitmetaphor: Thesyntaxforafunctioncall, p r i n t _ t i m e ( s t a r t ) , suggeststhatthefunctionistheactiveagent.Itsayssomethinglike,Hey p r i n t _ t i m e !Heresanobjectforyoutoprint. Inobjectorientedprogramming,theobjectsaretheactive agents.Amethodinvocationlike s t a r t . p r i n t _ t i m e ( ) saysHey s t a r t !Pleaseprintyourself. Thischangeinperspectivemightbemorepolite,butitisnotobviousthatitisuseful.Intheexampleswehaveseensofar,itmaynotbe.Butsometimes shiftingresponsibilityfromthefunctionsontotheobjectsmakesitpossibletowritemoreversatilefunctions,andmakesiteasiertomaintainandreusecode.

Exercise1
Rewrite t i m e _ t o _ i n t (fromSection'16.4')asamethod.Itisprobablynotappropriatetorewrite i n t _ t o _ t i m e asamethoditsnotclearwhatobjectyouwould invokeiton!

Anotherexample
Heresaversionof i n c r e m e n t (fromSection16.3)rewrittenasamethod:
#i n s i d ec l a s sT i m e : d e fi n c r e m e n t ( s e l f ,s e c o n d s ) : s e c o n d s+ =s e l f . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )

Thisversionassumesthat t i m e _ t o _ i n t iswrittenasamethod,asinExercise17.1.Also,notethatitisapurefunction,notamodifier. Hereshowyouwouldinvoke i n c r e m e n t :


> > >s t a r t . p r i n t _ t i m e ( ) 0 9 : 4 5 : 0 0
en.wikibooks.org/wiki/Think_Python/Print_version 177/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >e n d=s t a r t . i n c r e m e n t ( 1 3 3 7 ) > > >e n d . p r i n t _ t i m e ( ) 1 0 : 0 7 : 1 7

Thesubject, s t a r t ,getsassignedtothefirstparameter, s e l f .Theargument, 1 3 3 7 ,getsassignedtothesecondparameter, s e c o n d s . Thismechanismcanbeconfusing,especiallyifyoumakeanerror.Forexample,ifyouinvoke i n c r e m e n t withtwoarguments,youget:


> > >e n d=s t a r t . i n c r e m e n t ( 1 3 3 7 ,4 6 0 ) T y p e E r r o r :i n c r e m e n t ( )t a k e se x a c t l y2a r g u m e n t s( 3g i v e n )

Theerrormessageisinitiallyconfusing,becausethereareonlytwoargumentsinparentheses.Butthesubjectisalsoconsideredanargument,soalltogether thatsthree.

Amorecomplicatedexample
i s _ a f t e r (fromExercise16.2)isslightlymorecomplicatedbecauseittakestwoTimeobjectsasparameters.Inthiscaseitisconventionaltonamethefirst

parameter s e l f andthesecondparameter o t h e r :
#i n s i d ec l a s sT i m e : d e fi s _ a f t e r ( s e l f ,o t h e r ) : r e t u r ns e l f . t i m e _ t o _ i n t ( )>o t h e r . t i m e _ t o _ i n t ( )

Tousethismethod,youhavetoinvokeitononeobjectandpasstheotherasanargument:
> > >e n d . i s _ a f t e r ( s t a r t ) T r u e

OnenicethingaboutthissyntaxisthatitalmostreadslikeEnglish:endisafterstart?

Theinitmethod
Theinitmethod(shortforinitialization)isaspecialmethodthatgetsinvokedwhenanobjectisinstantiated.Itsfullnameis _ _ i n i t _ _ (twounderscore characters,followedby i n i t ,andthentwomoreunderscores).Aninitmethodforthe T i m e classmightlooklikethis:
#i n s i d ec l a s sT i m e : d e f_ _ i n i t _ _ ( s e l f ,h o u r = 0 ,m i n u t e = 0 ,s e c o n d = 0 ) : s e l f . h o u r=h o u r s e l f . m i n u t e=m i n u t e
en.wikibooks.org/wiki/Think_Python/Print_version 178/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

s e l f . s e c o n d=s e c o n d

Itiscommonfortheparametersof _ _ i n i t _ _ tohavethesamenamesastheattributes.Thestatement
s e l f . h o u r=h o u r

storesthevalueoftheparameter h o u r asanattributeof s e l f . Theparametersareoptional,soifyoucall T i m e withnoarguments,yougetthedefaultvalues.


> > >t i m e=T i m e ( ) > > >t i m e . p r i n t _ t i m e ( ) 0 0 : 0 0 : 0 0

Ifyouprovideoneargument,itoverrides h o u r :
> > >t i m e=T i m e( 9 ) > > >t i m e . p r i n t _ t i m e ( ) 0 9 : 0 0 : 0 0

Ifyouprovidetwoarguments,theyoverride h o u r and m i n u t e .
> > >t i m e=T i m e ( 9 ,4 5 ) > > >t i m e . p r i n t _ t i m e ( ) 0 9 : 4 5 : 0 0

Andifyouprovidethreearguments,theyoverrideallthreedefaultvalues.

Exercise2
Writeaninitmethodforthe'P o i n t 'classthattakes'x 'and'y 'asoptionalparametersandassignsthemtothecorrespondingattributes.

The_ _ s t r _ _ method
_ _ s t r _ _ isaspecialmethod,like _ _ i n i t _ _ ,thatissupposedtoreturnastringrepresentationofanobject.

Forexample,hereisa s t r methodforTimeobjects:
#i n s i d ec l a s sT i m e :
en.wikibooks.org/wiki/Think_Python/Print_version 179/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e f_ _ s t r _ _ ( s e l f ) : r e t u r n' % . 2 d : % . 2 d : % . 2 d '%( s e l f . h o u r ,s e l f . m i n u t e ,s e l f . s e c o n d )

Whenyou p r i n t anobject,Pythoninvokesthe s t r method:


> > >t i m e=T i m e ( 9 ,4 5 ) > > >p r i n tt i m e 0 9 : 4 5 : 0 0

WhenIwriteanewclass,Ialmostalwaysstartbywriting _ _ i n i t _ _ ,whichmakesiteasiertoinstantiateobjects,and _ _ s t r _ _ ,whichisusefulfordebugging.

Exercise3
Writea's t r 'methodforthe'P o i n t 'class.CreateaPointobjectandprintit.

Operatoroverloading
Bydefiningotherspecialmethods,youcanspecifythebehaviorofoperatorsonuserdefinedtypes.Forexample,ifyoudefineamethodnamed _ _ a d d _ _ forthe T i m e class,youcanusethe + operatoronTimeobjects. Hereiswhatthedefinitionmightlooklike:
#i n s i d ec l a s sT i m e : d e f_ _ a d d _ _ ( s e l f ,o t h e r ) : s e c o n d s=s e l f . t i m e _ t o _ i n t ( )+o t h e r . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )

Andhereishowyoucoulduseit:
> > >s t a r t=T i m e ( 9 ,4 5 ) > > >d u r a t i o n=T i m e ( 1 ,3 5 ) > > >p r i n ts t a r t+d u r a t i o n 1 1 : 2 0 : 0 0

Whenyouapplythe + operatortoTimeobjects,Pythoninvokes _ _ a d d _ _ .Whenyouprinttheresult,Pythoninvokes _ _ s t r _ _ .Sothereisquitealothappening behindthescenes! Changingthebehaviorofanoperatorsothatitworkswithuserdefinedtypesiscalled operatoroverloading.ForeveryoperatorinPythonthereisa correspondingspecialmethod,like _ _ a d d _ _ .Formoredetails,see d o c s . p y t h o n . o r g / r e f / s p e c i a l n a m e s . h t m l .


en.wikibooks.org/wiki/Think_Python/Print_version 180/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise4
Writean'a d d 'methodforthePointclass.

Typebaseddispatch
IntheprevioussectionweaddedtwoTimeobjects,butyoualsomightwanttoaddanintegertoaTimeobject.Thefollowingisaversionof _ _ a d d _ _ that checksthetypeof o t h e r andinvokeseither a d d _ t i m e or i n c r e m e n t :
#i n s i d ec l a s sT i m e : d e f_ _ a d d _ _ ( s e l f ,o t h e r ) : i fi s i n s t a n c e ( o t h e r ,T i m e ) : r e t u r ns e l f . a d d _ t i m e ( o t h e r ) e l s e : r e t u r ns e l f . i n c r e m e n t ( o t h e r ) d e fa d d _ t i m e ( s e l f ,o t h e r ) : s e c o n d s=s e l f . t i m e _ t o _ i n t ( )+o t h e r . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s ) d e fi n c r e m e n t ( s e l f ,s e c o n d s ) : s e c o n d s+ =s e l f . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )

Thebuiltinfunction i s i n s t a n c e takesavalueandaclassobject,andreturns T r u e ifthevalueisaninstanceoftheclass. If o t h e r isaTimeobject, _ _ a d d _ _ invokes a d d _ t i m e .Otherwiseitassumesthattheparameterisanumberandinvokes i n c r e m e n t .Thisoperationiscalleda type baseddispatchbecauseitdispatchesthecomputationtodifferentmethodsbasedonthetypeofthearguments. Hereareexamplesthatusethe + operatorwithdifferenttypes:
> > >s t a r t=T i m e ( 9 ,4 5 ) > > >d u r a t i o n=T i m e ( 1 ,3 5 ) > > >p r i n ts t a r t+d u r a t i o n 1 1 : 2 0 : 0 0 > > >p r i n ts t a r t+1 3 3 7 1 0 : 0 7 : 1 7

Unfortunately,thisimplementationofadditionisnotcommutative.Iftheintegeristhefirstoperand,youget
> > >p r i n t1 3 3 7+s t a r t T y p e E r r o r :u n s u p p o r t e do p e r a n dt y p e ( s )f o r+ :' i n t 'a n d' i n s t a n c e '

en.wikibooks.org/wiki/Think_Python/Print_version

181/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Theproblemis,insteadofaskingtheTimeobjecttoaddaninteger,PythonisaskinganintegertoaddaTimeobject,anditdoesntknowhowtodothat.But thereisacleversolutionforthisproblem:thespecialmethod _ _ r a d d _ _ ,whichstandsforrightsideadd.ThismethodisinvokedwhenaTimeobjectappearson therightsideofthe + operator.Heresthedefinition:


#i n s i d ec l a s sT i m e : d e f_ _ r a d d _ _ ( s e l f ,o t h e r ) : r e t u r ns e l f . _ _ a d d _ _ ( o t h e r )

Andhereshowitsused:
> > >p r i n t1 3 3 7+s t a r t 1 0 : 0 7 : 1 7

Exercise5
Writean'a d d 'methodforPointsthatworkswitheitheraPointobjectoratuple: IfthesecondoperandisaPoint,themethodshouldreturnanewPointwhose'x'coordinateisthesumofthe'x'coordinatesoftheoperands,and likewiseforthe'y'coordinates. Ifthesecondoperandisatuple,themethodshouldaddthefirstelementofthetupletothe'x'coordinateandthesecondelementtothe'y'coordinate, andreturnanewPointwiththeresult.

Polymorphism
Typebaseddispatchisusefulwhenitisnecessary,but(fortunately)itisnotalwaysnecessary.Oftenyoucanavoiditbywritingfunctionsthatworkcorrectly forargumentswithdifferenttypes. Manyofthefunctionswewroteforstringswillactuallyworkforanykindofsequence.Forexample,inSection11.1weused h i s t o g r a m tocountthenumberof timeseachletterappearsinaword.
d e fh i s t o g r a m ( s ) : d=d i c t ( ) f o rci ns : i fcn o ti nd : d [ c ]=1 e l s e : d [ c ]=d [ c ] + 1 r e t u r nd

Thisfunctionalsoworksforlists,tuples,andevendictionaries,aslongastheelementsof s arehashable,sotheycanbeusedaskeysin d .
en.wikibooks.org/wiki/Think_Python/Print_version 182/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

> > >t=[ ' s p a m ' ,' e g g ' ,' s p a m ' ,' s p a m ' ,' b a c o n ' ,' s p a m ' ] > > >h i s t o g r a m ( t ) { ' b a c o n ' :1 ,' e g g ' :1 ,' s p a m ' :4 }

Functionsthatcanworkwithseveraltypesarecalled polymorphic.Polymorphismcanfacilitatecodereuse.Forexample,thebuiltinfunction s u m ,whichadds theelementsofasequence,worksaslongastheelementsofthesequencesupportaddition. SinceTimeobjectsprovidean a d d method,theyworkwith s u m :


> > >t 1=T i m e ( 7 ,4 3 ) > > >t 2=T i m e ( 7 ,4 1 ) > > >t 3=T i m e ( 7 ,3 7 ) > > >t o t a l=s u m ( [ t 1 ,t 2 ,t 3 ] ) > > >p r i n tt o t a l 2 3 : 0 1 : 0 0

Ingeneral,ifalloftheoperationsinsideafunctionworkwithagiventype,thenthefunctionworkswiththattype. Thebestkindofpolymorphismistheunintentionalkind,whereyoudiscoverthatafunctionyoualreadywrotecanbeappliedtoatypeyouneverplannedfor.

Debugging
Itislegaltoaddattributestoobjectsatanypointintheexecutionofaprogram,butifyouareasticklerfortypetheory,itisadubiouspracticetohaveobjects ofthesametypewithdifferentattributesets.Itisusuallyagoodideatoinitializeallofanobjectsattributesintheinitmethod. Ifyouarenotsurewhetheranobjecthasaparticularattribute,youcanusethebuiltinfunction h a s a t t r (seeSection15.7). Anotherwaytoaccesstheattributesofanobjectisthroughthespecialattribute _ _ d i c t _ _ ,whichisadictionarythatmapsattributenames(asstrings)and values:
> > >p=P o i n t ( 3 ,4 ) > > >p r i n tp . _ _ d i c t _ _ { ' y ' :4 ,' x ' :3 }

Forpurposesofdebugging,youmightfinditusefultokeepthisfunctionhandy:
d e fp r i n t _ a t t r i b u t e s ( o b j ) : f o ra t t ri no b j . _ _ d i c t _ _ : p r i n ta t t r ,g e t a t t r ( o b j ,a t t r )
p r i n t _ a t t r i b u t e s traversestheitemsintheobjectsdictionaryandprintseachattributenameanditscorrespondingvalue.
en.wikibooks.org/wiki/Think_Python/Print_version 183/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thebuiltinfunction g e t a t t r takesanobjectandanattributename(asastring)andreturnstheattributesvalue.

Glossary
objectorientedlanguage: Alanguagethatprovidesfeatures,suchasuserdefinedclassesandmethodsyntax,thatfacilitateobjectorientedprogramming. objectorientedprogramming: Astyleofprogramminginwhichdataandtheoperationsthatmanipulateitareorganizedintoclassesandmethods. method: Afunctionthatisdefinedinsideaclassdefinitionandisinvokedoninstancesofthatclass. subject: Theobjectamethodisinvokedon. operatoroverloading: Changingthebehaviorofanoperatorlike + soitworkswithauserdefinedtype. typebaseddispatch: Aprogrammingpatternthatchecksthetypeofanoperandandinvokesdifferentfunctionsfordifferenttypes. polymorphic: Pertainingtoafunctionthatcanworkwithmorethanonetype.

Exercises
Exercise6
Thisexerciseisacautionarytaleaboutoneofthemost common,anddifficulttofind,errorsinPython. Writeadefinitionforaclassnamed'K a n g a r o o 'withthefollowing methods: An _ _ i n i t _ _ methodthatinitializesanattributenamed p o u c h _ c o n t e n t s toanemptylist. Amethodnamed p u t _ i n _ p o u c h thattakesanobjectofanytypeandaddsitto p o u c h _ c o n t e n t s . A_ _ s t r _ _ methodthatreturnsastringrepresentationoftheKangarooobjectandthecontentsofthepouch. Testyourcodebycreatingtwo'''K a n g a r o o '''objects,assigningthemtovariablesnamed'''k a n g a '''and'''r o o ''',andthenadding'''r o o '''tothecontentsof'''k a n g a '''s pouch.' 'Download'''t h i n k p y t h o n . c o m / c o d e / B a d K a n g a r o o . p y '''.Itcontains
en.wikibooks.org/wiki/Think_Python/Print_version 184/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

asolutiontothepreviousproblemwithonebig,nastybug.Findandfixthebug.''Ifyougetstuck,youcandownload'''t h i n k p y t h o n . c o m / c o d e / G o o d K a n g a r o o . p y ''', whichexplainstheproblemanddemonstratesasolution.'

Exercise7
VisualisaPythonmodulethatprovides3Dgraphics.ItisnotalwaysincludedinaPythoninstallation,soyoumighthavetoinstallitfromyoursoftware repositoryor,ifitsnotthere,from'v p y t h o n . o r g '. Thefollowingexamplecreatesa3Dspacethatis256unitswide,longandhigh,andsetsthecentertobethepoint'(128,128,128)'.Thenitdrawsablue sphere.
' ' f r o mv i s u a li m p o r t* s c e n e . r a n g e=( 2 5 6 ,2 5 6 ,2 5 6 ) s c e n e . c e n t e r=( 1 2 8 ,1 2 8 ,1 2 8 ) c o l o r=( 0 . 1 ,0 . 1 ,0 . 9 ) #m o s t l yb l u e s p h e r e ( p o s = s c e n e . c e n t e r ,r a d i u s = 1 2 8 ,c o l o r = c o l o r ) ' '
c o l o r ''isanRGBtuplethatis,theelementsareRedGreenBluelevelsbetween0.0and1.0(see'w i k i p e d i a . o r g / w i k i / R G B _ c o l o r _ m o d e l ').

Ifyourunthiscode,youshouldseeawindowwithablackbackgroundandabluesphere.Ifyoudragthemiddlebuttonupanddown,youcanzoominand out.Youcanalsorotatethescenebydraggingtherightbutton,butwithonlyonesphereintheworld,itishardtotellthedifference. Thefollowingloopcreatesacubeofspheres:


' ' t=r a n g e ( 0 ,2 5 6 ,5 1 ) f o rxi nt : f o ryi nt : f o rzi nt : p o s=x ,y ,z s p h e r e ( p o s = p o s ,r a d i u s = 1 0 ,c o l o r = c o l o r ) ' '

Putthiscodeinascriptandmakesureitworksfor you. Modifytheprogramsothateachsphereinthecube hasthecolorthatcorrespondstoitspositioninRGBspace.Noticethatthecoordinatesareintherange0255,buttheRGBtuplesareintherange0.01.0. Download't h i n k p y t h o n . c o m / c o d e / c o l o r _ l i s t . p y '


en.wikibooks.org/wiki/Think_Python/Print_version 185/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

andusethefunction r e a d _ c o l o r s togeneratealistoftheavailablecolorsonyoursystem,theirnamesandRGBvalues.Foreachnamedcolordrawaspherein thepositionthatcorrespondstoitsRGBvalues. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / c o l o r _ s p a c e . p y '.

Furtherreading
Wikipedia:VPython Wikipedia:RGBcolormodel

Inheritance
Inthischapterwewilldevelopclassestorepresentplayingcards,decksofcards,andpokerhands.Ifyoudontplaypoker,youcanreadaboutitat w i k i p e d i a . o r g / w i k i / P o k e r (http://en.wikipedia.org/wiki/Poker),butyoudon'thavetoI'lltellyouwhatyouneedtoknowfortheexercises. IfyouarenotfamiliarwithAngloAmericanplayingcards,youcanreadaboutthemat w i k i p e d i a . o r g / w i k i / P l a y i n g _ c a r d s (http://en.wikipedia.org/wiki/Playing_cards).

