Manual of Operations On The Prevention and Control of Non-Communicable Diseases in The PhIlippines
Manual of Operations On The Prevention and Control of Non-Communicable Diseases in The PhIlippines
Manual of Operations On The Prevention and Control of Non-Communicable Diseases in The PhIlippines
3/5/10 6:32 AM
Manual of Operations
3/5/10 6:32 AM
Contents
Contents
Foreword . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . iii Message . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . iv Acknowledgment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .v Section 1: The Manual of Operations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 1.1 Objectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 1.2 Target Users . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 1.3 Content Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 1.4 Scope and Limitations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2 1.5 How to Use this Manual. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 Section 2: The NCD Prevention and Control Program . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 2.1 Burden of Noncommunicable Diseases (NCDs) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 2.2 Early Developments in NCD Prevention and Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 2.3 The Integrated NCD Prevention and Control Program Framework . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6 2.4 Roles of Health Workers in NCD Prevention and Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6 Section 3: NCD Prevention and Control Program at the Local Level . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8 3.1 Planning the NCD Prevention and Control Program . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8 3.1.1 Principles in Formulating Local NCD Prevention and Control Plan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8 3.1.2 Basic Steps in Planning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8 Section 4: Promoting Healthy Lifestyle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.1 Goals and Targets of Healthy Lifestyle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.2 Local Activities in Promoting Healthy Lifestyle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.2.1 Development of IEC Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.2.2 Development of Interpersonal Communications Strategies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.2.3 Promoting Healthy Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Section 5: Building Healthy Public Policies and Supportive Environments . . . . . . . . . . . . . . . . . . . . . . 5.1 Development of Local Policies and Legislation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.1.1 Examples of Policy and Legislation to Support NCD Prevention and Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.2 Enforcing Policies and Regulations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.2.1 Implementing and Enforcing Policies at the Local Level . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.3 Supportive Environments . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.3.1 Physical Environment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Copyright Department of Health, Republic of the Philippines, 2009 This document is issued by the Degenerative Disease Office, National Center for Disease Prevention and Control, Department of Health (DOH-NCDPC-DDO) for general distribution. All rights are reserved. Subject to acknowledgement of DOH-NCDPC-DDO, all the articles in this manual may be freely reviewed, abstracted, reproduced or translated, in part or in whole, for non-commercial purposes only. If the entire work or substantial portions will be translated or reproduced, permission should be requested from the DOH-NCDPC-DDO.
13 13 13 13 14 14 16 16 16 16 16 17 17
Section 6: Establishing Coalitions and Partnerships . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 6.1 Identifying Potential Local Partners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 6.2 Building Local Coalition for NCD Prevention and Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Section 7: Making Health Services Available and Accesible . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 7.1 Principles in the Delivery of Health Care Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 7.1.1 Levels of Care . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
i
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Foreword
7.1.2 Flow of Delivery of Health Care Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2 Guidelines to Specific Health Care Procedures and Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2.1 Risk Factor Assessment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2.2 Lifestyle Modification . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2.3 Screening and Diagnosis of NCDs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2.4 Management and Treatment of NCDs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2.5 Rehabilitation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.2.6 Palliative Care and Pain Relief . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Section 8: Strengthening Program Management . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.1 Training/Capacity Building . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.1.1 Principles of Adult Learning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.1.2 Training Guidelines . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.2 Supervision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.2.1 Principles in Supervision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.1.2 Guide in Supervision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.3 Surveillance, monitoring and evaluation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.3.1 Principles of Surveillance, Monitoring and Evaluation System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.3.2 Steps in Monitoring and Evaluation Practice . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.3.3 Areas for Monitoring and Evaluation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.3.4 Data Sources . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Section 9: Ensuring Sustainable Health Care Financing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9.1 Health Care Financing Strategy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9.2 Principles in Establishing Health Care Financing Schemes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9.3 Local Health Care Financing Schemes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