Cardobjects
Therearefiftytwocardsinadeck,eachofwhichbelongstooneoffoursuitsandoneofthirteenranks.ThesuitsareSpades,Hearts,Diamonds,andClubs (indescendingorderinbridge).TheranksareAce,2,3,4,5,6,7,8,9,10,Jack,Queen,andKing.Dependingonthegamethatyouareplaying,anAcemay behigherthanKingorlowerthan2. Ifwewanttodefineanewobjecttorepresentaplayingcard,itisobviouswhattheattributesshouldbe: r a n k and s u i t .Itisnotasobviouswhattypethe attributesshouldbe.Onepossibilityistousestringscontainingwordslike ' S p a d e ' forsuitsand ' Q u e e n ' forranks.Oneproblemwiththisimplementationisthatit wouldnotbeeasytocomparecardstoseewhichhadahigherrankorsuit. Analternativeistouseintegersto encodetheranksandsuits.Inthiscontext,encodemeansthatwearegoingtodefineamappingbetweennumbersand suits,orbetweennumbersandranks.Thiskindofencodingisnotmeanttobeasecret(thatwouldbeencryption). Forexample,thistableshowsthesuitsandthecorrespondingintegercodes: Spades Hearts 3 2

Diamonds 1 Clubs 0

Thiscodemakesiteasytocomparecardsbecausehighersuitsmaptohighernumbers,wecancomparesuitsbycomparingtheircodes. Themappingforranksisfairlyobviouseachofthenumericalranksmapstothecorrespondinginteger,andforfacecards:
en.wikibooks.org/wiki/Think_Python/Print_version 186/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Jack

11

Queen 12 King 13

Iamusingthe symboltomakeisclearthatthesemappingsarenotpartofthePythonprogram.Theyarepartoftheprogramdesign,buttheydontappear explicitlyinthecode. Theclassdefinitionfor C a r d lookslikethis:


c l a s sC a r d : " " " r e p r e s e n t sas t a n d a r dp l a y i n gc a r d . " " " d e f_ _ i n i t _ _ ( s e l f ,s u i t = 0 ,r a n k = 2 ) : s e l f . s u i t=s u i t s e l f . r a n k=r a n k

Asusual,theinitmethodtakesanoptionalparameterforeachattribute.Thedefaultcardisthe2ofClubs. TocreateaCard,youcall C a r d withthesuitandrankofthecardyouwant.


q u e e n _ o f _ d i a m o n d s=C a r d ( 1 ,1 2 )

Classattributes
InordertoprintCardobjectsinawaythatpeoplecaneasilyread,weneedamappingfromtheintegercodestothecorrespondingranksandsuits.Anatural waytodothatiswithlistsofstrings.Weassigntheseliststo classattributes:
#i n s i d ec l a s sC a r d : s u i t _ n a m e s=[ ' C l u b s ' ,' D i a m o n d s ' ,' H e a r t s ' ,' S p a d e s ' ] r a n k _ n a m e s=[ N o n e ,' A c e ' ,' 2 ' ,' 3 ' ,' 4 ' ,' 5 ' ,' 6 ' ,' 7 ' , ' 8 ' ,' 9 ' ,' 1 0 ' ,' J a c k ' ,' Q u e e n ' ,' K i n g ' ] d e f_ _ s t r _ _ ( s e l f ) : r e t u r n' % so f% s '%( C a r d . r a n k _ n a m e s [ s e l f . r a n k ] , C a r d . s u i t _ n a m e s [ s e l f . s u i t ] )

Variableslike s u i t _ n a m e s and r a n k _ n a m e s ,whicharedefinedinsideaclassbutoutsideofanymethod,arecalledclassattributesbecausetheyareassociatedwith theclassobject C a r d . Thistermdistinguishedthemfromvariableslike s u i t and r a n k ,whicharecalled instanceattributesbecausetheyareassociatedwithaparticularinstance.


en.wikibooks.org/wiki/Think_Python/Print_version 187/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Bothkindsofattributeareaccessedusingdotnotation.Forexample,in _ _ s t r _ _ , s e l f isaCardobject,and s e l f . r a n k isitsrank.Similarly, C a r d isaclassobject, and C a r d . r a n k _ n a m e s isalistofstringsassociatedwiththeclass. Everycardhasitsown s u i t and r a n k ,butthereisonlyonecopyof s u i t _ n a m e s and r a n k _ n a m e s . Puttingitalltogether,theexpression C a r d . r a n k _ n a m e s [ s e l f . r a n k ] meansusetheattribute r a n k fromtheobject s e l f asanindexintothelist r a n k _ n a m e s fromtheclass C a r d ,andselecttheappropriatestring. Thefirstelementof r a n k _ n a m e s is N o n e becausethereisnocardwithrankzero.Byincluding N o n e asaplacekeeper,wegetamappingwiththenicepropertythat theindex2mapstothestring ' 2 ' ,andsoon.Toavoidthistweak,wecouldhaveusedadictionaryinsteadofalist. Withthemethodswehavesofar,wecancreateandprintcards:
> > >c a r d 1=C a r d ( 2 ,1 1 ) > > >p r i n tc a r d 1 J a c ko fH e a r t s

Hereisadiagramthatshowsthe C a r d classobjectandoneCardinstance: <IMGSRC="book026.png">


C a r d isaclassobject,soithastype t y p e . c a r d 1 hastype C a r d .(Tosavespace,Ididntdrawthecontentsof s u i t _ n a m e s and r a n k _ n a m e s ).

Comparingcards
Forbuiltintypes,thereareconditionaloperators(< , > , = = ,etc.)thatcomparevaluesanddeterminewhenoneisgreaterthan,lessthan,orequaltoanother. Foruserdefinedtypes,wecanoverridethebehaviorofthebuiltinoperatorsbyprovidingamethodnamed _ _ c m p _ _ .
_ _ c m p _ _ takestwoparameters, s e l f and o t h e r ,andreturnsapositivenumberifthefirstobjectisgreater,anegativenumberifthesecondobjectisgreater,and0

iftheyareequaltoeachother. Thecorrectorderingforcardsisnotobvious.Forexample,whichisbetter,the3ofClubsorthe2ofDiamonds?Onehasahigherrank,buttheotherhasa highersuit.Inordertocomparecards,youhavetodecidewhetherrankorsuitismoreimportant. Theanswermightdependonwhatgameyouareplaying,buttokeepthingssimple,wellmakethearbitrarychoicethatsuitismoreimportant,soallofthe SpadesoutrankalloftheDiamonds,andsoon. Withthatdecided,wecanwrite _ _ c m p _ _ :


#i n s i d ec l a s sC a r d : d e f_ _ c m p _ _ ( s e l f ,o t h e r ) : #c h e c kt h es u i t s i fs e l f . s u i t>o t h e r . s u i t :r e t u r n1
en.wikibooks.org/wiki/Think_Python/Print_version 188/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

i fs e l f . s u i t<o t h e r . s u i t :r e t u r n1 #s u i t sa r et h es a m e . . .c h e c kr a n k s i fs e l f . r a n k>o t h e r . r a n k :r e t u r n1 i fs e l f . r a n k<o t h e r . r a n k :r e t u r n1 #r a n k sa r et h es a m e . . .i t ' sat i e r e t u r n0

Youcanwritethismoreconciselyusingtuplecomparison:
#i n s i d ec l a s sC a r d : d e f_ _ c m p _ _ ( s e l f ,o t h e r ) : t 1=s e l f . s u i t ,s e l f . r a n k t 2=o t h e r . s u i t ,o t h e r . r a n k r e t u r nc m p ( t 1 ,t 2 )

Thebuiltinfunction c m p hasthesameinterfaceasthemethod _ _ c m p _ _ :ittakestwovaluesandreturnsapositivenumberifthefirstislarger,anegativenumber ofthesecondislarger,and0iftheyareequal.

Exercise1
Writea _ _ c m p _ _ methodforTimeobjects.Hint:youcanusetuplecomparison,butyoualsomightconsiderusingintegersubtraction.

Decks
NowthatwehaveCards,thenextstepistodefineDecks.Sinceadeckismadeupofcards,itisnaturalforeachDecktocontainalistofcardsasan attribute. Thefollowingisaclassdefinitionfor D e c k .Theinitmethodcreatestheattribute c a r d s andgeneratesthestandardsetoffiftytwocards:
c l a s sD e c k : d e f_ _ i n i t _ _ ( s e l f ) : s e l f . c a r d s=[ ] f o rs u i ti nr a n g e ( 4 ) : f o rr a n ki nr a n g e ( 1 ,1 4 ) : c a r d=C a r d ( s u i t ,r a n k ) s e l f . c a r d s . a p p e n d ( c a r d )

Theeasiestwaytopopulatethedeckiswithanestedloop.Theouterloopenumeratesthesuitsfrom0to3.Theinnerloopenumeratestheranksfrom1to 13.EachiterationcreatesanewCardwiththecurrentsuitandrank,andappendsitto s e l f . c a r d s .
en.wikibooks.org/wiki/Think_Python/Print_version 189/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Printingthedeck
Hereisa _ _ s t r _ _ methodfor D e c k :
# i n s i d ec l a s sD e c k : d e f_ _ s t r _ _ ( s e l f ) : r e s=[ s t r ( c a r d )f o rc a r di ns e l f . c a r d s ] r e t u r n' \ n ' . j o i n ( r e s )

Thismethoddemonstratesanefficientwaytoaccumulatealargestring:buildingalistofstringsandthenusing j o i n .Thebuiltinfunction s t r invokesthe _ _ s t r _ _ methodoneachcardandreturnsthestringrepresentation. Sinceweinvoke j o i n onanewlinecharacter,thecardsareseparatedbynewlines.Hereswhattheresultlookslike:


> > >d e c k=D e c k ( ) > > >p r i n td e c k A c eo fC l u b s 2o fC l u b s 3o fC l u b s . . . 1 0o fS p a d e s J a c ko fS p a d e s Q u e e no fS p a d e s K i n go fS p a d e s

Eventhoughtheresultappearson52lines,itisonelongstringthatcontainsnewlines.

Add,remove,shuffleandsort
Todealcards,wewouldlikeamethodthatremovesacardfromthedeckandreturnsit.Thelistmethod p o p providesaconvenientwaytodothat:
# i n s i d ec l a s sD e c k : d e fp o p _ c a r d ( s e l f ) : r e t u r ns e l f . c a r d s . p o p ( )

Since p o p removesthe last cardinthelist,wearedealingfromthebottomofthedeck.Inreallifebottomdealingisfrownedupon1,butinthiscontextitsok. Toaddacard,wecanusethelistmethod a p p e n d :


# i n s i d ec l a s sD e c k :
en.wikibooks.org/wiki/Think_Python/Print_version 190/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fa d d _ c a r d ( s e l f ,c a r d ) : s e l f . c a r d s . a p p e n d ( c a r d )

Amethodlikethisthatusesanotherfunctionwithoutdoingmuchrealworkissometimescalleda veneer.Themetaphorcomesfromwoodworking,whereitis commontoglueathinlayerofgoodqualitywoodtothesurfaceofacheaperpieceofwood. Inthiscasewearedefiningathinmethodthatexpressesalistoperationintermsthatareappropriatefordecks. Asanotherexample,wecanwriteaDeckmethodnamed s h u f f l e usingthefunction s h u f f l e fromthe r a n d o m module:


#i n s i d ec l a s sD e c k : d e fs h u f f l e ( s e l f ) : r a n d o m . s h u f f l e ( s e l f . c a r d s )

Dontforgettoimport r a n d o m .

Exercise2
WriteaDeckmethodnamed's o r t 'thatusesthelistmethod's o r t 'tosortthecardsina'D e c k '.'s o r t 'usesthe _ _ c m p _ _ methodwedefinedtodeterminesortorder.

Inheritance
Thelanguagefeaturemostoftenassociatedwithobjectorientedprogrammingis inheritance.Inheritanceistheabilitytodefineanewclassthatisamodified versionofanexistingclass. Itiscalledinheritancebecausethenewclassinheritsthemethodsoftheexistingclass.Extendingthismetaphor,theexistingclassiscalledthe parentand thenewclassiscalledthe child. Asanexample,letssaywewantaclasstorepresentahand,thatis,thesetofcardsheldbyoneplayer.Ahandissimilartoadeck:botharemadeupofa setofcards,andbothrequireoperationslikeaddingandremovingcards. Ahandisalsodifferentfromadeckthereareoperationswewantforhandsthatdontmakesenseforadeck.Forexample,inpokerwemightcomparetwo handstoseewhichonewins.Inbridge,wemightcomputeascoreforahandinordertomakeabid. Thisrelationshipbetweenclassessimilar,butdifferentlendsitselftoinheritance. Thedefinitionofachildclassislikeotherclassdefinitions,butthenameoftheparentclassappearsinparentheses:
c l a s sH a n d ( D e c k ) : " " " r e p r e s e n t sah a n do fp l a y i n gc a r d s " " "

en.wikibooks.org/wiki/Think_Python/Print_version

191/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Thisdefinitionindicatesthat H a n d inheritsfrom D e c k thatmeanswecanusemethodslike p o p _ c a r d and a d d _ c a r d forHandsaswellasDecks.


H a n d alsoinherits _ _ i n i t _ _ from D e c k ,butitdoesntreallydowhatwewant:insteadofpopulatingthehandwith52newcards,theinitmethodforHandsshould

initialize c a r d s withanemptylist. Ifweprovideaninitmethodinthe H a n d class,itoverridestheoneinthe D e c k class:


#i n s i d ec l a s sH a n d : d e f_ _ i n i t _ _ ( s e l f ,l a b e l = ' ' ) : s e l f . c a r d s=[ ] s e l f . l a b e l=l a b e l

SowhenyoucreateaHand,Pythoninvokesthisinitmethod:
> > >h a n d=H a n d ( ' n e wh a n d ' ) > > >p r i n th a n d . c a r d s [ ] > > >p r i n th a n d . l a b e l n e wh a n d

Buttheothermethodsareinheritedfrom D e c k ,sowecanuse p o p _ c a r d and a d d _ c a r d todealacard:


> > >d e c k=D e c k ( ) > > >c a r d=d e c k . p o p _ c a r d ( ) > > >h a n d . a d d _ c a r d ( c a r d ) > > >p r i n th a n d K i n go fS p a d e s

Anaturalnextstepistoencapsulatethiscodeinamethodcalled m o v e _ c a r d s :
# i n s i d ec l a s sD e c k : d e fm o v e _ c a r d s ( s e l f ,h a n d ,n u m ) : f o rii nr a n g e ( n u m ) : h a n d . a d d _ c a r d ( s e l f . p o p _ c a r d ( ) )
m o v e _ c a r d s takestwoarguments,aHandobjectandthenumberofcardstodeal.Itmodifiesboth s e l f and h a n d ,andreturns N o n e .

Insomegames,cardsaremovedfromonehandtoanother,orfromahandbacktothedeck.Youcanuse m o v e _ c a r d s foranyoftheseoperations: s e l f canbe eitheraDeckoraHand,and h a n d ,despitethename,canalsobea D e c k .

en.wikibooks.org/wiki/Think_Python/Print_version

192/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise3 WriteaDeckmethodcalled d e a l _ h a n d s thattakestwoparameters,thenumberofhandsandthenumberofcardsperhand,andthatcreatesnewHandobjects, dealstheappropriatenumberofcardsperhand,andreturnsalistofHandobjects. Inheritanceisausefulfeature.Someprogramsthatwouldberepetitivewithoutinheritancecanbewrittenmoreelegantlywithit.Inheritancecanfacilitate codereuse,sinceyoucancustomizethebehaviorofparentclasseswithouthavingtomodifythem.Insomecases,theinheritancestructurereflectsthenatural structureoftheproblem,whichmakestheprogrameasiertounderstand. Ontheotherhand,inheritancecanmakeprogramsdifficulttoread.Whenamethodisinvoked,itissometimesnotclearwheretofinditsdefinition.The relevantcodemaybescatteredamongseveralmodules.Also,manyofthethingsthatcanbedoneusinginheritancecanbedoneaswellorbetterwithoutit.

Classdiagrams
Sofarwehaveseenstackdiagrams,whichshowthestateofaprogram,andobjectdiagrams,whichshowtheattributesofanobjectandtheirvalues.These diagramsrepresentasnapshotintheexecutionofaprogram,sotheychangeastheprogramruns. Theyarealsohighlydetailedforsomepurposes,toodetailed.Aclassdiagramsisamoreabstractrepresentationofthestructureofaprogram.Insteadof showingindividualobjects,itshowsclassesandtherelationshipsbetweenthem. Thereareseveralkindsofrelationshipbetweenclasses: Objectsinoneclassmightcontainreferencestoobjectsinanotherclass.Forexample,eachRectanglecontainsareferencetoaPoint,andeachDeck containsreferencestomanyCards.Thiskindofrelationshipiscalled HASA,asin,aRectanglehasaPoint. Oneclassmightinheritfromanother.Thisrelationshipiscalled ISA,asin,aHandisakindofaDeck. Oneclassmightdependonanotherinthesensethatchangesinoneclasswouldrequirechangesintheother. A classdiagramisagraphicalrepresentationoftheserelationships2.Forexample,thisdiagramshowstherelationshipsbetween C a r d , D e c k and H a n d . <IMGSRC="book027.png"> ThearrowwithahollowtriangleheadrepresentsanISArelationshipinthiscaseitindicatesthatHandinheritsfromDeck. ThestandardarrowheadrepresentsaHASArelationshipinthiscaseaDeckhasreferencestoCardobjects. Thestar(* )nearthearrowheadisa multiplicityitindicateshowmanyCardsaDeckhas.Amultiplicitycanbeasimplenumber,like 5 2 ,arange,like 5 . . 7 or astar,whichindicatesthataDeckcanhaveanynumberofCards. AmoredetaileddiagrammightshowthataDeckactuallycontainsa list ofCards,butbuiltintypeslikelistanddictareusuallynotincludedinclassdiagrams.

Exercise4
Read'T u r t l e W o r l d . p y ','W o r l d . p y 'and'G u i . p y 'anddrawaclassdiagramthatshowstherelationshipsamongtheclassesdefinedthere.
en.wikibooks.org/wiki/Think_Python/Print_version 193/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Debugging
Inheritancecanmakedebuggingachallengebecausewhenyouinvokeamethodonanobject,youmightnotknowwhichmethodwillbeinvoked. SupposeyouarewritingafunctionthatworkswithHandobjects.YouwouldlikeittoworkwithallkindsofHands,likePokerHands,BridgeHands,etc.Ifyou invokeamethodlike s h u f f l e ,youmightgettheonedefinedin D e c k ,butifanyofthesubclassesoverridethismethod,youllgetthatversioninstead. Anytimeyouareunsureabouttheflowofexecutionthroughyourprogram,thesimplestsolutionistoaddprintstatementsatthebeginningoftherelevant methods.If D e c k . s h u f f l e printsamessagethatsayssomethinglike R u n n i n gD e c k . s h u f f l e ,thenastheprogramrunsittracestheflowofexecution. Asanalternative,youcouldusethisfunction,whichtakesanobjectandamethodname(asastring)andreturnstheclassthatprovidesthedefinitionofthe method:
d e ff i n d _ d e f i n i n g _ c l a s s ( o b j ,m e t h _ n a m e ) : f o rt yi nt y p e ( o b j ) . m r o ( ) : i fm e t h _ n a m ei nt y . _ _ d i c t _ _ : r e t u r nt y

Heresanexample:
> > >h a n d=H a n d ( ) > > >p r i n tf i n d _ d e f i n i n g _ c l a s s ( h a n d ,' s h u f f l e ' ) < c l a s s' C a r d . D e c k ' >

Sothe s h u f f l e methodforthisHandistheonein D e c k .
f i n d _ d e f i n i n g _ c l a s s usesthe m r o methodtogetthelistofclassobjects(types)thatwillbesearchedformethods.MROstandsformethodresolutionorder.

Heresaprogramdesignsuggestion:wheneveryouoverrideamethod,theinterfaceofthenewmethodshouldbethesameastheold.Itshouldtakethe sameparameters,returnthesametype,andobeythesamepreconditionsandpostconditions.Ifyouobeythisrule,youwillfindthatanyfunctiondesignedto workwithaninstanceofasuperclass,likeaDeck,willalsoworkwithinstancesofsubclasseslikeaHandorPokerHand. Ifyouviolatethisrule,yourcodewillcollapselike(sorry)ahouseofcards.

Glossary
encode: Torepresentonesetofvaluesusinganothersetofvaluesbyconstructingamappingbetweenthem. classattribute: Anattributeassociatedwithaclassobject.Classattributesaredefinedinsideaclassdefinitionbutoutsideanymethod. instanceattribute: Anattributeassociatedwithaninstanceofaclass.
en.wikibooks.org/wiki/Think_Python/Print_version 194/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

veneer: Amethodorfunctionthatprovidesadifferentinterfacetoanotherfunctionwithoutdoingmuchcomputation. inheritance: Theabilitytodefineanewclassthatisamodifiedversionofapreviouslydefinedclass. parentclass: Theclassfromwhichachildclassinherits. childclass: Anewclasscreatedbyinheritingfromanexistingclassalsocalledasubclass. ISArelationship: Therelationshipbetweenachildclassanditsparentclass. HASArelationship: Therelationshipbetweentwoclasseswhereinstancesofoneclasscontainreferencestoinstancesoftheother. classdiagram: Adiagramthatshowstheclassesinaprogramandtherelationshipsbetweenthem. multiplicity: Anotationinaclassdiagramthatshows,foraHASArelationship,howmanyreferencestherearetoinstancesofanotherclass.

Exercises
Exercise5
Thefollowingarethepossiblehandsinpoker,inincreasingorderofvalue(anddecreasingorderofprobability): pair: twocardswiththesamerank ''twopair:'' twopairsofcardswiththesamerank ''threeofakind:'' threecardswiththesamerank ''straight:'' fivecardswithranksinsequence(acescanbehighorlow,so'A c e 2 3 4 5 'isastraightandsois'1 0 J a c k Q u e e n K i n g A c e ',but'Q u e e n K i n g A c e 2 3 'isnot.) ''flush:'' fivecardswiththesamesuit ''fullhouse:'' threecardswithonerank,twocardswithanother ''fourofakind:''
en.wikibooks.org/wiki/Think_Python/Print_version 195/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

fourcardswiththesamerank ''straightflush:'' fivecardsinsequence(asdefinedabove)andwiththesamesuit Thegoaloftheseexercisesistoestimatetheprobabilityofdrawingthesevarioushands. Downloadthefollowingfilesfrom't h i n k p y t h o n . c o m / c o d e ':


C a r d . p y

:Acompleteversionofthe'C a r d ','D e c k 'and'H a n d 'classesinthischapter. ''P o k e r H a n d . p y '' :Anincompleteimplementationofaclass thatrepresentsapokerhand,andsomecodethattestsit. 'Ifyourun'''P o k e r H a n d . p y ''',itdealssix7cardpokerhands andcheckstoseeifanyofthemcontainsaflush.Readthiscodecarefullybeforeyougoon.' 'Addmethodsto'''P o k e r H a n d . p y ''' named'' h a s _ p a i r ' ', '' h a s _ t w o p a i r ' ',etc.thatreturnTrueorFalseaccordingtowhetherornotthehandmeetstherelevantcriteria.Yourcodeshouldworkcorrectlyforhandsthat containanynumberofcards(although5and7arethemostcommonsizes).' 'Writeamethodnamed'''c l a s s i f y ''' thatfiguresout thehighestvalueclassificationforahandandsetsthe'''l a b e l '''attributeaccordingly.Forexample,a7cardhandmightcontainaflushandapairitshouldbe labeledflush.' 'Whenyouareconvincedthatyourclassificationmethodsare working,thenextstepistoestimatetheprobabilitiesofthevarioushands.Writeafunctionin'''P o k e r H a n d . p y '''thatshufflesadeckofcards,dividesitintohands, classifiesthehands,andcountsthenumberoftimesvariousclassificationsappear.' 'Printatableoftheclassificationsandtheirprobabilities. Runyourprogramwithlargerandlargernumbersofhandsuntiltheoutputvaluesconvergetoareasonabledegreeofaccuracy.Compareyourresultstothe valuesat'''w i k i p e d i a . o r g / w i k i / H a n d _ r a n k i n g s '''.'

Exercise6

ThisexerciseusesTurtleWorldfromChapter'4'. YouwillwritecodethatmakesTurtlesplaytag.Ifyouarenotfamiliarwiththerulesoftag,see en.wikibooks.org/wiki/Think_Python/Print_version

196/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

ThisexerciseusesTurtleWorldfromChapter'4'. YouwillwritecodethatmakesTurtlesplaytag.Ifyouarenotfamiliarwiththerulesoftag,see 'w i k i p e d i a . o r g / w i k i / T a g _ ( g a m e ) '. Download't h i n k p y t h o n . c o m / c o d e / W o b b l e r . p y 'andrunit.You shouldseeaTurtleWorldwiththreeTurtles.Ifyoupressthe'Run'button,theTurtleswanderatrandom. Readthecodeandmakesureyouunderstandhowitworks. The'W o b b l e r 'classinheritsfrom'T u r t l e ',whichmeansthatthe'T u r t l e 'methods'l t ','r t ','f d 'and'b k 'workonWobblers. The's t e p 'methodgetsinvokedby TurtleWorld.Itinvokes's t e e r ',whichturnstheTurtleinthedesireddirection,'w o b b l e ',whichmakesarandomturninproportiontotheTurtlesclumsiness,and 'm o v e ',whichmovesforwardafewpixels,dependingontheTurtlesspeed. Createafilenamed'T a g g e r . p y '.Importeverythingfrom 'W o b b l e r ',thendefineaclassnamed'T a g g e r 'thatinheritsfrom'W o b b l e r '.Call m a k e _ w o r l d passingthe'T a g g e r 'classobjectasanargument. Adda's t e e r 'methodto'T a g g e r 'tooverridetheonein 'W o b b l e r '.Asastartingplace,writeaversionthatalwayspointstheTurtletowardtheorigin.Hint:usethemathfunction'a t a n 2 'andtheTurtleattributes'x ','y 'and 'h e a d i n g '. Modify's t e e r 'sothattheTurtlesstayinbounds. Fordebugging,youmightwanttousethe'Step'button,whichinvokes's t e p 'onceoneachTurtle. Modify's t e e r 'sothateachTurtlepointstowarditsnearest neighbor.Hint:Turtleshaveanattribute,'w o r l d ',thatisareferencetotheTurtleWorldtheylivein,andtheTurtleWorldhasanattribute,'a n i m a l s ',thatisalistof allTurtlesintheworld. Modify's t e e r 'sotheTurtlesplaytag.Youcanaddmethods to'T a g g e r 'andyoucanoverride's t e e r 'and _ _ i n i t _ _ ,butyoumaynotmodifyoroverride's t e p ','w o b b l e 'or'm o v e '.Also,'s t e e r 'isallowedtochangetheheadingofthe Turtlebutnottheposition. Adjusttherulesandyour's t e e r 'methodforgoodqualityplay forexample,itshouldbepossiblefortheslowTurtletotagthefaster Turtleseventually. Youcangetmysolutionfrom't h i n k p y t h o n . c o m / c o d e / T a g g e r . p y '.

1 See w i k i p e d i a . o r g / w i k i / B o t t o m _ d e a l i n g .
en.wikibooks.org/wiki/Think_Python/Print_version 197/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

2 ThediagramsIamusingherearesimilartoUML(see w i k i p e d i a . o r g / w i k i / U n i f i e d _ M o d e l i n g _ L a n g u a g e ),withafewsimplifications.

Debugging
Differentkindsoferrorscanoccurinaprogram,anditisusefultodistinguishamongtheminordertotrackthemdownmorequickly: SyntaxerrorsareproducedbyPythonwhenitistranslatingthesourcecodeintobytecode.Theyusuallyindicatethatthereissomethingwrongwiththe syntaxoftheprogram.Example:Omittingthecolonattheendofa d e f statementyieldsthesomewhatredundantmessage S y n t a x E r r o r :i n v a l i ds y n t a x . Runtimeerrorsareproducedbytheinterpreterifsomethinggoeswrongwhiletheprogramisrunning.Mostruntimeerrormessagesincludeinformation aboutwheretheerroroccurredandwhatfunctionswereexecuting.Example:Aninfiniterecursioneventuallycausestheruntimeerrormaximum recursiondepthexceeded. Semanticerrorsareproblemswithaprogramthatrunswithoutproducingerrormessagesbutdoesntdotherightthing.Example:Anexpressionmay notbeevaluatedintheorderyouexpect,yieldinganincorrectresult. Thefirststepindebuggingistofigureoutwhichkindoferroryouaredealingwith.Althoughthefollowingsectionsareorganizedbyerrortype,some techniquesareapplicableinmorethanonesituation.

Syntaxerrors
Syntaxerrorsareusuallyeasytofixonceyoufigureoutwhattheyare.Unfortunately,theerrormessagesareoftennothelpful.Themostcommonmessages are S y n t a x E r r o r :i n v a l i ds y n t a x and S y n t a x E r r o r :i n v a l i dt o k e n ,neitherofwhichisveryinformative. Ontheotherhand,themessagedoestellyouwhereintheprogramtheproblemoccurred.Actually,ittellsyouwherePythonnoticedaproblem,whichisnot necessarilywheretheerroris.Sometimestheerrorispriortothelocationoftheerrormessage,oftenontheprecedingline. Ifyouarebuildingtheprogramincrementally,youshouldhaveagoodideaaboutwheretheerroris.Itwillbeinthelastlineyouadded. Ifyouarecopyingcodefromabook,startbycomparingyourcodetothebookscodeverycarefully.Checkeverycharacter.Atthesametime,rememberthat thebookmightbewrong,soifyouseesomethingthatlookslikeasyntaxerror,itmightbe. Herearesomewaystoavoidthemostcommonsyntaxerrors: MakesureyouarenotusingaPythonkeywordforavariablename. Checkthatyouhaveacolonattheendoftheheaderofevery compoundstatement,including f o r , w h i l e , i f ,and d e f statements.

Makesurethatanystringsinthecodehavematching
en.wikibooks.org/wiki/Think_Python/Print_version 198/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

quotationmarks. Ifyouhavemultilinestringswithtriplequotes(singleordouble),make sureyouhaveterminatedthestringproperly.Anunterminatedstringmaycausean i n v a l i dt o k e n errorattheendofyourprogram,oritmaytreatthefollowing partoftheprogramasastringuntilitcomestothenextstring.Inthesecondcase,itmightnotproduceanerrormessageatall!

Anunclosedopeningoperator( , { ,or
[ makesPythoncontinuewiththenextlineaspartofthecurrentstatement.Generally,anerroroccursalmostimmediatelyinthenextline.

Checkfortheclassic = insteadof = = inside aconditional. Checktheindentationtomakesureitlinesupthewayit issupposedto.Pythoncanhandlespaceandtabs,butifyoumixthemitcancauseproblems.Thebestwaytoavoidthisproblemistouseatexteditorthat knowsaboutPythonandgeneratesconsistentindentation. Ifnothingworks,moveontothenextsection...

Ikeepmakingchangesanditmakesnodifference.
Iftheinterpretersaysthereisanerrorandyoudontseeit,thatmightbebecauseyouandtheinterpreterarenotlookingatthesamecode.Checkyour programmingenvironmenttomakesurethattheprogramyouareeditingistheonePythonistryingtorun. Ifyouarenotsure,tryputtinganobviousanddeliberatesyntaxerroratthebeginningoftheprogram.Nowrunitagain.Iftheinterpreterdoesntfindthenew error,youarenotrunningthenewcode. Thereareafewlikelyculprits: Youeditedthefileandforgottosavethechangesbefore runningitagain.Someprogrammingenvironmentsdothisforyou,butsomedont. Youchangedthenameofthefile,butyouarestillrunning theoldname. Somethinginyourdevelopmentenvironmentisconfigured incorrectly.
en.wikibooks.org/wiki/Think_Python/Print_version 199/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Ifyouarewritingamoduleandusing i m p o r t , makesureyoudontgiveyourmodulethesamenameasoneofthestandardPythonmodules.

Ifyouareusing i m p o r t toreadamodule,remember thatyouhavetorestarttheinterpreteroruse r e l o a d toreadamodifiedfile.Ifyouimportthemoduleagain,itdoesntdoanything. Ifyougetstuckandyoucantfigureoutwhatisgoingon,oneapproachistostartagainwithanewprogramlikeHello,World!,andmakesureyoucangeta knownprogramtorun.Thengraduallyaddthepiecesoftheoriginalprogramtothenewone.

Runtimeerrors
Onceyourprogramissyntacticallycorrect,Pythoncancompileitandatleaststartrunningit.Whatcouldpossiblygowrong?

Myprogramdoesabsolutelynothing.
Thisproblemismostcommonwhenyourfileconsistsoffunctionsandclassesbutdoesnotactuallyinvokeanythingtostartexecution.Thismaybeintentional ifyouonlyplantoimportthismoduletosupplyclassesandfunctions. Ifitisnotintentional,makesurethatyouareinvokingafunctiontostartexecution,orexecuteonefromtheinteractiveprompt.AlsoseetheFlowof Executionsectionbelow.

Myprogramhangs.
Ifaprogramstopsandseemstobedoingnothing,itishanging.Oftenthatmeansthatitiscaughtinaninfinitelooporinfiniterecursion. Ifthereisaparticularloopthatyoususpectisthe problem,adda p r i n t statementimmediatelybeforetheloopthatsaysenteringtheloopandanotherimmediatelyafterthatsaysexitingtheloop.Runthe program.Ifyougetthefirstmessageandnotthesecond,youvegotaninfiniteloop.GototheInfiniteLoopsectionbelow. Mostofthetime,aninfiniterecursionwillcausetheprogram torunforawhileandthenproduceaRuntimeError:Maximumrecursiondepthexceedederror.Ifthathappens,gototheInfiniteRecursionsectionbelow.If youarenotgettingthiserrorbutyoususpectthereisaproblemwitharecursivemethodorfunction,youcanstillusethetechniquesintheInfiniteRecursion section. Ifneitherofthosestepsworks,starttestingother

en.wikibooks.org/wiki/Think_Python/Print_version

200/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

loopsandotherrecursivefunctionsandmethods. Ifthatdoesntwork,thenitispossiblethat youdontunderstandtheflowofexecutioninyourprogram.GototheFlowofExecutionsectionbelow. InfiniteLoop Ifyouthinkyouhaveaninfiniteloopandyouthinkyouknowwhatloopiscausingtheproblem,adda p r i n t statementattheendoftheloopthatprintsthe valuesofthevariablesintheconditionandthevalueofthecondition. Forexample:


w h i l ex>0a n dy<0: #d os o m e t h i n gt ox #d os o m e t h i n gt oy p r i n t " x :" ,x p r i n t " y :" ,y p r i n t " c o n d i t i o n :" ,( x>0a n dy<0 )

Nowwhenyouruntheprogram,youwillseethreelinesofoutputforeachtimethroughtheloop.Thelasttimethroughtheloop,theconditionshouldbe f a l s e . Iftheloopkeepsgoing,youwillbeabletoseethevaluesof x and y ,andyoumightfigureoutwhytheyarenotbeingupdatedcorrectly. InfiniteRecursion Mostofthetime,aninfiniterecursionwillcausetheprogramtorunforawhileandthenproducea M a x i m u mr e c u r s i o nd e p t he x c e e d e d error. Ifyoususpectthatafunctionormethodiscausinganinfiniterecursion,startbycheckingtomakesurethatthereisabasecase.Inotherwords,thereshould besomeconditionthatwillcausethefunctionormethodtoreturnwithoutmakingarecursiveinvocation.Ifnot,thenyouneedtorethinkthealgorithmand identifyabasecase. Ifthereisabasecasebuttheprogramdoesntseemtobereachingit,adda p r i n t statementatthebeginningofthefunctionormethodthatprintsthe parameters.Nowwhenyouruntheprogram,youwillseeafewlinesofoutputeverytimethefunctionormethodisinvoked,andyouwillseetheparameters. Iftheparametersarenotmovingtowardthebasecase,youwillgetsomeideasaboutwhynot. FlowofExecution Ifyouarenotsurehowtheflowofexecutionismovingthroughyourprogram,add p r i n t statementstothebeginningofeachfunctionwithamessagelike enteringfunction f o o ,where f o o isthenameofthefunction. Nowwhenyouruntheprogram,itwillprintatraceofeachfunctionasitisinvoked.
en.wikibooks.org/wiki/Think_Python/Print_version 201/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

WhenIruntheprogramIgetanexception.
Ifsomethinggoeswrongduringruntime,Pythonprintsamessagethatincludesthenameoftheexception,thelineoftheprogramwheretheproblem occurred,andatraceback. Thetracebackidentifiesthefunctionthatiscurrentlyrunning,andthenthefunctionthatinvokedit,andthenthefunctionthatinvoked that ,andsoon.Inother words,ittracesthesequenceoffunctioninvocationsthatgotyoutowhereyouare.Italsoincludesthelinenumberinyourfilewhereeachofthesecalls occurs. Thefirststepistoexaminetheplaceintheprogramwheretheerroroccurredandseeifyoucanfigureoutwhathappened.Thesearesomeofthemost commonruntimeerrors: NameError: Youaretryingtouseavariablethatdoesntexistinthecurrentenvironment.Rememberthatlocalvariablesarelocal.Youcannotrefertothemfrom outsidethefunctionwheretheyaredefined. TypeError: Thereareseveralpossiblecauses: Youaretryingtouseavalueimproperly.Example:indexing astring,list,ortuplewithsomethingotherthananinteger. Thereisamismatchbetweentheitemsinaformatstringand theitemspassedforconversion.Thiscanhappenifeitherthenumberofitemsdoesnotmatchoraninvalidconversioniscalledfor. Youarepassingthewrongnumberofargumentstoafunctionormethod. Formethods,lookatthemethoddefinitionandcheckthatthefirstparameteris s e l f .Thenlookatthemethodinvocationmakesureyouareinvoking themethodonanobjectwiththerighttypeandprovidingtheotherargumentscorrectly. KeyError: Youaretryingtoaccessanelementofadictionaryusingakeythatthedictionarydoesnotcontain. AttributeError: Youaretryingtoaccessanattributeormethodthatdoesnotexist.Checkthespelling!Youcanuse d i r tolisttheattributesthatdoexist.Ifan AttributeErrorindicatesthatanobjecthas N o n e T y p e ,thatmeansthatitis N o n e .Onecommoncauseisforgettingtoreturnavaluefromafunctionifyou gettotheendofafunctionwithouthittinga r e t u r n statement,itreturns N o n e .Anothercommoncauseisusingtheresultfromalistmethod,like s o r t ,that returns N o n e . IndexError: Theindexyouareusingtoaccessalist,string,ortupleisgreaterthanitslengthminusone.Immediatelybeforethesiteoftheerror,adda p r i n t statementtodisplaythevalueoftheindexandthelengthofthearray.Isthearraytherightsize?Istheindextherightvalue?
en.wikibooks.org/wiki/Think_Python/Print_version 202/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

ThePythondebugger(p d b )isusefulfortrackingdownExceptionsbecauseitallowsyoutoexaminethestateoftheprogramimmediatelybeforetheerror.You canreadabout p d b at d o c s . p y t h o n . o r g / l i b / m o d u l e p d b . h t m l . Iaddedsomany p r i n t statementsIgetinundatedwithoutput. Oneoftheproblemswithusing p r i n t statementsfordebuggingisthatyoucanendupburiedinoutput.Therearetwowaystoproceed:simplifytheoutputor simplifytheprogram. Tosimplifytheoutput,youcanremoveorcommentout p r i n t statementsthatarenthelping,orcombinethem,orformattheoutputsoitiseasierto understand. Tosimplifytheprogram,thereareseveralthingsyoucando.First,scaledowntheproblemtheprogramisworkingon.Forexample,ifyouaresearchingalist, searcha smalllist.Iftheprogramtakesinputfromtheuser,giveitthesimplestinputthatcausestheproblem. Second,cleanuptheprogram.Removedeadcodeandreorganizetheprogramtomakeitaseasytoreadaspossible.Forexample,ifyoususpectthatthe problemisinadeeplynestedpartoftheprogram,tryrewritingthatpartwithsimplerstructure.Ifyoususpectalargefunction,trysplittingitintosmaller functionsandtestingthemseparately.

Oftentheprocessoffindingtheminimaltestcaseleadsyoutothebug.Ifyoufindthataprogramworksinonesituationbutnotinanother,thatgivesyoua clueaboutwhatisgoingon. Similarly,rewritingapieceofcodecanhelpyoufindsubtlebugs.Ifyoumakeachangethatyouthinkdoesntaffecttheprogram,anditdoes,thatcantipyou off.