24 25 25 27 35 38 43 44 47 47 47 47 48 48 49 50 50 50 51 55 57 57 57 57
Foreword
The prevention and control of chronic, lifestyle-related, major noncommunicable diseases (NCDs), particularly, cardiovascular diseases, cancers, diabetes mellitus and chronic respiratory diseases, has been traditionally implemented as separate programs, each having its own set of policies, protocols and interventions. In the last ten years, the approach towards NCD prevention and control has focused on their common risk factors, specifically, tobacco and alcohol use, physical inactivity and unhealthy diet. These NCD risk factors are prevalent worldwide and becoming more common in the Philippines. As a response to this growing challenge, DOH has launched its promotion of healthy lifestyle. Promotion of healthy lifestyle aims to increase awareness of people on the common risk factors of NCD and to promote healthy diet and nutrition, physical activity, avoidance of tobacco and alcohol. Initial reforms in the health sector is also part of the efforts to respond to the growing concern on NCD, particularly in establishing supportive environment at the national and local levels and in forging a more cohesive partnership between the public and private sector. For example, BFAD plays a critical role in ensuring the availability of quality food products in the market through stricter compliance to food quality control and product labelling rules; and PhilHealth explores also sustainable financing for a wider array of preventive measures as well as benefit packages for hypertension and diabetes. This Manual of Operations on the Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines is an attempt by the DOH to put in one document the guidelines, policies and standards in the delivery of an integrated, comprehensive and communitybased NCD prevention and control services under a health sector reform orientation. It aims to translate into actionable points the national policies and guidelines for the local level. Most of these guidelines were adopted from the existing program manuals, particularly on cardiovascular diseases, cancer control and management, diabetes mellitus and asthma, updated with the new integrated approach on common risk factors. Best practices on healthy lifestyle promotion from global and local experiences are also included in this document. The prevalence of major NCDs continues to grow, and countries cannot be complacent. I therefore encourage all entities concerned, particularly the Local Government Units to act now on the prevention and control of NCDs. I urge all concerned providers and promoters of healthy lifestyle in both public and private sector to make this Manual of Operations as part of their day-to-day reference in the delivery of health care and services. It is my hope that through this Manual of Operations, each of us can make a contribution to stop the increase of NCDs in our country.
Section 10: Sustaining Initiatives and Planning for the Future . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 Appendix A: Integrated NCD Prevention and Control Program Framework . . . . . . . . . . . . . . . . . . . . . 64 Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases . . . . . . . . 69 Appendix C: Package of Intervention for NCD Prevention and Control by Level of Care and Standards and Requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 Appendix D: Risk Assessment Form and Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 Appendix E: Management of Major Noncommunicable Diseases . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 Appendix F: Supervision Checklist on NCD Prevention and Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111 Appendix G: Guide to Making an Instructional Plan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115 References. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117
ii
iii
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Acknowledgment
Message
Globally, the epidemic of noncommunicable chronic diseases threatens economic and social development, and the lives and health of millions of people. In 2005, an estimated 35 million people worldwide died from chronic diseases, double the number of deaths from all infectious diseases (including HIV/AIDS, malaria, and tuberculosis), maternal and perinatal conditions, and nutritional deficiencies combined. Deaths due to chronic diseases are projected to increase by 17% by 2015. In the Philippines, NCDs are among the top killers and cause more than half of all deaths annually. Hypertension and diseases of the heart are among the ten leading causes of illnesses each year. Prevalence of risk factors, particularly tobacco and alcohol use, unhealthy diet, and sedentary lifestyle is high among adults and increasing among adolescents and children. Fortunately, there are proven and tested cost-effective interventions to prevent premature deaths, diseases, and disabilities from noncommunicable diseases and countries can make significant improvements in chronic disease prevention and control. The major causes of NCDs are known, and if these risk factors were eliminated, at least 80% of all heart disease, stroke and type 2 diabetes and over 40% of cancer would be prevented. WHO supports and provides guidance to countries via the Action Plan for the Global Strategy on Noncommunicable Diseases and the Regional Framework for NCD Prevention and Control in the Western Pacific Region These guidance documents take off from the policy and program gains of the Framework Convention for Tobacco Control and Global Strategy for Diet, Physical Activity and Health. This manual of operations for the prevention and control of chronic lifestyle-related noncommunicable diseases is timely and it is likely to be a useful guide in the development or strengthening of national and local policies and programs on NCD prevention and control. It is hoped that this will be used widely by health program managers and other key stakeholders to carry on advocacy for NCD prevention and control and continue to save lives and prevent diseases and disability from NCDs. Congratulations to DOH for coming out of this relevant document. Mabuhay!