Semanticerrors
Insomeways,semanticerrorsarethehardesttodebug,becausetheinterpreterprovidesnoinformationaboutwhatiswrong.Onlyyouknowwhatthe programissupposedtodo. Thefirststepistomakeaconnectionbetweentheprogramtextandthebehavioryouareseeing.Youneedahypothesisaboutwhattheprogramisactually doing.Oneofthethingsthatmakesthathardisthatcomputersrunsofast. Youwilloftenwishthatyoucouldslowtheprogramdowntohumanspeed,andwithsomedebuggersyoucan.Butthetimeittakestoinsertafewwellplaced p r i n t statementsisoftenshortcomparedtosettingupthedebugger,insertingandremovingbreakpoints,andsteppingtheprogramtowheretheerroris occurring.

Myprogramdoesntwork.
Youshouldaskyourselfthesequestions: Istheresomethingtheprogramwassupposedtodobut
en.wikibooks.org/wiki/Think_Python/Print_version 203/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

whichdoesntseemtobehappening?Findthesectionofthecodethatperformsthatfunctionandmakesureitisexecutingwhenyouthinkitshould. Issomethinghappeningthatshouldnt?Findcodein yourprogramthatperformsthatfunctionandseeifitisexecutingwhenitshouldnt. Isasectionofcodeproducinganeffectthatisnot whatyouexpected?Makesurethatyouunderstandthecodeinquestion,especiallyifitinvolvesinvocationstofunctionsormethodsinotherPythonmodules. Readthedocumentationforthefunctionsyouinvoke.Trythemoutbywritingsimpletestcasesandcheckingtheresults. Inordertoprogram,youneedtohaveamentalmodelofhowprogramswork.Ifyouwriteaprogramthatdoesntdowhatyouexpect,veryoftentheproblem isnotintheprogramitsinyourmentalmodel.

Thebestwaytocorrectyourmentalmodelistobreaktheprogramintoitscomponents(usuallythefunctionsandmethods)andtesteachcomponent independently.Onceyoufindthediscrepancybetweenyourmodelandreality,youcansolvetheproblem. Ofcourse,youshouldbebuildingandtestingcomponentsasyoudeveloptheprogram.Ifyouencounteraproblem,thereshouldbeonlyasmallamountof newcodethatisnotknowntobecorrect.

A.3.2IvegotabighairyexpressionanditdoesntdowhatIexpect.

Writingcomplexexpressionsisfineaslongastheyarereadable,buttheycanbehardtodebug.Itisoftenagoodideatobreakacomplexexpressionintoa seriesofassignmentstotemporaryvariables. Forexample:


s e l f . h a n d s [ i ] . a d d C a r d ( s e l f . h a n d s [ s e l f . f i n d N e i g h b o r ( i ) ] . p o p C a r d ( ) )

Thiscanberewrittenas:
n e i g h b o r=s e l f . f i n d N e i g h b o r ( i ) p i c k e d C a r d=s e l f . h a n d s [ n e i g h b o r ] . p o p C a r d ( ) s e l f . h a n d s [ i ] . a d d C a r d ( p i c k e d C a r d )

Theexplicitversioniseasiertoreadbecausethevariablenamesprovideadditionaldocumentation,anditiseasiertodebugbecauseyoucancheckthetypes oftheintermediatevariablesanddisplaytheirvalues.

en.wikibooks.org/wiki/Think_Python/Print_version

204/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Anotherproblemthatcanoccurwithbigexpressionsisthattheorderofevaluationmaynotbewhatyouexpect.Forexample,ifyouaretranslatingthe expression x/2intoPython,youmightwrite:


y=x/2*m a t h . p i

Thatisnotcorrectbecausemultiplicationanddivisionhavethesameprecedenceandareevaluatedfromlefttoright.Sothisexpressioncomputes x/2. Agoodwaytodebugexpressionsistoaddparenthesestomaketheorderofevaluationexplicit:


y=x/( 2*m a t h . p i )

Wheneveryouarenotsureoftheorderofevaluation,useparentheses.Notonlywilltheprogrambecorrect(inthesenseofdoingwhatyouintended),itwill alsobemorereadableforotherpeoplewhohaventmemorizedtherulesofprecedence.

A.3.3IvegotafunctionormethodthatdoesntreturnwhatIexpect.

Ifyouhavea r e t u r n statementwithacomplexexpression,youdonthaveachancetoprintthe r e t u r n valuebeforereturning.Again,youcanuseatemporary variable.Forexample,insteadof:


r e t u r ns e l f . h a n d s [ i ] . r e m o v e M a t c h e s ( )

youcouldwrite:
c o u n t=s e l f . h a n d s [ i ] . r e m o v e M a t c h e s ( ) r e t u r nc o u n t

Nowyouhavetheopportunitytodisplaythevalueof c o u n t beforereturning.

I'mreally,reallystuckandIneedhelp.
First,trygettingawayfromthecomputerforafewminutes.Computersemitwavesthataffectthebrain,causingthesesymptoms: Frustrationandrage.
en.wikibooks.org/wiki/Think_Python/Print_version 205/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Superstitiousbeliefs(thecomputerhatesme)and magicalthinking(theprogramonlyworkswhenIwearmyhatbackward). Randomwalkprogramming(theattempttoprogrambywriting everypossibleprogramandchoosingtheonethatdoestherightthing). Ifyoufindyourselfsufferingfromanyofthesesymptoms,getupandgoforawalk.Whenyouarecalm,thinkabouttheprogram.Whatisitdoing?Whatare somepossiblecausesofthatbehavior?Whenwasthelasttimeyouhadaworkingprogram,andwhatdidyoudonext? Sometimesitjusttakestimetofindabug.IoftenfindbugswhenIamawayfromthecomputerandletmymindwander.Someofthebestplacestofind bugsaretrains,showers,andinbed,justbeforeyoufallasleep.

No,Ireallyneedhelp.
Ithappens.Eventhebestprogrammersoccasionallygetstuck.Sometimesyouworkonaprogramsolongthatyoucantseetheerror.Afreshpairofeyesis justthething. Beforeyoubringsomeoneelsein,makesureyouareprepared.Yourprogramshouldbeassimpleaspossible,andyoushouldbeworkingonthesmallest inputthatcausestheerror.Youshouldhave p r i n t statementsintheappropriateplaces(andtheoutputtheyproduceshouldbecomprehensible).Youshould understandtheproblemwellenoughtodescribeitconcisely. Whenyoubringsomeoneintohelp,besuretogivethemtheinformationtheyneed: Ifthereisanerrormessage,whatisit andwhatpartoftheprogramdoesitindicate? Whatwasthelastthingyoudidbeforethiserroroccurred? Whatwerethelastlinesofcodethatyouwrote,orwhatisthenewtestcasethatfails? Whathaveyoutriedsofar,andwhathaveyoulearned? Whenyoufindthebug,takeasecondtothinkaboutwhatyoucouldhavedonetofinditfaster.Nexttimeyouseesomethingsimilar,youwillbeabletofind thebugmorequickly. Remember,thegoalisnotjusttomaketheprogramwork.Thegoalistolearnhowtomaketheprogramwork.

Answers
Chapter1
SeebelowforChapter1exercises.
en.wikibooks.org/wiki/Think_Python/Print_version 206/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Exercise1.4
Ifyouruna10kilometerracein43minutes30seconds,whatisyouraveragetimepermile?Whatisyouraveragespeedinmilesperhour?(Hint:thereare 1.61kilometersinamile).
> > >1 0 / 1 . 6 1#C o n v e r tk i l o m e t e r st om i l e s 6 . 2 1 1 1 8 0 1 2 4 2 2 3 6 0 1 8 > > >( 4 3 * 6 0 ) + 3 0#C o n v e r tt i m et os e c o n d s 2 6 1 0 > > >2 6 1 0 / 6 . 2 1 1 1 8 0 1 2 4 2 2 3 6 0 1 8#w h a ti sy o u ra v e r a g et i m e( s e c o n d s )p e rm i l e 4 2 0 . 2 1 0 0 0 0 0 0 0 0 0 0 0 4 > > >4 2 0 . 2 1 0 0 0 0 0 0 0 0 0 0 0 4 / 6 0#w h a ti sy o u ra v e r a g et i m e( m i n u t e s )p e rm i l e 7 . 0 0 3 5 0 0 0 0 0 0 0 0 0 0 0 7 > > >6 0 / 7 . 0 0 3 5 0 0 0 0 0 0 0 0 0 0 0 7#M i l e sp e rh o u r 8 . 5 6 7 1 4 4 9 9 8 9 2 9 1 0 5 5

Comment:Thisisnotvalid,it ONLY worksfor43minand30secondsto10km's.Pythonshouldhaveawaytodothistheproperway. Inordertodothistheproperway,apersonmustdosomethinglikethis. 43*60>converttheminutestoseconds. 2580+30>addtheseconds 2610/10>dividebydistance 261/60>changesecondsintominutes 4.35>istheanswer,nowyoumust .35*60>multiplythenumberafterthedecimalwith60 21seconds.. Endresult=4.21minutesperKM,thistechniqueworksforalldistancesandtimes.

Chapter2
Exercise2.1
Ifyoutypeanintegerwithaleadingzero,youmightgetaconfusingerror:
> > >z i p c o d e=0 2 4 9 2 ^ S y n t a x E r r o r :i n v a l i dt o k e n

Othernumberseemtowork,buttheresultsarebizarre:
> > >z i p c o d e=0 2 1 3 2 > > >p r i n tz i p c o d e 1 1 1 4
en.wikibooks.org/wiki/Think_Python/Print_version 207/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Sopythonisassumingyouwanttoconvertanoctalnumbertoadecimalnumber.Inthebase8numberingsystemwherevalidnumbersare 0,1,2,3,4,5,6 and7.


B a s e 8 :0 00 10 20 30 40 50 60 71 01 11 21 31 41 51 61 72 02 12 22 32 4 B a s e1 0 :0 00 10 20 30 40 50 60 70 80 91 01 11 21 31 41 51 61 71 81 92 0

Every8numbersweincrementthelefthandcolumns.Thismeansthattheleftmostcolumnisthenumberof'ones'.Theonetotherightofthatisatallyof thenumberof'eights',theonenexttothatisatallyofafullcolumnof'eight'timesthe'eightcolumn'64.Theonenexttothatis64*8512andsoon.For moreinformationread[BaseEightmath(http://www4.ncsu.edu/unity/lockers/users/f/felder/public/kenny/papers/bases.html)]. Thatiswhy zipcode=02492isinvalidasthedigit9isnotavalidoctalnumber.Wecandotheconversionmanuallyasfollows:


> > >p r i n t0 2 1 3 2 1 1 1 4 > > >( 2 * 5 1 2 ) + ( 1 * 6 4 ) + ( 3 * 8 ) + ( 2 * 1 ) 1 1 1 4 > > >

Exercise2.4
Thevolumeofaspherewithradius ris 4/3 r3. Whatisthevolumeofaspherewithradius5?
> > >p i=3 . 1 4 1 5 9 2 6 5 3 5 8 9 7 9 3 1 > > >r=5 > > >4 / 3 * p i * r * * 3#T h i si st h ew r o n ga n s w e r 3 9 2 . 6 9 9 0 8 1 6 9 8 7 2 4 1 1 > > >r=5 . 0#R a d i u sc a nb eaf l o a th e r ea sw e l l ,b u ti sn o t_ n e c e s s a r y _ . > > >4 . 0 / 3 . 0 * p i * r * * 3#U s i n gf l o a t sg i v et h ec o r r e c ta n s w e r 5 2 3 . 5 9 8 7 7 5 5 9 8 2 9 8 8 6 > > >

Supposethecoverpriceofabookis$24.95,butbookstoresgeta40%discount.Shippingcosts$3forthefirstcopyand75centsforeachadditionalcopy. Whatisthetotalwholesalecostfor60copies?
$ 2 4 . 9 5 $ 9 . 9 8 $ 1 4 . 9 7 6 0 $ 8 9 8 . 2 0 C o s t D i s c o u n tp e rb o o k C o s tp e rb o o ka f t e rd i s c o u n t T o t a ln u m b e ro fb o o k s T o t a lc o s tn o ti n cd e l i v e r y

$ 3 . 0 0 F i r s tb o o kd e l i v e r y 5 9 R e m a i n i n gb o o k s
en.wikibooks.org/wiki/Think_Python/Print_version 208/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

$ 0 . 7 5 D e l i v e r yc o s tf o re x t r ab o o k s $ 4 4 . 2 5 T o t a lc o s tf o re x t r ab o o k s $ 4 7 . 2 5 T o t a lD e l i v e r yc o s t $ 9 4 5 . 4 5 T o t a lB i l l T h i sa n s w e ri sw r o n gb e c a u s e4 0 . 0 / 1 0 0 . 0r e t u r nw r o n gv a l u e0 . 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2f o rm o r ei n f os e eI E E E7 5 4( S t a n d a r df o rF l o a t i n g P o i n tA r i t h m e t i c ) > > >( 2 4 . 9 5 2 4 . 9 5 * 4 0 . 0 / 1 0 0 . 0 ) * 6 0 + 3 + 0 . 7 5 * ( 6 0 1 ) 9 4 5 . 4 4 9 9 9 9 9 9 9 9 9 9 9 3 > > >2 4 . 9 5 * 0 . 6 * 6 0 + 0 . 7 5 * ( 6 0 1 ) + 3 9 4 5 . 4 5

IfIleavemyhouseat6:52amandrun1mileataneasypace(8:15permile),then3milesattempo(7:12permile)and1mileateasypaceagain,whattime doIgethomeforbreakfast? Answer: 7:30am HowIdidit:


> > >s t a r t=( 6 * 6 0 + 5 2 ) * 6 0 > > >e a s y=( 8 * 6 0 + 1 5 ) * 2 > > >f a s t=( 7 * 6 0 + 1 2 ) * 3 > > >f i n i s h _ h o u r=( s t a r t+e a s y+f a s t ) / ( 6 0 * 6 0 . 0 ) > > >f i n i s h _ f l o o r e d=( s t a r t+e a s y+f a s t ) / ( 6 0 * 6 0 ) # i n t ( )f u n c t i o nc a na l s ob eu s e dt og e ti n t e g e rv a l u e ,b u ti s n ' tt a u g h ty e t . > > >f i n i s h _ m i n u t e =( f i n i s h _ h o u r-f i n i s h _ f l o o r e d ) * 6 0 > > >p r i n t' F i n i s ht i m ew a s% d : % d '%( f i n i s h _ h o u r , f i n i s h _ m i n u t e ) F i n i s ht i m ew a s7 : 3 0 > > >

Chapter3
Exercise3.3
Pythonprovidesabuiltinfunctioncalled lenthatreturnsthelengthofastring,sothevalueoflen('allen')is5.Writeafunctionnamedright_justifythattakesa stringnamed sasaparameterandprintsthestringwithenoughleadingspacessothatthelastletterofthestringisincolumn70ofthedisplay.
> > >d e fr i g h t _ j u s t i f y ( s ) : . . . p r i n t( '' * ( 7 0 l e n ( s ) ) + s ) . . . > > >r i g h t _ j u s t i f y ( ' a l l e n ' ) a l l e n > > >

Exercise3.5
en.wikibooks.org/wiki/Think_Python/Print_version 209/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Youcanseemysolutionat[http://thinkpython.com/code/grid.py].
" " " S o l u t i o nt oE x e r c i s eX . Xo np a g eXo fT h i n kP y t h o n A l l e nB .D o w n e y " " " #h e r ei sam o s t l y s t r a i g h t f o r w a r ds o l u t i o nt ot h e #t w o b y t w ov e r s i o no ft h eg r i d . d e fd o _ t w i c e ( f ) : f ( ) f ( ) d e fd o _ f o u r ( f ) : d o _ t w i c e ( f ) d o _ t w i c e ( f ) d e fp r i n t _ b e a m ( ) : p r i n t' +---' , d e fp r i n t _ p o s t ( ) : p r i n t' | ' , d e fp r i n t _ b e a m s ( ) : d o _ t w i c e ( p r i n t _ b e a m ) p r i n t' + ' d e fp r i n t _ p o s t s ( ) : d o _ t w i c e ( p r i n t _ p o s t ) p r i n t' | ' d e fp r i n t _ r o w ( ) : p r i n t _ b e a m s ( ) d o _ f o u r ( p r i n t _ p o s t ) d e fp r i n t _ g r i d ( ) : d o _ t w i c e ( p r i n t _ r o w ) p r i n t _ b e a m s ( ) p r i n t _ g r i d ( ) _ _ _ _ _ _ _ _ _ _ _ _ # a n o t h e rs o l u t i o n d e fd o _ t w i c e ( f ) : f ( ) f ( ) d e fd o _ f o u r ( f ) : d o _ t w i c e ( f ) d o _ t w i c e ( f ) d e fp r i n t _ c o l u m n ( ) :
en.wikibooks.org/wiki/Think_Python/Print_version 210/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

p r i n t' + + + ' d e fp r i n t _ r o w ( ) : p r i n t' | | | '

d e fp r i n t _ r o w s ( ) : d o _ f o u r ( p r i n t _ r o w ) d e fd o _ b l o c k ( ) : p r i n t _ c o l u m n ( ) p r i n t _ r o w s ( ) d e fp r i n t _ b l o c k ( ) : d o _ t w i c e ( d o _ b l o c k ) p r i n t _ c o l u m n ( ) p r i n t _ b l o c k ( ) # n a t h a nm o s e s g o n z a l e s _ _ _ _ _ _ _ _ _ #h e r ei sal e s s s t r a i g h t f o r w a r ds o l u t i o nt ot h e #f o u r b y f o u rg r i d d e fo n e _ f o u r _ o n e ( f ,g ,h ) : f ( ) d o _ f o u r ( g ) h ( ) d e fp r i n t _ p l u s ( ) : p r i n t' + ' , d e fp r i n t _ d a s h ( ) : p r i n t' ' , d e fp r i n t _ b a r ( ) : p r i n t' | ' , d e fp r i n t _ s p a c e ( ) : p r i n t'' , d e fp r i n t _ e n d ( ) : p r i n t d e fn o t h i n g ( ) : " d on o t h i n g " d e fp r i n t 1 b e a m ( ) : o n e _ f o u r _ o n e ( n o t h i n g ,p r i n t _ d a s h ,p r i n t _ p l u s ) d e fp r i n t 1 p o s t ( ) : o n e _ f o u r _ o n e ( n o t h i n g ,p r i n t _ s p a c e ,p r i n t _ b a r ) d e fp r i n t 4 b e a m s ( ) : o n e _ f o u r _ o n e ( p r i n t _ p l u s ,p r i n t 1 b e a m ,p r i n t _ e n d )
en.wikibooks.org/wiki/Think_Python/Print_version 211/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fp r i n t 4 p o s t s ( ) : o n e _ f o u r _ o n e ( p r i n t _ b a r ,p r i n t 1 p o s t ,p r i n t _ e n d ) d e fp r i n t _ r o w ( ) : o n e _ f o u r _ o n e ( n o t h i n g ,p r i n t 4 p o s t s ,p r i n t 4 b e a m s ) d e fp r i n t _ g r i d ( ) : o n e _ f o u r _ o n e ( p r i n t 4 b e a m s ,p r i n t _ r o w ,n o t h i n g ) p r i n t _ g r i d ( ) c o m m e n t=" " " A f t e rw r i t i n gad r a f to ft h e4 x 4g r i d ,In o t i c e dt h a tm a n yo ft h e f u n c t i o n sh a dt h es a m es t r u c t u r e :t h e yw o u l dd os o m e t h i n g ,d o s o m e t h i n ge l s ef o u rt i m e s ,a n dt h e nd os o m e t h i n ge l s eo n c e . S oIw r o t eo n e _ f o u r _ o n e ,w h i c ht a k e st h r e ef u n c t i o n sa sa r g u m e n t s ;i t c a l l st h ef i r s to n eo n c e ,t h e nu s e sd o _ f o u rt oc a l lt h es e c o n do n e f o u rt i m e s ,t h e nc a l l st h et h i r d . T h e nIr e w r o t ep r i n t 1 b e a m ,p r i n t 1 p o s t ,p r i n t 4 b e a m s ,p r i n t 4 p o s t s , p r i n t _ r o wa n dp r i n t _ g r i du s i n go n e _ f o u r _ o n e . P r o g r a m m i n gi sa ne x p l o r a t o r yp r o c e s s . W r i t i n gad r a f to fap r o g r a m o f t e ng i v e sy o ui n s i g h ti n t ot h ep r o b l e m ,w h i c hm i g h tl e a dy o ut o r e w r i t et h ec o d et or e f l e c tt h es t r u c t u r eo ft h es o l u t i o n . -A l l e n " " " p r i n tc o m m e n t

Chapter9
Exercise9.1
f i n=o p e n ( ' w o r d s . t x t ' ) f o rl i n ei nf i n : w o r d=l i n e . s t r i p ( ) i fl e n ( w o r d )> =2 0 : p r i n t( w o r d )

Chapter10
Exercise10.1
Writeafunctionthattakesalistofnumbersandreturnsthecumulativesumthatis,anewlistwheretheithelementisthesumofthefirsti+1elementsfrom theoriginallist.Forexample,thecumulativesumof[1,2,3]is[1,3,6].
en.wikibooks.org/wiki/Think_Python/Print_version 212/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fc u m u l a t i v e ( a ) : c u m u l a t i v e=[ ] s u m=0 f o rii na : s u m+ =i c u m u l a t i v e . a p p e n d ( s u m ) r e t u r nc u m u l a t i v e a=[ 1 ,2 ,3 ] p r i n t ( c u m u l a t i v e ( a ) )

Exercise10.2
Writeafunctioncalledchopthattakesalistandmodifiesit,removingthefirstandlastelements,andreturnsNone.
> > >d e fc h o p ( x ) : d e lx [ : 1 ] d e lx [ 1 : ]

Thenwriteafunctioncalledmiddlethattakesalistandreturnsanewlistthatcontainsallbutthefirstandlastelements.
> > >d e fm i d d l e ( x ) : r e s=[ ] i=1 w h i l ei< =l e n ( x ) 2 : r e s . a p p e n d ( x [ i ] ) i+ =1 r e t u r nr e s

Thiscanalsobedonesimplywithaslice.
> > >d e fm i d d l e ( x ) : r e t u r nx [ 1 : 1 ]

Chapter11
Exercise11.1
Writeafunctionthatreadsthewordsinwords.txtandstoresthemaskeysinadictionary.Itdoesntmatterwhatthevaluesare.Thenyoucanusethein operatorasafastwaytocheckwhetherastringisinthedictionary.
e n g l i s h d i c t i o n a r y=d i c t ( )
en.wikibooks.org/wiki/Think_Python/Print_version 213/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

f i n=o p e n ( ' w o r d s . t x t ' ) l i n e=f i n . r e a d l i n e ( ) d e fe n g d i c d e f i n e ( ) : i n d e x=0 w h i l ei n d e x< =1 0 0 0 : w o r d=l i n e . s t r i p ( ) e n g l i s h d i c t i o n a r y [ w o r d ]=i n d e x i n d e x+ =1 r e t u r ne n g l i s h d i c t i o n a r y

Exercise11.2
d e fh i s t o g r a m ( s ) : d=d i c t ( ) f o rci ns : d [ c ]=1+d . g e t ( c ,0 ) r e t u r nd

Exercise11.3
Dictionarieshaveamethodcalledkeysthatreturnsthekeysofthedictionary,innoparticularorder,asalist.Modifyprint_histtoprintthekeysandtheir valuesinalphabeticalorder.
v={ ' p ':1 ,' a ':1 ,' r ':2 ,' o ':1 ,' t ':1 } d e fp r i n t _ h i s t ( h ) : x=h . k e y s ( ) y=l i s t ( x ) y . s o r t ( ) f o rci ny : p r i n t ( c ,h [ c ] )

Exercise11.4
d e fr e v e r s e _ l o o k u p ( d , v ) : l=l i s t ( ) f o rci nd : i fd [ c ]= =v : l . a p p e n d ( c ) r e t u r nl

Chapter12
Exercise12.1
en.wikibooks.org/wiki/Think_Python/Print_version 214/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

n u m b e r s=( 1 , 2 , 3 ) d e fs u m a l l ( n u m b e r s ) : x=0 f o rii nn u m b e r s : x=x+i p r i n tx s u m a l l ( n u m b e r s )

or
d e fs u m a l l ( * t ) : x=0 f o rii nr a n g e ( l e n ( t ) ) : x+ =t [ i ] r e t u r nx

or
d e fs u m a l l ( * a r g s ) : t=l i s t ( a r g s ) r e t u r ns u m ( t )

Exercise12.2
i m p o r tr a n d o m d e fs o r t _ b y _ l e n g t h ( w o r d s ) : t=[ ] f o rw o r di nw o r d s : t . a p p e n d ( ( l e n ( w o r d ) , w o r d ) ) t . s o r t ( r e v e r s e = T r u e ) r e s=[ ] f o rl e n g t h ,w o r di nt : r e s . a p p e n d ( w o r d ) i = 0 f i n a l=[ ] w h i l ei< =l e n ( r e s ) 2 : i fl e n ( r e s [ i ] )= =l e n ( r e s [ i + 1 ] ) : y _ l i s t=[ r e s [ i ] ,r e s [ i + 1 ] ] r a n d o m . s h u f f l e ( y _ l i s t ) f i n a l=f i n a l+y _ l i s t i+ =2 e l s e : f i n a l . a p p e n d ( r e s [ i ] ) i+ =1 i fi= =l e n ( r e s ) 1 : f i n a l . a p p e n d ( r e s [ i ] ) r e t u r nf i n a l
en.wikibooks.org/wiki/Think_Python/Print_version 215/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

or
f r o mr a n d o mi m p o r ts h u f f l e d e fs o r t _ b y _ l e n g t h ( w o r d s ) : r=[ ] d=d i c t ( ) f o rw o r di nw o r d s : d . s e t d e f a u l t ( l e n ( w o r d ) ,[ ] ) . a p p e n d ( w o r d ) f o rk e yi ns o r t e d ( d ,r e v e r s e = T r u e ) : i fl e n ( d [ k e y ] )>1 : s h u f f l e ( d [ k e y ] ) r . e x t e n d ( d [ k e y ] ) r e t u r nr

Exercise12.3
i m p o r ts t r i n g d e fm o s t _ f r e q u e n t ( s ) : d=d i c t ( ) i n v=d i c t ( ) f o rc h a ri ns : i fc h a ri ns t r i n g . a s c i i _ l e t t e r s : l e t t e r=c h a r . l o w e r ( ) d [ l e t t e r ]=d . g e t ( l e t t e r ,0 )+1 f o rl e t t e r ,f r e qi nd . i t e m s ( ) : i n v . s e t d e f a u l t ( f r e q ,[ ] ) . a p p e n d ( l e t t e r ) f o rf r e qi ns o r t e d ( i n v ,r e v e r s e = T r u e ) : p r i n t ( ' { : . 2 % } : ' . f o r m a t ( f r e q / ( s u m ( l i s t ( i n v ) * l e n ( i n v [ f r e q ] ) ) ) ) ,' ,' . j o i n ( i n v [ f r e q ] ) )

Chapter13
Exercise13.7
f r o ms t r i n gi m p o r tp u n c t u a t i o n ,w h i t e s p a c e ,d i g i t s f r o mr a n d o mi m p o r tr a n d i n t f r o mb i s e c ti m p o r tb i s e c t _ l e f t d e fp r o c e s s _ f i l e ( f i l e n a m e ) : h=d i c t ( ) f p=o p e n ( f i l e n a m e ) f o rl i n ei nf p : p r o c e s s _ l i n e ( l i n e ,h )
en.wikibooks.org/wiki/Think_Python/Print_version 216/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r nh d e fp r o c e s s _ l i n e ( l i n e ,h ) : l i n e=l i n e . r e p l a c e ( ' ' ,'' ) f o rw o r di nl i n e . s p l i t ( ) : w o r d=w o r d . s t r i p ( p u n c t u a t i o n+w h i t e s p a c e+d i g i t s ) w o r d=w o r d . l o w e r ( ) i fw o r d! =' ' : h [ w o r d ]=h . g e t ( w o r d ,0 )+1 h i s t=p r o c e s s _ f i l e ( ' e m m a . t x t ' ) d e fc u m _ s u m ( l i s t _ o f _ n u m b e r s ) : c u m _ l i s t=[ ] f o ri ,e l e mi ne n u m e r a t e ( l i s t _ o f _ n u m b e r s ) : i fi= =0 : c u m _ l i s t . a p p e n d ( e l e m ) e l s e : c u m _ l i s t . a p p e n d ( c u m _ l i s t [ i 1 ]+e l e m ) r e t u r nc u m _ l i s t d e fr a n d o m _ w o r d ( h ) : w o r d _ l i s t=l i s t ( h . k e y s ( ) ) n u m _ l i s t=[ ] f o rw o r di nw o r d _ l i s t : n u m _ l i s t . a p p e n d ( h [ w o r d ] ) c u m _ l i s t=c u m _ s u m ( n u m _ l i s t ) i=r a n d i n t ( 1 ,c u m _ l i s t [ 1 ] ) p o s=b i s e c t _ l e f t ( c u m _ l i s t ,i ) r e t u r nw o r d _ l i s t [ p o s ] p r i n t ( r a n d o m _ w o r d ( h i s t ) )

Chapter14
Exercise14.3
i m p o r ts h e l v e d e fd i c t _ o f _ s i g n a t u r e s _ a n d _ w o r d s ( f i l e n a m e = ' w o r d s . t x t ' ) : d=d i c t ( ) f o rl i n ei no p e n ( f i l e n a m e ) : w o r d=l i n e . l o w e r ( ) . s t r i p ( ) s i g n a t u r e=' ' . j o i n ( s o r t e d ( w o r d ) ) d . s e t d e f a u l t ( s i g n a t u r e ,[ ] ) . a p p e n d ( w o r d ) r e t u r nd d e fd b _ o f _ a n a g r a m s ( f i l e n a m e = ' a n a g r a m s ' ,d = d i c t _ o f _ s i g n a t u r e s _ a n d _ w o r d s ( ) ) : d b=s h e l v e . o p e n ( f i l e n a m e ) f o rk e y ,v a l u e si nd . i t e m s ( ) : i fl e n ( v a l u e s ) > 1 : f o ri n d e x ,v a l u ei ne n u m e r a t e ( v a l u e s ) :
en.wikibooks.org/wiki/Think_Python/Print_version 217/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d b [ v a l u e ] = v a l u e s [ : i n d e x ] + v a l u e s [ i n d e x + 1 : ] d b . c l o s e ( ) d e fp r i n t _ c o n t e n t s _ o f _ d b ( f i l e n a m e = ' a n a g r a m s ' ) : d b=s h e l v e . o p e n ( f i l e n a m e ,f l a g = ' r ' ) f o rk e yi ns o r t e d ( d b ) : p r i n t ( k e y . r j u s t ( 1 2 ) ,' \ t < = = > \ t ' ,' ,' . j o i n ( d b [ k e y ] ) ) d b . c l o s e ( ) d b _ o f _ a n a g r a m s ( ) p r i n t _ c o n t e n t s _ o f _ d b ( )

Exercise14.5
#R e p l a c eu r l l i b . r e q u e s tw i t hu r l l i bi fy o uu s eP y t h o n2 . #Iw o u l dl o v et os e eam o r ee l e g a n ts o l u t i o nf o rt h i se x e r c i s e ,p o s s i b l yb ys o m e o n ew h ou n d e r s t a n d sh t m l . i m p o r tu r l l i b . r e q u e s t d e fc h e c k ( z i p _ c o d e ) : i fz i p _ c o d e= =' d o n e ' : r e t u r nb r e a k i fl e n ( z i p _ c o d e )! =5 : p r i n t ( ' \ n T h ez i pc o d em u s th a v ef i v ed i g i t s ! ' ) r e t u r nc o n t i n u e d e fg e t _ h t m l ( z i p _ c o d e ) : g i b b e r i s h=u r l l i b . r e q u e s t . u r l o p e n ( ' h t t p : / / w w w . u s z i p . c o m / z i p / '+z i p _ c o d e ) l e s s _ g i b=g i b b e r i s h . r e a d ( ) . d e c o d e ( ' u t f 8 ' ) r e t u r nl e s s _ g i b d e fe x t r a c t _ t r u t h ( c o d e ,k e y ,d e l i m i t e r ) : p o s=c o d e . f i n d ( k e y )+l e n ( k e y ) n e a r l y _ t r u e=c o d e [ p o s : p o s + 4 0 ] t r u t h=n e a r l y _ t r u e . s p l i t ( d e l i m i t e r ) [ 0 ] r e t u r nt r u t h w h i l eT r u e : z i p _ c o d e=i n p u t ( ' P l e a s et y p eaz i pc o d e( 5d i g i t s )o r" d o n e "i fw a n tt os t o p : \ n ' ) c h e c k ( z i p _ c o d e ) c o d e=g e t _ h t m l ( z i p _ c o d e ) i n v a l i d _ k e y=' ( 0r e s u l t s ) ' i fi n v a l i d _ k e yi nc o d e : p r i n t ( ' \ n N o tav a l i dz i pc o d e . ' ) c o n t i n u e n a m e _ k e y=' z i pc o d eo f< s t r o n g > ' n a m e _ d e l=' < ' n a m e=e x t r a c t _ t r u t h ( c o d e ,n a m e _ k e y ,n a m e _ d e l )
en.wikibooks.org/wiki/Think_Python/Print_version 218/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

p o p _ k e y=' P o p u l a t i o n : < / b > < / t d > < t d > ' p o p _ d e l='< ' n a m e=e x t r a c t _ t r u t h ( c o d e ,p o p _ k e y ,p o p _ d e l ) i fn o t1<l e n ( p o p )<9 : p o p=' n o ta v a i l a b l e ' p r i n t ( ' \ n '+n a m e ) p r i n t ( ' P o p u l a t i o n : ' ,p o p ,' \ n ' )

Chapter15
Exercise15.1
i m p o r tm a t h c l a s sP o i n t ( o b j e c t ) : " " " r e p r e s e n t sap o i n ti n2 Ds p a c e " " " d e fd i s t a n c e ( p 1 ,p 2 ) : d i s t a n c e=m a t h . s q r t ( ( p 2 . x-p 1 . x ) * * 2+( p 2 . y-p 1 . y ) * * 2 ) r e t u r nd i s t a n c e p 1=P o i n t ( ) p 2=P o i n t ( ) p 1 . x=3 p 1 . y=2 p 2 . x=4 p 2 . y=3 p r i n t ( d i s t a n c e ( p 1 ,p 2 ) )

Chapter16
Exercise16.1
d e fp r i n t _ t i m e ( t ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( t . h o u r ,t . m i n u t e ,t . s e c o n d )

or
#S o l u t i o nf o rP y t h o n 3 #M o r eo ns t r i n gf o r m a t t i n g :h t t p : / / d o c s . p y t h o n . o r g / p y 3 k / l i b r a r y / s t r i n g . h t m l # f o r m a t s p e c
en.wikibooks.org/wiki/Think_Python/Print_version 219/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fp r i n t _ t i m e ( t ) : #0i saf i l lc h a r a c t e r ,2d e f i n e st h ew i d t h p r i n t ( ' { } : { : 0 2 } : { : 0 2 } ' . f o r m a t ( t . h o u r ,t . m i n u t e ,t . s e c o n d ) )

Exercise16.2
d e fi s _ a f t e r ( t 1 ,t 2 ) : r e t u r n( t 1 . h o u r ,t 1 . m i n u t e ,t 1 . s e c o n d )>( t 2 . h o u r ,t 2 . m i n u t e ,t 2 . s e c o n d )

Exercise16.3
#C o m m e n tn o tb yt h ea u t h o r :T h i sw i l lg i v eaw r o n gr e s u l t ,i f( t i m e . s e c o n d+s e c o n d s%6 0 )>6 0 d e fi n c r e m e n t ( t i m e ,s e c o n d s ) : n=s e c o n d s / 6 0 t i m e . s e c o n d+ =s e c o n d s-6 0 . 0 * n t i m e . m i n u t e+ =n m=t i m e . m i n u t e / 6 0 t i m e . m i n u t e=m * 6 0 t i m e . h o u r+ =m

or
#S o l u t i o nf o rP y t h o n 3 #R e p l a c e' / / 'b y' / 'f o rP y t h o n 2 d e fi n c r e m e n t ( t i m e ,s e c o n d s ) : t i m e . s e c o n d+ =s e c o n d s t i m e . m i n u t e+ =t i m e . s e c o n d / / 6 0 t i m e . h o u r+ =t i m e . m i n u t e / / 6 0 t i m e . s e c o n d% =6 0 t i m e . m i n u t e% =6 0 t i m e . h o u r% =2 4

Exercise16.4
#S o l u t i o nf o rP y t h o n 3 #R e p l a c e' / / 'b y' / 'f o rP y t h o n 2 f r o mc o p yi m p o r td e e p c o p y d e fi n c r e m e n t ( t i m e ,s e c o n d s ) :
en.wikibooks.org/wiki/Think_Python/Print_version 220/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r=d e e p c o p y ( t i m e ) r . s e c o n d+ =s e c o n d s r . m i n u t e+ =r . s e c o n d / / 6 0 r . h o u r+ =r . m i n u t e / / 6 0 r . s e c o n d% =6 0 r . m i n u t e% =6 0 r . h o u r% =2 4 r e t u r nr

Exercise16.5
c l a s sT i m e ( o b j e c t ) : " " " r e p r e s e n t st h et i m eo fd a y . a t t r i b u t e s :h o u r ,m i n u t e ,s e c o n d " " " t i m e=T i m e ( ) t i m e . h o u r=1 1 t i m e . m i n u t e=5 9 t i m e . s e c o n d=3 0 d e ft i m e _ t o _ i n t ( t i m e ) : m i n u t e s=t i m e . h o u r*6 0+t i m e . m i n u t e s e c o n d s=m i n u t e s*6 0+t i m e . s e c o n d r e t u r ns e c o n d s d e fi n t _ t o _ t i m e ( s e c o n d s ) : t i m e=T i m e ( ) m i n u t e s ,t i m e . s e c o n d=d i v m o d ( s e c o n d s ,6 0 ) t i m e . h o u r ,t i m e . m i n u t e=d i v m o d ( m i n u t e s ,6 0 ) r e t u r nt i m e d e fi n c r e m e n t ( t i m e ,a d d t i m e ) : s e c o n d s=t i m e _ t o _ i n t ( t i m e ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s+a d d t i m e ) d e fp r i n t _ t i m e( x ) : p r i n t' T h et i m ei s% . 2 d:% . 2 d:% . 2 d '%( x . h o u r ,x . m i n u t e ,x . s e c o n d ) p r i n t _ t i m e( t i m e ) n e w t i m e=i n c r e m e n t( t i m e ,7 0 ) p r i n t _ t i m e( n e w t i m e )

Exercise16.6
d e ft i m e _ t o _ i n t ( t i m e ) : m i n u t e s=t i m e . h o u r*6 0+t i m e . m i n u t e
en.wikibooks.org/wiki/Think_Python/Print_version 221/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

s e c o n d s=m i n u t e s*6 0+t i m e . s e c o n d r e t u r ns e c o n d s d e fi n t _ t o _ t i m e ( s e c o n d s ) : t i m e=T i m e ( ) m i n u t e s ,t i m e . s e c o n d=d i v m o d ( s e c o n d s ,6 0 ) t i m e . h o u r ,t i m e . m i n u t e=d i v m o d ( m i n u t e s ,6 0 ) r e t u r nt i m e d e fm u l _ t i m e ( t i m e ,f a c t o r ) : s e c o n d s=t i m e _ t o _ i n t ( t i m e ) s e c o n d s* =f a c t o r s e c o n d s=i n t ( s e c o n d s ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s ) d e fa v e r a g e _ p a c e ( t i m e ,d i s t a n c e ) : r e t u r nm u l _ t i m e ( t i m e ,1 / d i s t a n c e )