Acknowledgment
The Department of Health would like to recognize and thank the following individuals for their contributions in the development of this Manual of Operations. The expertise, time and resources they shared are invaluable. To the members of the Core Group who have taken the time to draft and revise their assigned sections and materials: y y y y y y y y y y y y Dr Yolanda Oliveros, Director IV, National Center for Disease Prevention and Control (NCDPC) Dr Cristina Dablo, Division Chief, Degenerative Disease Office (DDO) Ms Frances Prescilla Cuevas, Chief Health Program Officer, NCD/HL Program Coordinator, DDO Ms Remedies Niola, Nurse VI, DDO Ms Rose Holandes, Supervising Health Program Officer, DDO Dr Marina Baquilod, Medical Specialist IV, National Epidemiology Center (NEC) Ms Luz Tagunicar, Supervising Health Program Officer, National Center for Health Promotion (NCHP) Dr Rosette Vergeire, Medical Officer V, Health Policy Development and Planning Bureau (HPDPB) Dr Francisca Cuevas, Municipal Health Officer, Pateros Dr Rowena Rachel Garcia, Regional NCD Coordinator, NCR Dr John Juliard Go, NCD Technical Officer, WHO-Philippines Ms Sheila Bonito, Assistant Professor, University of the Philippines Open University
To the health service providers who reviewed the document as applied in their health facility settings: y Pateros Municipal Health Office Dr Ronald Raymundo, Physician Dr Ronald Flores, Physician Ms Julia Sapno, Nurse III Ms Joyce Parco, Nutritionist Ms Margie Bade, Nurse III y Pavia RHU, Iloilo Dr Joyous Jan Cuevas-Santos, MHO
Dr Soe Nyunt-U,
y Nueva Valencia RHU, Guimaras Dr Shiela Gumabong, MHO To the DOH NCD Coordinators in the different regions in the Philippines for the additional valuable comments and suggestions to make the Manual more usable and appropriate to the local setting; in particular, CHD- NCR for the clinical practice guidelines. To Ms Eireen Villa who facilitated the overall development process and integrated the different sections and materials from the authors. To Mr Zando Escultura for the beautiful and interesting cover design and layout.
iv
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
To Ms Sheila Bonito, Dr John Juliard Go and Ms Frances Prescilla Cuevas who organized and finalized the document based on the comments and suggestions from the reviewers. The DOH would also like to thank the World Health Organization (WHO) which has always been a supportive partner in the field of Noncommunicable Disease prevention and control in the country. WHO has been very generous in providing the technical and financial assistance to the NCD prevention and control program.