Exercise16.7
WriteaclassdefinitionforaDateobjectthathasattributes day, monthand year.Writeafunctioncalled increment_datethattakesaDateobject, date,andan integer, n,andreturnsanewDateobjectthatrepresentstheday ndaysafter date.Hint:ThirtydayshathSeptember...Challenge:doesyourfunctiondeal withleapyearscorrectly?See wikipedia.org/wiki/Leap_year.
c l a s sD a t e ( o b j e c t ) : " " " r e p r e s e n t sad a t e . a t t r i b u t e s :d a y ,m o n t h ,y e a r " " " d e fp r i n t _ d a t e ( d a t e ) : #G e r m a nd a t ef o r m a t p r i n t ( ' { } . { } . { } ' . f o r m a t ( d a t e . d a y ,d a t e . m o n t h ,d a t e . y e a r ) ) d e fi s _ l e a p _ y e a r ( y e a r ) : #h t t p : / / e n . w i k i p e d i a . o r g / w i k i / L e a p _ y e a r # A l g o r i t h m i fy e a r%4= =0 : i fy e a r%1 0 0= =0 : i fy e a r%4 0 0= =0 : r e t u r nT r u e r e t u r nF a l s e r e t u r nT r u e r e t u r nF a l s e d e fm o n t h _ l i s t ( y e a r ) : i fi s _ l e a p _ y e a r ( y e a r ) : r e t u r n[ 3 1 ,2 9 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ] r e t u r n[ 3 1 ,2 8 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ] d e fd a y s _ o f _ y e a r ( y e a r ) : i fi s _ l e a p _ y e a r ( y e a r ) : r e t u r n3 6 6
en.wikibooks.org/wiki/Think_Python/Print_version 222/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r n3 6 5 d e fd a t e _ t o _ i n t ( d a t e ) : d a y s=0 f o ry e a ri nr a n g e ( 1 ,d a t e . y e a r ) : d a y s+ =d a y s _ o f _ y e a r ( y e a r ) m o n t h _ d a y s=m o n t h _ l i s t ( d a t e . y e a r ) f o rm o n t hi nr a n g e ( 1 ,d a t e . m o n t h ) : d a y s+ =m o n t h _ d a y s [ m o n t h-1 ] d a y s+ =d a t e . d a y-1 r e t u r nd a y s d e fi n t _ t o _ d a t e ( d a y s ) : d a t e=D a t e ( ) d a t e . y e a r=1 n e x t _ d a y s=3 6 5 w h i l ed a y s> =n e x t _ d a y s : d a t e . y e a r+ =1 d a y s=n e x t _ d a y s n e x t _ d a y s=d a y s _ o f _ y e a r ( d a t e . y e a r ) d a t e . m o n t h=1 n e x t _ d a y s=3 1 m o n t h _ d a y s=m o n t h _ l i s t ( d a t e . y e a r ) w h i l ed a y s> =n e x t _ d a y s : d a t e . m o n t h+ =1 d a y s=n e x t _ d a y s n e x t _ d a y s=m o n t h _ d a y s [ d a t e . m o n t h-1 ] d a t e . d a y=d a y s+1 r e t u r nd a t e d e fi n c r e m e n t _ d a t e ( d a t e ,n ) : d a y s=d a t e _ t o _ i n t ( d a t e ) r e t u r ni n t _ t o _ d a t e ( d a y s+n ) d 1=D a t e ( ) d 1 . d a y ,d 1 . m o n t h ,d 1 . y e a r=8 ,3 ,2 0 1 2 p r i n t _ d a t e ( d 1 ) d 2=i n c r e m e n t _ d a t e ( d 1 ,7 ) p r i n t _ d a t e ( d 2 )

Exercise16.8
1.Usethe datetimemoduletowriteaprogramthatgetsthecurrentdateandprintsthedayoftheweek.
f r o md a t e t i m ei m p o r td a t e d e fc u r r e n t _ w e e k d a y ( ) :
en.wikibooks.org/wiki/Think_Python/Print_version 223/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

i=d a t e . t o d a y ( ) . w e e k d a y ( ) p r i n t ( [ ' M o n d a y ' ,' T u e s d a y ' ,' W e d n e s d a y ' ,' T h u r s d a y ' ,' F r i d a y ' ,' S a t u r d a y ' ,' S u n d a y ' ] [ i ] ) c u r r e n t _ w e e k d a y ( )

2.Writeaprogramthattakesabirthdayasinputandprintstheusersageandthenumberofdays,hours,minutesandsecondsuntiltheirnextbirthday.
#P y t h o n 3s o l u t i o n .R e p l a c e" i n p u t "b y" r a w _ i n p u t "f o rP y t h o n 2 . f r o md a t e t i m ei m p o r td a t e t i m e d e ft i m e _ u n t i l _ b i r t h d a y ( ) : d o b _ i n p u t=i n p u t ( ( ' P l e a s ee n t e rt h ed a t eo fy o u rb i r t hi n' ' t h ef o r m a t" m m / d d / y y y y " :' ) ) d o b=d a t e t i m e . s t r p t i m e ( d o b _ i n p u t ,' % m / % d / % Y ' ) n o w=d a t e t i m e . n o w ( ) i fn o w>d a t e t i m e ( n o w . y e a r ,d o b . m o n t h ,d o b . d a y ) : a g e=n o w . y e a r-d o b . y e a r n e x t _ y e a r=T r u e e l s e : a g e=n o w . y e a r-d o b . y e a r-1 n e x t _ y e a r=F a l s e t i m e _ t o _ b i r t h d a y=d a t e t i m e ( n o w . y e a r+n e x t _ y e a r , d o b . m o n t h ,d o b . d a y )-n o w d a y s=t i m e _ t o _ b i r t h d a y . d a y s h o u r s ,r e m a i n d e r=d i v m o d ( t i m e _ t o _ b i r t h d a y . s e c o n d s ,3 6 0 0 ) m i n u t e s ,s e c o n d s=d i v m o d ( r e m a i n d e r ,6 0 ) p r i n t ( " \ n Y o ua r e{ }y e a r so l d . " . f o r m a t ( a g e ) ) p r i n t ( ( " Y o uh a v e{ 0 }d a y s ,{ 1 }h o u r s ,{ 2 }m i n u t e sa n d{ 3 }" " s e c o n d sl e f tu n t i ly o u rn e x tb i r t h d a y . " ) . f o r m a t ( d a y s ,h o u r s ,m i n u t e s ,s e c o n d s ) ) t i m e _ u n t i l _ b i r t h d a y ( )

Chapter17
Exercise17.8
2.
f r o mv i s u a li m p o r ts c e n e ,s p h e r e s c e n e . r a n g e=( 2 5 6 ,2 5 6 ,2 5 6 ) s c e n e . c e n t e r=( 1 2 8 ,1 2 8 ,1 2 8 ) t=r a n g e ( 0 ,2 5 6 ,5 1 ) f o rxi nt : f o ryi nt : f o rzi nt : p o s=x ,y ,z
en.wikibooks.org/wiki/Think_Python/Print_version 224/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

c o l o r=( x / 2 5 5 . ,y / 2 5 5 . ,z / 2 5 5 . ) s p h e r e ( p o s = p o s ,r a d i u s = 1 0 ,c o l o r = c o l o r )

3.Downloadhttp://thinkpython.com/code/color_list.pyandusethefunction read_colorstogeneratealistoftheavailablecolorsonyoursystem,theirnames andRGBvalues.ForeachnamedcolordrawasphereinthepositionthatcorrespondstoitsRGBvalues.


#A st h e r ec u r r e n t l y( 2 0 1 3 0 4 1 2 )i sn of u n c t i o nr e a d _ c o l o r si nc o l o r _ l i s t . p y #Iu s eaw o r k a r o u n da n ds i m p l yi m p o r tt h ev a r i a b l eC O L O R Sf r o mc o l o r _ l i s t . p y . #It h e nu s et h ef u n c t i o na l l _ c o l o r s ( )o nC O L O R St og e tal i s to ft h ec o l o r s . f r o mc o l o r _ l i s ti m p o r tC O L O R S f r o mv i s u a li m p o r ts c e n e ,s p h e r e d e fa l l _ c o l o r s ( c o l o r s _ s t r i n g = C O L O R S ) : " " " E x t r a c tal i s to fu n i q u eR G B t u p l e sf r o mC O L O R S . T h et u p l e sl o o kl i k e( r ,g ,b ) ,w h e r er ,ga n dba r ee a c hi n t e g e r si n [ 0 ,2 5 5 ] . " " " #s p l i tt h es t r i n gi n t ol i n e sa n dr e m o v ei r r e l e v a n tl i n e s l i n e s=c o l o r s _ s t r i n g . s p l i t ( ' \ n ' ) [ 2 : 2 ] #s p l i tt h ei n d i v i d u a ll i n e sa n dr e m o v et h en a m e s n u m b e r s _ o n l y=[ l i n e . s p l i t ( ) [ : 3 ]f o rl i n ei nl i n e s ] #t u r ns t r i n g si n t oi n t sa n dr g b l i s t si n t ot u p l e s r g b _ t u p l e s=[ t u p l e ( [ i n t ( s )f o rsi nl s t ] )f o rl s ti nn u m b e r s _ o n l y ] #r e t u r nal i s to fu n i q u et u p l e s r e t u r nl i s t ( s e t ( r g b _ t u p l e s ) ) d e fm a k e _ s p h e r e s ( c o l o r _ t u p l e s = a l l _ c o l o r s ( ) ) : s c e n e . r a n g e=( 2 5 6 ,2 5 6 ,2 5 6 ) s c e n e . c e n t e r=( 1 2 8 ,1 2 8 ,1 2 8 ) f o r( r ,g ,b )i nc o l o r _ t u p l e s : s p h e r e ( p o s = ( r ,g ,b ) ,r a d i u s = 7 ,c o l o r = ( r / 2 5 5 . ,g / 2 5 5 . ,b / 2 5 5 . ) ) i f_ _ n a m e _ _= =' _ _ m a i n _ _ ' : m a k e _ s p h e r e s ( )

Chapter3.5
calculator
# r e c u r s i o no rr e c u r s i v e p r i n t" \ n I N D E X \ n " " \ n C = 1f o ra d d i t i o n \ n " " \ n C = 2f o rs u b s t r a c t i o n \ n " " \ n C = 3f o rm u l t i p l i c a t i o n \ n " " \ n C = 4f o rd i v i s i o n \ n " " \ n C = 5f o rt of i n dm o d u l u s \ n " " \ n C = 6t of i n df a c t o r i a l \ n " C = i n p u t ( " E n t e ry o u rc h o i c eh e r e :" ) d e fa d d ( x , y ) : c = x + y
en.wikibooks.org/wiki/Think_Python/Print_version 225/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

p r i n tx , " + " , y , " = " , c d e fs u b ( x , y ) : c = x y p r i n tx , " " , y , " = " , c d e fm u l ( x , y ) : c = x * y p r i n tx , " * " , y , " = " , c d e fd i v ( x , y ) : c = x / y p r i n tx , " / " , y , " = " , c d e fm o d ( x , y ) : c = x % y p r i n tx , " % " , y , " = " , c i fC = = 6 : d e ff ( n ) : i fn = = 1 : p r i n tn r e t u r nn e l s e : p r i n tn , " * " , r e t u r nn * f ( n 1 ) n = i n p u t ( " e n t e ry o u rn oh e r e :" ) p r i n tf ( n ) i fC = = 1 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) a d d ( a , b ) e l i fC = = 2 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) s u b ( a , b ) e l i fC = = 3 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) m u l ( a , b ) e l i fC = = 4 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) d i v ( a , b ) e l i fC = = 5 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) m o d ( a , b )

palindrome
d e ff i r s t ( w o r d ) : r e t u r nw o r d [ 0 ] d e fl a s t ( w o r d ) : r e t u r nw o r d [ 1 ] d e fm i d d l e ( w o r d ) : r e t u r nw o r d [ 1 : 1 ] d e fp a l i n d r o m e ( w o r d ) :
en.wikibooks.org/wiki/Think_Python/Print_version 226/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

i ff i r s t ( w o r d ) = = l a s t ( w o r d ) : w o r d=m i d d l e ( w o r d ) n = l e n ( w o r d ) i fn < 2 : p r i n t" p a l i n d r o m e " e l s e : r e t u r np a l i n d r o m e ( w o r d ) e l s e : p r i n t" n o tp a l i n d r o m e " w o r d = r a w _ i n p u t ( " E n t e rt h e s t r i n g : " ) p a l i n d r o m e ( w o r d )

sumofalldigits
d e fs u m _ o f _ n _ n u m b e r s ( n u m b e r ) : i f ( n u m b e r = = 0 ) : r e t u r n0 e l s e : r e t u r nn u m b e r+s u m _ o f _ n _ n u m b e r s ( n u m b e r 1 ) n u m=r a w _ i n p u t ( " E n t e ran u m b e r : " ) n u m = i n t ( n u m ) s u m=s u m _ o f _ n _ n u m b e r s ( n u m ) p r i n ts u m # # # a n o t h e ra n s w e ri nc a s eo fw h i l el o o p s d e fs u m _ o f _ D i g i t s ( n u m b e r ) : s u m = 0 w h i l en u m b e r > 0 : d i g i t = n u m b e r % 1 0 s u m = s u m + d i g i t n u m b e r = n u m b e r / 1 0 r e t u r ns u m n u m = r a w _ i n p u t ( " e n t e rt h en u m b e r " ) n u m = i n t ( n u m ) s u m _ o f _ d i g i t s = s u m _ o f _ D i g i t s ( n u m ) p r i n ts u m _ o f _ d i g i t s

Exercise18.5
c l a s sC a r d ( o b j e c t ) : s u i t _ n a m e s=[ ' C l u b s ' ,' D i a m o n d s ' ,' H e a r t s ' ,' S p a d e s ' ] r a n k _ n a m e s=[ N o n e ,' A c e ' ,' 2 ' ,' 3 ' ,' 4 ' ,' 5 ' ,' 6 ' ,' 7 ' , ' 8 ' ,' 9 ' ,' 1 0 ' ,' J a c k ' ,' Q u e e n ' ,' K i n g ' ] d e f_ _ i n i t _ _ ( s e l f ,s u i t=0 ,r a n k=2 ) : s e l f . s u i t=s u i t s e l f . r a n k=r a n k
en.wikibooks.org/wiki/Think_Python/Print_version 227/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e f_ _ s t r _ _ ( s e l f ) : r e t u r n' % so f% s '%( C a r d . r a n k _ n a m e s [ s e l f . r a n k ] , C a r d . s u i t _ n a m e s [ s e l f . s u i t ] ) d e f_ _ c m p _ _ ( s e l f ,o t h e r ) : c 1=( s e l f . s u i t ,s e l f . r a n k ) c 2=( o t h e r . s u i t ,o t h e r . r a n k ) r e t u r nc m p ( c 1 ,c 2 ) d e fi s _ v a l i d ( s e l f ) : r e t u r ns e l f . r a n k>0 c l a s sD e c k ( o b j e c t ) : d e f_ _ i n i t _ _ ( s e l f ,l a b e l=' D e c k ' ) : s e l f . l a b e l=l a b e l s e l f . c a r d s=[ ] f o rii nr a n g e ( 4 ) : f o rki nr a n g e ( 1 ,1 4 ) : c a r d=C a r d ( i ,k ) s e l f . c a r d s . a p p e n d ( c a r d ) d e f_ _ s t r _ _ ( s e l f ) : r e s=[ ] f o rc a r di ns e l f . c a r d s : r e s . a p p e n d ( s t r ( c a r d ) ) p r i n ts e l f . l a b e l r e t u r n' \ n ' . j o i n ( r e s ) d e fd e a l _ c a r d ( s e l f ) : r e t u r ns e l f . c a r d s . p o p ( 0 ) d e fa d d _ c a r d ( s e l f ,c a r d ) : s e l f . c a r d s . a p p e n d ( c a r d ) d e fs h u f f l e ( s e l f ) : i m p o r tr a n d o m r a n d o m . s h u f f l e ( s e l f . c a r d s ) d e fs o r t ( s e l f ) : s e l f . c a r d s . s o r t ( ) d e fm o v e _ c a r d s ( s e l f ,o t h e r ,n u m ) : f o rii nr a n g e ( n u m ) : o t h e r . a d d _ c a r d ( s e l f . d e a l _ c a r d ( ) ) d e fd e a l _ h a n d s ( s e l f ,n u m _ h a n d s ,n u m _ c a r d s ) : i fn u m _ h a n d s * n u m _ c a r d s>5 2 : r e t u r n' N o te n o u g hc a r d s . ' l=[ ] f o rii nr a n g e ( 1 ,n u m _ h a n d s+1 ) : h a n d _ i=H a n d ( ' H a n d% d '%i ) s e l f . m o v e _ c a r d s ( h a n d _ i ,n u m _ c a r d s )
en.wikibooks.org/wiki/Think_Python/Print_version 228/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

l . a p p e n d ( h a n d _ i ) r e t u r nl c l a s sH a n d ( D e c k ) : d e f_ _ i n i t _ _ ( s e l f ,l a b e l=' ' ) : s e l f . c a r d s=[ ] s e l f . l a b e l=l a b e l #1 8 6 ,1 4 : c l a s sP o k e r H a n d ( H a n d ) : d e fs u i t _ h i s t ( s e l f ) : s e l f . s u i t s={ } f o rc a r di ns e l f . c a r d s : s e l f . s u i t s [ c a r d . s u i t ]=s e l f . s u i t s . g e t ( c a r d . s u i t ,0 )+1 r e t u r ns e l f . s u i t s d e fr a n k _ h i s t ( s e l f ) : s e l f . r a n k s={ } f o rc a r di ns e l f . c a r d s : s e l f . r a n k s [ c a r d . r a n k ]=s e l f . r a n k s . g e t ( c a r d . r a n k ,0 )+1 r e t u r ns e l f . r a n k s d e fP ( s e l f ) : s e l f . r a n k _ h i s t ( ) f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l> =2 : r e t u r nT r u e r e t u r nF a l s e d e fT P ( s e l f ) : s e l f . r a n k _ h i s t ( ) c o u n t=0 f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l= =4 : r e t u r nT r u e e l i fv a l> =2a n dv a l<4 : c o u n t+ =1 r e t u r nc o u n t> =2 d e fT O A K ( s e l f ) : s e l f . r a n k _ h i s t ( ) f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l> =3 : r e t u r nT r u e r e t u r nF a l s e d e fS T R s e q ( s e l f ) : s e q=[ ] l=S T R l i s t ( ) s e l f . r a n k _ h i s t ( ) h=s e l f . r a n k s . k e y s ( ) h . s o r t ( ) i fl e n ( h )<5 :
en.wikibooks.org/wiki/Think_Python/Print_version 229/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

r e t u r n[ ] #A c c o u n t sf o rh i g hA c e s : i f1i nh : h . a p p e n d ( 1 ) f o rii nr a n g e ( 5 ,l e n ( h ) + 1 ) : i fh [ i 5 : i ]i nl : s e q . a p p e n d ( h [ i 5 : i ] ) r e t u r ns e q d e fS T R ( s e l f ) : s e q=s e l f . S T R s e q ( ) r e t u r ns e q! =[ ] d e fF L ( s e l f ) : s e l f . s u i t _ h i s t ( ) f o rv a li ns e l f . s u i t s . v a l u e s ( ) : i fv a l> =5 : r e t u r nT r u e r e t u r nF a l s e d e fF H ( s e l f ) : d=s e l f . r a n k _ h i s t ( ) k e y s=d . k e y s ( ) f o rk e yi nk e y s : i fd [ k e y ]> =3 : k e y s . r e m o v e ( k e y ) f o rk e yi nk e y s : i fd [ k e y ]> =2 : r e t u r nT r u e r e t u r nF a l s e d e fF O A K ( s e l f ) : s e l f . r a n k _ h i s t ( ) f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l> =4 : r e t u r nT r u e r e t u r nF a l s e d e fS F L ( s e l f ) : s e q=s e l f . S T R s e q ( ) i fs e q= =[ ] : r e t u r nF a l s e f o rl i s ti ns e q : l i s t _ s u i t s=[ ] f o ri n d e xi nl i s t : f o rc a r di ns e l f . c a r d s : i fc a r d . r a n k= =i n d e x : l i s t _ s u i t s . a p p e n d ( c a r d . s u i t ) l i s t _ h i s t=h i s t o g r a m ( l i s t _ s u i t s ) f o rk e yi nl i s t _ h i s t . k e y s ( ) : i fl i s t _ h i s t [ k e y ]> =5 : r e t u r nT r u e r e t u r nF a l s e
en.wikibooks.org/wiki/Think_Python/Print_version 230/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

d e fc l a s s i f y ( s e l f ) : s e l f . s c o r e s=[ ] h a n d s=[ ' P a i r ' ,' T w o P a i r ' , ' T h r e eo faK i n d ' ,' S t r a i g h t ' , ' F l u s h ' ,' F u l lH o u s e ' , ' F o u ro faK i n d ' ,' S t r a i g h tF l u s h ' ] i fs e l f . P ( ) : s e l f . s c o r e s . a p p e n d ( 1 ) i fs e l f . T P ( ) : s e l f . s c o r e s . a p p e n d ( 2 ) i fs e l f . T O A K ( ) : s e l f . s c o r e s . a p p e n d ( 3 ) i fs e l f . S T R ( ) : s e l f . s c o r e s . a p p e n d ( 4 ) i fs e l f . F L ( ) : s e l f . s c o r e s . a p p e n d ( 5 ) i fs e l f . F H ( ) : s e l f . s c o r e s . a p p e n d ( 6 ) i fs e l f . F O A K ( ) : s e l f . s c o r e s . a p p e n d ( 7 ) i fs e l f . S F L ( ) : s e l f . s c o r e s . a p p e n d ( 8 ) i fs e l f . s c o r e s! =[ ] : r e t u r nh a n d s [ m a x ( s e l f . s c o r e s ) 1 ] d e fS T R l i s t ( ) : s=[ ] f o rii nr a n g e ( 0 , 9 ) : s . a p p e n d ( r a n g e ( 1 , 1 4 ) [ i : i + 5 ] ) s . a p p e n d ( [ 1 0 , 1 1 , 1 2 , 1 3 , 1 ] ) r e t u r ns d e fh i s t o g r a m ( l ) : d=d i c t ( ) f o rki nr a n g e ( l e n ( l ) ) : d [ l [ k ] ]=1+d . g e t ( l [ k ] , 0 ) r e t u r nd #1 8 6 ,5 : d e fp ( c o n f i g=' ' ,t r i a l s=1 0 0 0 0 ,n=1 ) : " " " E s t i m a t e sp r o b a b i l i t yt h a tt h e n t hd e a l th a n dw i l lb ec o n f i g .Ah a n d c o n s i s t so fs e v e nc a r d s . " " " s u c c e s s e s=0 f o rii nr a n g e ( 1 ,t r i a l s+1 ) : d e c k=D e c k ( ' D e c k% d '%i ) d e c k . s h u f f l e ( ) b o x=H a n d ( ) d e c k . m o v e _ c a r d s ( b o x ,( n 1 ) * 7 ) h a n d=P o k e r H a n d ( ' P o k e rH a n d% d '%i ) d e c k . m o v e _ c a r d s ( h a n d ,7 )
en.wikibooks.org/wiki/Think_Python/Print_version 231/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

i fh a n d . c l a s s i f y ( )= =c o n f i g : s u c c e s s e s+ =1 r e t u r n1 . 0 * s u c c e s s e s / t r i a l s # I t e r a t eu n t i lf i r s td e s i r e dc o n f i g . : i f_ _ n a m e _ _= =' _ _ m a i n _ _ ' : c=1 w h i l eT r u e : d e c k=D e c k ( ) d e c k . s h u f f l e ( ) h a n d=P o k e r H a n d ( ' P o k e rH a n d% d '%c ) d e c k . m o v e _ c a r d s ( h a n d ,5 ) p r i n th a n d p r i n th a n d . S F L ( ) i fh a n d . S F L ( ) : p r i n th a n d . S T R s e q ( ) b r e a k p r i n t' ' c+ =1 C o d eb yV i c t o rA l v a r e z

AppendixB
ExerciseB.3
Writeafunctioncalled bisectionthattakesasortedlistandatargetvalueandreturnstheindexofthevalueinthelist,ifitsthere,or Noneifitsnot.
f r o mb i s e c ti m p o r tb i s e c t _ l e f t d e fb i s e c t i o n ( s o r t e d _ l i s t ,i t e m ) : i=b i s e c t _ l e f t ( s o r t e d _ l i s t ,i t e m ) i fi<l e n ( s o r t e d _ l i s t )a n ds o r t e d _ l i s t [ i ]= =i t e m : r e t u r ni e l s e : r e t u r nN o n e i f_ _ n a m e _ _= =' _ _ m a i n _ _ ' : a=[ 1 ,2 ,3 ] p r i n t ( b i s e c t i o n ( a ,2 ) ) #e x p e c t1 b=[ 1 ,3 ] p r i n t ( b i s e c t i o n ( b ,2 ) ) #e x p e c tN o n e c=[ 1 ,2 ] p r i n t ( b i s e c t i o n ( c ,3 ) ) #e x p e c tN o n e

Index
en.wikibooks.org/wiki/Think_Python/Print_version 232/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Index
Ackermanfunction,6.11 literalness,1.4

AttributeError,15.7,A.2.3

localvariable,3.9,3.14

Austin,Jane,13.3

logfunction,3.3

abecedarian,8.3,9.2

logarithm,13.12

absfunction,6.1

logicaloperator,5.2,5.3

absolutepath,14.4,14.11

longinteger,11.7

access,10.2

lookup,11.9

accumulator,10.14

lookup,dictionary,11.3

histogram,13.3

loop,4.2,4.11,7.3,12.5

list,10.7

condition,A.2.2

string,18.5
en.wikibooks.org/wiki/Think_Python/Print_version

event,19.1
233/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

sum,10.7

for,4.2,8.3,10.3

infinite,7.3,19.1,A.2.2 addmethod,17.7 nested,18.4 additionwithcarrying,7.6 traversal,8.3 algorithm,1.2,1.7,7.6,13.7 while,7.3 Euclid,6.11

MD5,14.12

looping withdictionaries,11.2

RSA,11.7 withindices,9.4 squareroot,7.9 withstrings,8.7

aliasing,10.10,10.11,10.14,15.2,15.6,17.12 loopingandcounting,8.7 copyingtoavoid,10.13 loopingwithindices,10.3


en.wikibooks.org/wiki/Think_Python/Print_version 234/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

alphabet,4.12

lowlevellanguage,1.1,1.7

alternativeexecution,5.5

ls(Unixcommand),14.8

ambiguity,1.4 Markovanalysis,13.8 anagram,10.15 McCloskey,Robert,8.3 anagramset,12.11,14.7 MD5algorithm,14.12 andoperator,5.3 Menubuttonwidget,19.7 anydbmmodule,14.6 MontyPythonandtheHolyGrail,16.2 appendmethod,10.6,10.12,10.15,18.4,18.6 MP3,14.12 arcfunction,4.3 mappattern,10.7,10.14 argument,3.1,3.5,3.8,3.8,3.14,10.12 mapto,18.1 gather,12.4

en.wikibooks.org/wiki/Think_Python/Print_version

235/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

keyword,4.5,4.11,12.7,19.2

mapping,10.2,10.14,13.8

list,10.12

mashup,13.8

optional,8.8,10.9,11.3

mathfunction,3.3

variablelengthtuple,12.4

maxfunction,12.3,12.4

membership argumentscatter,12.4 bisectionsearch,10.15

arithmeticoperator,2.5

dictionary,11

assertstatement,16.5

list,10.2

assignment,2.11,7.1,10.1

set,11

item,8.5,10.2,12.1 memo,11.5,11.9 multiple,7.8,11.6 mentalmodel,A.3.1 tuple,12.2,12.3,12.5,12.10 metaphor,methodinvocation,17.2


en.wikibooks.org/wiki/Think_Python/Print_version 236/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

assignmentstatement,2.2

metathesis,12.11

attribute __dict__,17.10

method,8.8,8.12,17.1,17.11

__cmp__,18.3 class,18.2,18.10 __str__,17.6,18.5 initializing,17.10 add,17.7 instance,15.2,15.8,18.2,18.10 append,10.6,10.12,18.4,18.6

availablecolors,15.9,17.12

close,14.2,14.6,14.8

config,19.3 Bacon,Kevin,14.12 count,8.8 Bangladesh,nationalflag,15.9 extend,10.6 Buttonwidget,19.2 get,11.1 basecase,5.9,5.13


en.wikibooks.org/wiki/Think_Python/Print_version 237/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

init,17.5,18.1,18.4,18.7 benchmarking,13.9,13.11 items,12.6 big,hairyexpression,A.3.2 join,10.9,18.5 binding,19.8,19.10 keys,11.2 bingo,12.11 mro,18.9 birthday,16.7 pop,10.8,18.6 birthdayparadox,10.15 radd,17.8 bisectmodule,10.15 read,14.8 bisectionsearch,10.15 readline,9.1,14.8 bisection,debuggingby,7.7 remove,10.8 bitwiseoperator,2.5 replace,13.1 body,3.5,3.14,5.13,7.3 setdefault,11.4
en.wikibooks.org/wiki/Think_Python/Print_version 238/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

booltype,5.2 sort,10.6,10.13,12.7,18.6 booleanexpression,5.2,5.13 split,10.9,12.2 booleanfunction,6.4,16.1 string,8.13 booleanoperator,8.9 strip,9.1,13.1 borrowing,subtractionwith,7.6,16.4 translate,13.1 boundmethod,19.6,19.10 update,12.6 boundingbox,15.9,19.4,19.10 values,11 bracket squiggly,11 void,10.6

bracketoperator,8.1,10.2,12.1

methodappend,10.15

branch,5.5,5.13

methodresolutionorder,18.9

breakstatement,7.4
en.wikibooks.org/wiki/Think_Python/Print_version

methodsyntax,17.2
239/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

bug,1.3,1.3,1.7

method,bound,19.6

worst,17.12

method,list,10.6

worstever,19.11

minfunction,12.3,12.4

model,mental,A.3.1

Callableobject,19.7

modifier,16.3,16.6

Canvascoordinate,19.3,19.8

module,3.3,3.14,3.14

Canvasitem,19.3

anydbm,14.6

Canvasobject,15.9

bisect,10.15

Canvaswidget,19.3

copy,15.6

CarTalk,9.7,9.7,9.7,11.10,12.11

datetime,16.7

Cardclass,18.1

Gui,19.1

en.wikibooks.org/wiki/Think_Python/Print_version

240/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Collatzconjecture,7.3

HTMLParser,19.11

CzechRepublic,nationalflag,15.9

Image,19.11

calculator,1.8,2.12

os,14.4

callgraph,11.5,11.9

pickle,14.1,14.7

callback,19.2,19.6,19.7,19.8,19.9,19.10

pprint,11.8

card,playing,18

profile,13.9

carrying,additionwith,7.6,16.2,16.4

random,10.15,12.7,13.2,18.6

casesensitivity,variablenames,2.10

reload,14.9,A.1.1

catch,14.11

shelve,14.7,14.12

chainedconditional,5.6,5.13

string,13.1

character,8.1

structshape,12.9

checksum,14.12
en.wikibooks.org/wiki/Think_Python/Print_version

urllib,14.12,19.11
241/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

childclass,18.7,18.10

Visual,17.12

choicefunction,13.2

vpython,17.12

circlefunction,4.3

World,15.9

circulardefinition,6.5 moduleobject,3.3,14.9 class,15.1,15.8 module,writing,14.9 Card,18.1 modulusoperator,5.1,5.13 Date,16.7 mromethod,18.9 Deck,18.4 multilinestring,4.9,A.1 Hand,18.7 multipleassignment,7.1,7.8,11.6 Kangaroo,17.12 multiplicity(inclassdiagram),18.8,18.10 Point,15.1,17.5 mutability,8.5,10.2,10.5,10.11,11.6,12.1,12.8,15.5
en.wikibooks.org/wiki/Think_Python/Print_version 242/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

parent,18.7 mutableobject,asdefaultvalue,17.12 Rectangle,15.3

SimpleTurtleWorld,19.6

NameError,3.9,A.2.3

Time,16.1

Newtonsmethod,7.5

Nonespecialvalue,3.11,6.1,6.10,10.6,10.8 classattribute,18.2,18.10 naturallanguage,1.4,1.7 classdefinition,15.1 negativeindex,8.2 classdiagram,18.8,18.10 nestedconditional,5.7,5.13 classobject,15.1,15.8 nestedlist,10.1,10.3,10.14 closemethod,14.2,14.6,14.8 newline,5.11,7.1,18.5 cmpfunction,18.3 notoperator,5.3 __cmp__method,18.3

en.wikibooks.org/wiki/Think_Python/Print_version

243/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

colon,3.5,A.1

number,random,13.2

colorlist,15.9,17.12 OverflowError,5.12 comment,2.9,2.11 object,8.5,8.12,10.10,10.10,10.14,15.1 commutativity,2.8,17.8 Callable,19.7 comparefunction,6.1 Canvas,15.9 comparison string,8.10 class,15.1

tuple,12.7,18.3

copying,15.6

Event,19.8 comparisonoperator,5.2 embedded,15.3,15.8,17.12 compile,1.1,1.7 file,9.1,9.6 composition,3.4,3.8,3.14,6.3,18.4 function,3.5,3.15 compoundstatement,5.4,5.13


en.wikibooks.org/wiki/Think_Python/Print_version 244/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

module,14.9 compression file,14.8 mutable,15.5

printing,17.2 concatenation,2.8,2.11,3.9,8.3,8.5,10.9

list,10.4,10.12,10.15

objectcode,1.1,1.7

objectdiagram,15.2,15.3,15.6,15.8,16.1,18.2 condition,5.4,5.13,7.3,A.2.2 objectorientedlanguage,17.11 conditional,A.1 objectorientedprogramming,17.1,17.11,18.7 chained,5.6,5.13 octal,2.2 nested,5.7,5.13 odometer,9.7 conditionalexecution,5.4 openfunction,9.1,9.1,14.2,14.5,14.6 conditionaloperator,18.3 operand,2.5,2.11

en.wikibooks.org/wiki/Think_Python/Print_version

245/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

conditionalstatement,5.4,5.13,6.4

operator,2.11

configmethod,19.3

and,5.3

consistencycheck,11.8,16.4

bitwise,2.5

contributors,0

boolean,8.9

conversion type,3.2

bracket,8.1,10.2,12.1

comparison,5.2

coordinate Canvas,19.3,19.8

conditional,18.3

del,10.8 pixel,19.8 format,14.3,14.11,A.2.3

coordinatesequence,19.4

in,8.9,9.3,10.2,11

copy deep,15.6

is,10.10,15.6

logical,5.2,5.3
en.wikibooks.org/wiki/Think_Python/Print_version 246/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

shallow,15.6 modulus,5.1,5.13 slice,8.4,10.5 not,5.3 toavoidaliasing,10.13 or,5.3

copymodule,15.6

overloading,17.11

copyingobjects,15.6

slice,8.4,8.13,10.5,10.12,12.1

countmethod,8.8

string,2.8

counter,8.7,8.12,11.1,11.6

update,10.7

countingandlooping,8.7 operatoroverloading,17.7,18.3 crosswords,9.1 operator,arithmetic,2.5 cummings,e.e.,1.3.1 option,19.2,19.10 cumulativesum,10.7 optionalargument,8.8,10.9,11.3


en.wikibooks.org/wiki/Think_Python/Print_version 247/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

optionalparameter,13.5,17.5 Dateclass,16.7 oroperator,5.3 Deckclass,18.4 orderofoperations,2.7,2.10,A.3.2 Dijkstra,Edsger,9.5 osmodule,14.4 Doyle,ArthurConan,1.3.4 other(parametername),17.4 DSUpattern,12.7,12.10,13.4 overloading,17.11 datastructure,12.9,12.10,13.9 override,13.5,13.11,17.5,18.3,18.7,18.9 database,14.6,14.11,14.12

datetimemodule,16.7

PEMDAS,2.7

deadcode,6.1,6.10,A.2.4

PIL(PythonImagingLibrary),19.11

debugger(pdb),A.2.3

Pointclass,15.1,17.5

en.wikibooks.org/wiki/Think_Python/Print_version

248/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

debugging,1.3,1.3,1.6,1.7,2.10,3.13,4.10,5.12,6.9,8.11,9.5,10.13,11.8, 12.9,13.10,14.10,15.7,16.5,17.10,18.9,19.9,A

ProjectGutenberg,13.1

Puzzler,9.7,9.7,9.7,11.10,12.11 bybisection,7.7 Pythagoreantheorem,6.2 emotionalresponse,1.6,A.3.4 Python3.0,1.5,2.5,5.11,11.7,12.5 experimental,1.3.4 Pythondebugger(pdb),A.2.3 superstition,A.3.4 PythonImagingLibrary(PIL),19.11 deck,playingcards,18.4 packingwidgets,19.6,19.10 declaration,11.6,11.9 palindrome,6.11,8.13,9.4,9.7,9.7 decoratesortundecoratepattern,12.7 parameter,3.8,3.9,3.14,10.12 decrement,7.2,7.8

gather,12.4

deepcopy,15.6,15.8

optional,13.5,17.5

deepcopyfunction,15.6
en.wikibooks.org/wiki/Think_Python/Print_version

other,17.4
249/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

defkeyword,3.5

self,17.2

defaultvalue,13.5,13.11,17.5 parentclass,18.7,18.7,18.10 avoidingmutable,17.12 parentheses argumentin,3.1 definition circular,6.5 empty,3.5,8.8

class,15.1

matching,1.3.1

function,3.5

overridingprecedence,2.7

recursive,12.11

parametersin,3.8,3.9

parentclassin,18.7 deloperator,10.8 tuplesin,12.1 deletion,elementoflist,10.8

delimiter,10.9,10.14
en.wikibooks.org/wiki/Think_Python/Print_version

parse,1.4,1.7,14.12
250/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

deterministic,13.2,13.11

passstatement,5.4

developmentplan,4.11

path,14.4,14.11

encapsulationandgeneralization,4.8

absolute,14.4

incremental,6.2,A.1

relative,14.4

planned,16.4 pattern problemrecognition,9.3,9.4 DSU,12.7,13.4

prototypeandpatch,16.2,16.4

decoratesortundecorate,12.7

randomwalkprogramming,13.10,A.3.4

filter,10.7,10.14

guardian,6.8,6.10,8.11 diagram callgraph,11.9 map,10.7,10.14

class,18.8,18.10

reduce,10.7,10.14

en.wikibooks.org/wiki/Think_Python/Print_version

251/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

object,15.2,15.3,15.6,15.8,16.1,18.2

search,8.6,8.12,9.3,11.3

stack,3.10,10.12

swap,12.2

state,2.2,7.1,8.11,10.2,10.10,10.11,11.4,12.6,15.2,15.3,15.6,16.1,18.2 pdb(Pythondebugger),A.2.3

__dict__attribute,17.10

permission,file,14.5

dictfunction,11

persistence,14.1,14.11

dictionary,11,11,11.9,12.6,A.2.3

pi,3.3,7.9

initialize,12.6

picklemodule,14.1,14.7

invert,11.4

pickling,14.7

lookup,11.3

pie,4.12

loopingwith,11.2

pipe,14.8,14.12

reverselookup,11.3

pixelcoordinate,19.8

en.wikibooks.org/wiki/Think_Python/Print_version

252/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

subtraction,13.6

plaintext,9.1,13.1,14.12,19.11

traversal,12.6,17.10

planneddevelopment,16.4,16.6

playingcard,AngloAmerican,18 dictionarymethods anydbmmodule,14.6 poetry,1.4

point,mathematical,15.1 directory,14.4,14.11 poker,18,18.11 walk,14.4 polygonfunction,4.3 working,14.4 polymorphism,17.9,17.11,18.9

dispatch typebased,17.9

popmethod,10.8,18.6

popenfunction,14.8 dispatch,typebased,17.8 portability,1.1,1.7 divisibility,5.1 postcondition,4.10,6.9,18.9


en.wikibooks.org/wiki/Think_Python/Print_version 253/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

division floatingpoint,2.5

pprintmodule,11.8

precedence,2.11,A.3.2 floor,2.5,5.12 precondition,4.10,4.11,4.11,6.9,10.15,18.9

divmod,12.3,16.4

prefix,13.8

docstring,4.9,4.11,15.1

prettyprint,11.8

documentation,1.8

printstatement,1.5,1.7,17.6,A.2.4

dotnotation,3.3,3.14,8.8,15.2,17.2,18.2

problemrecognition,9.3,9.4,9.6

doubleletters,9.7

problemsolving,1,1.7

draganddrop,19.8

profilemodule,13.9

duplicate,10.15,10.15,11.10,14.12

program,1.2,1.7

programtesting,9.5 Einstein,Albert,4.6
en.wikibooks.org/wiki/Think_Python/Print_version 254/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

programminglanguage,1.1 Entrywidget,19.5 prompt,1.1,1.7,5.11 Euclidsalgorithm,6.11 prose,1.4 Eventobject,19.8 prototypeandpatch,16.2,16.4,16.6 element,10.1,10.14 pseudorandom,13.2,13.11 elementdeletion,10.8 purefunction,16.2,16.6 elifkeyword,5.6 python.org,1.8 ellipses,3.5

elsekeyword,5.5

quotationmark,1.5,2.1,2.1,4.9,8.4,A.1

emailaddress,12.2

embeddedobject,15.3,15.8,17.12

Ramanujan,Srinivasa,7.9

copying,15.6

Rectangleclass,15.3

en.wikibooks.org/wiki/Think_Python/Print_version

255/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

RSAalgorithm,11.7 emotionaldebugging,1.6,A.3.4 RuntimeError,5.10,6.8 emptylist,10.1 raddmethod,17.8 emptystring,8.12,10.9 radian,3.3 encapsulation,4.4,4.11,6.3,7.5,8.7,18.7 rage,A.3.4 encode,18.1,18.10 raisestatement,11.3,16.5 encrypt,18.1 randintfunction,10.15,13.2 encryption,11.7 randomfunction,12.7,13.2 endoflinecharacter,14.10 randommodule,10.15,12.7,13.2,18.6 enumeratefunction,12.5 randomnumber,13.2 epsilon,7.5 randomtext,13.8 equalityandassignment,7.1 randomwalkprogramming,13.10,A.3.4
en.wikibooks.org/wiki/Think_Python/Print_version 256/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

equivalence,10.10 rank,18.1 equivalent,10.14 raw_inputfunction,5.11 error compiletime,A readmethod,14.8

runtime,1.3.2,2.10,5.10,5.12,A

readlinemethod,9.1,14.8

semantic,1.3.3,2.1,2.10,8.11,A,A.3

recursion,5.8,5.8,5.13,6.5,6.6

shape,12.9

basecase,5.9

syntax,1.3.1,2.10,A

infinite,5.10,6.8,A.2.2

errorchecking,6.8

recursivedefinition,6.5,12.11

errormessage,1.3.1,1.3.3,1.6,2.1,2.10,A.1

reducepattern,10.7,10.14

evalfunction,7.9

reducibleword,11.10,12.11

evaluate,2.6
en.wikibooks.org/wiki/Think_Python/Print_version

redundancy,1.4
257/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

event,19.10

refactoring,4.7,4.7

eventhandler,19.8

reference,10.11,10.12,10.14

eventloop,19.1,19.10

aliasing,10.11

eventstring,19.8 relativepath,14.4,14.11 eventdrivenprogramming,19.2,19.9,19.10 reloadfunction,14.9,A.1.1 exception,1.3.2,1.7,2.10,A,A.2.3 removemethod,10.8 AttributeError,15.7,A.2.3 repetition,4.2 IndexError,8.2,8.11,10.2,A.2.3 list,10.4 IOError,14.5

KeyError,11,A.2.3

replacemethod,13.1

NameError,3.9,A.2.3

reprfunction,14.10

en.wikibooks.org/wiki/Think_Python/Print_version

258/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

OverflowError,5.12

representation,15.1,15.3,18.1

RuntimeError,5.10

returnstatement,5.8,6.1,A.3.3

SyntaxError,3.4

returnvalue,3.1,3.14,6.1,15.4

TypeError,8.1,8.5,11.4,12.1,12.4,14.3,17.3,A.2.3

tuple,12.3

UnboundLocalError,11.6 reverselookup,dictionary,11.3,11.9 ValueError,5.11,11.3,12.2 reversewordpair,10.15

exception,catching,14.5

reversedfunction,12.8

executable,1.1,1.7

rotation letters,11.10

exercise,secret,14.12

existsfunction,14.4

rotation,letter,8.13

experimentaldebugging,1.3.4,13.10

rulesofprecedence,2.7,2.11

en.wikibooks.org/wiki/Think_Python/Print_version

259/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

expression,2.5,2.6,2.11

runningpace,1.8,2.12,16.7

bigandhairy,A.3.2

runtimeerror,1.3.2,2.10,5.10,5.12,A,A.2.3

boolean,5.2,5.13

Scrabble,12.11 extendmethod,10.6 SimpleTurtleWorldclass,19.6

SVG,19.11 Falsespecialvalue,5.2 Swampy,4.1,9.1,15.9,18.11,19.1 FermatsLastTheorem,5.14 SyntaxError,3.4 Framewidget,19.6 safelanguage,1.3.2 FreeDocumentationLicense,GNU,0,0 sanitycheck,11.8 factorialfunction,6.5,6.8 scaffolding,6.2,6.10,11.8 fibonaccifunction,6.7,11.5 scatter,12.4,12.10 file,14
en.wikibooks.org/wiki/Think_Python/Print_version 260/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

compression,14.8

script,1.1,1.7

permission,14.5

scriptmode,1.1,1.7,2.4,3.11

readingandwriting,14.2

search,11.3

searchpattern,8.6,8.12,9.3 fileobject,9.1,9.6 search,bisection,10.15 filename,14.4 secretexercise,14.12 filterpattern,10.7,10.14 self(parametername),17.2 findfunction,8.6 semanticerror,1.3.3,1.7,2.1,2.10,8.11,A,A.3 flag,11.6,11.9 semantics,1.3.3,1.7,17.1 floatfunction,3.2 sequence,8.1,8.12,10.1,10.9,12.1,12.8 floattype,2.1 coordinate,19.4 floatingpoint,2.11,7.5
en.wikibooks.org/wiki/Think_Python/Print_version 261/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

floatingpointdivision,2.5

set,13.6

floordivision,2.5,2.11,5.12

anagram,12.11,14.7

flowofexecution,3.7,3.14,6.7,6.9,7.3,18.9,19.9,A.2.2 setmembership,11 flower,4.12 setdefaultmethod,11.4 folder,14.4 sexagesimal,16.4 forloop,4.2,8.3,10.3,12.5 shallowcopy,15.6,15.8 formallanguage,1.4,1.7 shape,12.10 formatoperator,14.3,14.11,A.2.3 shapeerror,12.9 formatsequence,14.3,14.11 shell,14.8 formatstring,14.3,14.11 shelvemodule,14.7,14.12 frabjuous,6.5 shufflefunction,18.6
en.wikibooks.org/wiki/Think_Python/Print_version 262/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

frame,3.10,3.14,5.9,6.5,11.5 sinefunction,3.3 frequency,11.1 singleton,11.4,11.9,12.1 letter,12.11 slice,8.12 word,13.1,13.12 copy,8.4,10.5

fruitfulfunction,3.11,3.14

list,10.5

frustration,A.3.4

string,8.4

function,3.5,3.14,17.1

tuple,12.1

abs,6.1

update,10.5

ack,6.11 sliceoperator,8.4,8.13,10.5,10.12,12.1 arc,4.3 sortmethod,10.6,10.13,12.7,18.6 choice,13.2 sortedfunction,12.8


en.wikibooks.org/wiki/Think_Python/Print_version 263/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

circle,4.3 sourcecode,1.1,1.7 cmp,18.3 specialcase,9.5,9.6,16.3 compare,6.1 specialvalue deepcopy,15.6 False,5.2

dict,11

None,3.11,6.1,6.10,10.6,10.8

enumerate,12.5

True,5.2

eval,7.9 splitmethod,10.9,12.2 exists,14.4 sqrt,6.2 factorial,6.5 sqrtfunction,3.3 fibonacci,6.7,11.5 squareroot,7.5 find,8.6 squigglybracket,11 float,3.2
en.wikibooks.org/wiki/Think_Python/Print_version 264/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

getattr,17.10

stackdiagram,3.10,3.10,3.14,4.12,5.9,6.5,6.11, 10.12

getcwd,14.4

statediagram,2.2,2.11,7.1,8.11,10.2,10.10,10.11, 11.4,12.6,15.2,15.3,15.6,16.1,18.2

hasattr,15.7,17.10

statement,2.4,2.11

int,3.2

assert,16.5

isinstance,6.8,17.8

assignment,2.2,7.1

len,3.15,8.2,11

break,7.4

list,10.9

compound,5.4

log,3.3

conditional,5.4,5.13,6.4

max,12.3,12.4

for,4.2,8.3,10.3

min,12.3,12.4

global,11.6

open,9.1,9.1,14.2,14.5,14.6

if,5.4

en.wikibooks.org/wiki/Think_Python/Print_version

265/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

polygon,4.3

import,3.14,4.1,14.9

popen,14.8

pass,5.4

randint,10.15,13.2

print,1.5,1.7,17.6,A.2.4

random,12.7,13.2

raise,11.3,16.5

raw_input,5.11

return,5.8,6.1,A.3.3

recursive,5.8

try,14.5

reload,14.9,A.1.1

while,7.3

repr,14.10 stepsize,8.13 reversed,12.8 strfunction,3.2 shuffle,18.6 __str__method,17.6,18.5 sorted,12.8 string,2.1,2.11,10.9,12.8 sqrt,3.3,6.2


en.wikibooks.org/wiki/Think_Python/Print_version 266/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

accumulator,18.5 str,3.2 comparison,8.10 sum,12.4 empty,10.9 tuple,12.1 immutable,8.5 type,15.7 method,8.8 zip,12.5 multiline,4.9,A.1

functionargument,3.8

operation,2.8

functioncall,3.1,3.14

slice,8.4

functioncomposition,6.3

triplequoted,4.9

functiondefinition,3.5,3.6,3.14,3.14 stringmethod,8.13 functionframe,3.10,3.14,5.9,11.5 stringmodule,13.1 functionobject,3.5,3.15


en.wikibooks.org/wiki/Think_Python/Print_version 267/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

stringrepresentation,14.10,17.6 functionparameter,3.8 stringtype,2.1 functionsyntax,17.2 stripmethod,9.1,13.1 functiontype modifier,16.3 structshapemodule,12.9

pure,16.2

structure,1.4

subclass,18.7 function,fruitful,3.11 subject,17.2,17.11,19.6 function,math,3.3 subtraction function,reasonsfor,3.12 dictionary,13.6

function,trigonometric,3.3

withborrowing,7.6

function,tupleasreturnvalue,12.3 subtractionwithborrowing,16.4 function,void,3.11 suffix,13.8


en.wikibooks.org/wiki/Think_Python/Print_version 268/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

functionalprogrammingstyle,16.3,16.6 suit,18.1

GCD(greatestcommondivisor),6.11

sumfunction,12.4

GNUFreeDocumentationLicense,0,0

superclass,18.7

GUI,19.1,19.10

superstitiousdebugging,A.3.4

Guimodule,19.1

swappattern,12.2

gammafunction,6.8

syntax,1.3.1,1.3.1,1.7,17.1,A.1

gather,12.4,12.10

syntaxerror,1.3.1,1.7,2.10,A

generalization,4.5,4.11,9.3,16.4 Tagger,18.11 geometrymanager,19.6,19.10 Textwidget,19.5 getmethod,11.1 Timeclass,16.1 getattrfunction,17.10


en.wikibooks.org/wiki/Think_Python/Print_version 269/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Tkinter,19.1 getcwdfunction,14.4 Truespecialvalue,5.2 globalstatement,11.6 Turingcompletelanguage,6.5 globalvariable,11.6,11.9 TuringThesis,6.5 update,11.6 Turing,Alan,6.5

graphicaluserinterface,19.1

TurtleWorld,4.1,5.14,18.11

greatestcommondivisor(GCD),6.11

TypeError,8.1,8.5,11.4,12.1,12.4,14.3,17.3,A.2.3

grid,3.15

temporaryvariable,6.1,6.10,A.3.2

guardianpattern,6.8,6.10,8.11

testcase,minimal,A.2.4

gzip(Unixcommand),14.8

testing andabsenceofbugs,9.5

HASArelationship,18.8,18.10

incrementaldevelopment,6.2

en.wikibooks.org/wiki/Think_Python/Print_version

270/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

Handclass,18.7

interactivemode,1.1

Hello,World,1.5

ishard,9.5

Holmes,Sherlock,1.3.4

knowingtheanswer,6.2

HTMLParsermodule,19.11

leapoffaith,6.6

hanging,A.2.2

minimaltestcase,A.2.4

hasattrfunction,15.7,17.10 text hashfunction,11.4,11.9 plain,9.1,13.1,14.12,19.11

hashable,11.4,11.9,12.6

random,13.8

hashtable,11,11.9 textfile,14.11 header,3.5,3.14,A.1 token,1.4,1.7 helputility,1.8 traceback,3.10,3.14,5.10,5.12,11.3,A.2.3 hexadecimal,15.1


en.wikibooks.org/wiki/Think_Python/Print_version 271/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

translatemethod,13.1 highlevellanguage,1.1,1.7 traversal,8.3,8.3,8.6,8.11,8.12,9.3,9.3,10.7,10.14, 11.1,11.2,12.5,12.5,12.7,13.3

histogram,11.1,11.1,11.9

randomchoice,13.2,13.7

dictionary,17.10

wordfrequencies,13.3

list,10.3

homophone,11.10

traverse dictionary,12.6

hyperlink,19.11 triangle,5.14

hypotenuse,6.2

trigonometricfunction,3.3

IMDb(InternetMovieDatabase),14.12

triplequotedstring,4.9

Imagemodule,19.11

trystatement,14.5

IndexError,8.2,8.11,10.2,A.2.3

tuple,12.1,12.3,12.8,12.10

en.wikibooks.org/wiki/Think_Python/Print_version

272/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

InternetMovieDatabase(IMDb),14.12

askeyindictionary,12.6,13.9

IOError,14.5

assignment,12.2

ISArelationship,18.8,18.10

comparison,12.7,18.3

identical,10.14

inbrackets,12.6

identity,10.10

singleton,12.1

ifstatement,5.4

slice,12.1

imageviewer,19.11 tupleassignment,12.3,12.5,12.10 immutability,8.5,8.5,8.12,10.11,11.4,12.1,12.8 tuplefunction,12.1 implementation,11.1,11.9,13.9 turtletypewriter,4.12 importstatement,3.14,4.1,14.9 type,2.1,2.1,2.11 inoperator,8.9,9.3,10.2,11 bool,5.2 increment,7.2,7.8,16.3,17.3
en.wikibooks.org/wiki/Think_Python/Print_version 273/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

dict,11 incrementaldevelopment,6.10,A.1 file,14 indentation,3.5,17.2,A.1 float,2.1 index,8.1,8.1,8.11,8.12,10.2,10.14,11,A.2.3 int,2.1 loopingwith,9.4,10.3 list,10 negative,8.2 long,11.7 slice,8.4,10.5 set,13.6 startingatzero,8.1,10.2 str,2.1

infiniteloop,7.3,7.8,19.1,A.2.2,A.2.2

tuple,12.1

infiniterecursion,5.10,5.13,6.8,A.2.2,A.2.2

userdefined,15.1,16.1

inheritance,18.7,18.10 typechecking,6.8 initmethod,17.5,17.10,18.1,18.4,18.7


en.wikibooks.org/wiki/Think_Python/Print_version 274/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

typeconversion,3.2 initialization(beforeupdate),7.2 typefunction,15.7 instance,4.1,4.11,15.1,15.8 typebaseddispatch,17.8,17.9,17.11 asargument,15.2 typewriter,turtle,4.12 asreturnvalue,15.4 typographicalerror,13.10

instanceattribute,15.2,15.8,18.2,18.10

instantiation,15.1

UML,18.8

intfunction,3.2

UnboundLocalError,11.6

inttype,2.1

Unixcommand gzip,14.8

integer,2.11 ls,14.8 long,11.7

URL,14.12,19.11

en.wikibooks.org/wiki/Think_Python/Print_version

275/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

interactivemode,1.1,1.7,2.4,3.11

underscorecharacter,2.3

interface,4.6,4.10,4.11,18.9

uniqueness,10.15

interlockingwords,10.15

update,7.2,7.5,7.8

interpret,1.1,1.7

coordinate,19.8

invariant,16.5,16.6,19.9

database,14.6

invertdictionary,11.4

globalvariable,11.6

invocation,8.8,8.12

histogram,13.3

isoperator,10.10,15.6

item,10.3

isinstancefunction,6.8,17.8

slice,10.5

item,8.12,10.1 updatemethod,12.6 Canvas,19.3,19.10 updateoperator,10.7 dictionary,11.9


en.wikibooks.org/wiki/Think_Python/Print_version 276/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

urllibmodule,14.12,19.11

itemassignment,8.5,10.2,12.1

usebeforedef,2.10,3.6

itemupdate,10.3

userdefinedtype,15.1,16.1

itemsmethod,12.6 ValueError,5.11,11.3,12.2

iteration,7,7.3,7.8

Visualmodule,17.12

joinmethod,10.9,18.5

value,2.1,2.11,10.10,10.10,11.9

default,13.5 Kangarooclass,17.12 tuple,12.3 KevinBaconGame,14.12 valuesmethod,11 KeyError,11,A.2.3 variable,2.2,2.11 Kochcurve,5.14 global,11.6


en.wikibooks.org/wiki/Think_Python/Print_version 277/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

key,11,11.9 local,3.9 keyvaluepair,11,11.9,12.6 temporary,6.1,6.10,A.3.2 keyboardinput,5.11 updating,7.2 keysmethod,11.2

keyword,2.3,2.3,2.11,A.1

variablelengthargumenttuple,12.4

def,3.5

vectorgraphics,19.11

elif,5.6

veneer,18.6,18.10

else,5.5

voidfunction,3.11,3.14

voidmethod,10.6 keywordargument,4.5,4.11,12.7,19.2,19.10 vpythonmodule,17.12

Labelwidget,19.2 Worldmodule,15.9 Linux,1.3.4


en.wikibooks.org/wiki/Think_Python/Print_version 278/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

walk,directory,14.4 language formal,1.4 whileloop,7.3

highlevel,1.1

whitespace,3.13,5.12,9.1,14.10,A.1

lowlevel,1.1

widget,19.1,19.10

natural,1.4

Button,19.2

programming,1.1

Canvas,19.3

safe,1.3.2

Entry,19.5

Turingcomplete,6.5

Frame,19.6

Label,19.2 leapoffaith,6.6 Menubutton,19.7 lenfunction,3.15,8.2,11 Text,19.5 letterfrequency,12.11

en.wikibooks.org/wiki/Think_Python/Print_version

279/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

letterrotation,8.13,11.10

widget,packing,19.6

lipogram,9.2

wordcount,14.9

list,10,10.9,10.14,12.8

wordfrequency,13.1,13.12

asargument,10.12

word,reducible,11.10,12.11

comprehension,10.7

workingdirectory,14.4

concatenation,10.4,10.12,10.15

worstbug,17.12

copy,10.5

ever,19.11

element,10.2

empty,10.1

Zipfslaw,13.12

function,10.9

zero,indexstartingat,8.1,10.2

index,10.2

zipfunction,12.5

membership,10.2
en.wikibooks.org/wiki/Think_Python/Print_version

usewithdict,12.6
280/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

method,10.6

nested,10.1,10.3

ofobjects,18.4

oftuples,12.5

operation,10.4

repetition,10.4

slice,10.5

traversal,10.3,10.14

<IMGSRC="previous_motif.gif"ALT="Previous"><IMGSRC="contents_motif.gif"ALT="Up"> Retrievedfrom"http://en.wikibooks.org/w/index.php?title=Think_Python/Print_version&oldid=1931999"
Thispagewaslastmodifiedon23October2013,at21:16. TextisavailableundertheCreativeCommonsAttribution/ShareAlikeLicenseadditionaltermsmayapply.Byusingthissite,youagreetotheTermsof UseandPrivacyPolicy.
en.wikibooks.org/wiki/Think_Python/Print_version 281/282

10/24/13

Think Python/Print version - Wikibooks, open books for an open world

en.wikibooks.org/wiki/Think_Python/Print_version

282/282

You might also like