1.1 Objectives
This Manual of Operations for the Prevention and Control of Lifestyle-Related Diseases aims to:
vi
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
implementation, monitoring and evaluation of an integrated and comprehensive program on the prevention and control of lifestyle-related diseases at the local level. It is divided into nine sections. The first three sections provide an introduction of the Manual, overview of the NCD prevention and control program and how it can be established at the local level. Sections 4 to 9 describe the components of the NCD Prevention and Control Program with emphasis on strengthening the health systems as embodied in the DOHs health sector reform initiative called Fourmula 1. Section 10 provides pointers and suggests next steps to ensure sustainability of interventions. Section 1: The Manual of Operations This section introduces and describes the objectives and target users of the Manual and gives an overview of the rest of the contents. Section 2: The Prevention and Control of NCDs This section describes the status of major NCDs in the country and presents past and current initiatives in addressing them. It briefly introduces the National Policy and Strategic Framework in the Prevention and Control of NCDs which can be read fully in Appendix A. The roles of health workers and other stakeholders in NCD prevention and control are also presented. Section 3: NCD Prevention and Control Program at the Local Level This section describes the steps that health workers together with their local government and partners can do to establish, implement their local program on NCD Prevention and Control. Section 4: Promoting Healthy Lifestyle This section describes strategies in promoting healthy lifestyle, provides examples of IEC messages and advocacy materials that the local implementers may want to adopt or initiate. Section 5: Building Healthy Public Policies and Supportive Environments This section defines the policy development
2
process and gives examples of national and local policies that support NCD prevention and control. Interventions on improving the physical environment to promote healthy lifestyle are also discussed. Section 6: Establishing Coalitions and Partnerships This section identifies the stakeholders and potential partners and describes the steps in forming coalitions and partnerships for NCD prevention and control. Section 7: Making Health Services Available and Accessible This section sets the essential package of health services that must be provided to high risk clients for the prevention and control of NCDs. It provides coverage on essential services on: (1) risk factor assessment, (2) lifestyle modification, (3) screening and diagnoses, (4) management of the four major NCDs; and (5) rehabilitation and palliative care. Section 8: Strengthening Program Management This section describes how the NCD Prevention and Control Program can be properly supported through capacity building/training of health workforce and other key stakeholders, supervision, and surveillance, monitoring and evaluation. Section 9: Ensuring Sustainable Health Care Financing This section defines the principles and guidelines to ensure sustainable financing of NCD prevention and control program. Section 10: Sustaining Initiatives and Planning for the Future This section provides inputs on ensuring sustainability of interventions and meeting potential challenges in the future.
and control at the local level. It specifies the expected roles and functions of health workers at the national, regional and local level and provides guidance on the essential policy and program elements which include promoting healthy lifestyle, building coalitions and partnerships, and strengthening health systems to prevent and control NCDs. The manual provides a comprehensive mix of related information to guide feasible and sustainable action on prevention, treatment, rehabilitation and palliation strategies for lifestyle-related diseases. However, it does not contain detailed discussions on specific program strategies nor does it provide a complete listing of clinical protocols or procedures in the sphere of secondary or tertiary care for major NCDs. This manual is a work in progress. As new learning emerges and new initiatives develop, the opportunity to improve the document should always be considered.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
(2009) on costs, availability, and affordability of diabetes care in the Philippines indicate that the median out-of-pocket expenditures for out-patient care is PhP 687 and hospitalization is PhP 8,580. Median daily cost of maintenance medicines is PHP 25/day. Medicines too in general are more expensive compared with other Asian countries. Not surprisingly among diabetics, only 69% are able to sustain regular consultations, 76% maintain regular medication, and 40% maintain regular laboratory tests. Social health insurance covers 79% of those in the formal sector, but lowest at 15% among the informal sector.
2000
yy MagyHLyTayoyCampaignylaunched. yy GuinnessyRecordyforylargestynumberyofyparticipantsyinyaerobicsydisplayy earned. yy NationwideytrainingyofyregionalyNCDycoordinatorsyandyhealthyeducationy andypromotionyofficersy(HEPOs)yonytheypromotionyofyHLyconducted. yy IntegratedyNCDyPreventionyandyControlyStrategyyFrameworkydeveloped; yy NationalyNutritionyCouncilyincorporatedysupportyforynon-communicabley diseaseypreventionyandycontrolyinytheyPhilippineyPlanyofyActionyfory Nutrition. yy PhilippineyCoalitionyforytheyPreventionyandyControlyofyNCDsyformallyy organized. yy Advocacyywithycommercialyfoodyestablishmentsytoyofferyhealthierymenuy optionsyinitiated. yy Keyyofficialsyandytechnicalystaffyofytheynationalygovernmentyagenciesy (DILG,yDepED,yDSWD,yDOT,yetc.)ytrainedyonyHL. yy Aypolicyydevelopmentystudyyidentifyingypolicyyagendayinysupportytoythey integratedyNCDPCystrategyycompleted; yy AssessmentyonytheydemonstrationyprojectyinyGuimarasyandyPaterosy conductedyandyshowedypromisingyresults.y yy PresidentialyDecreeyonytheyDecadeyofyHealthyyLifestyley2005-2015yissued; yy PilotystudyyonybreastycanceryinterventionystudyyinyPaterosyandypilotystudyy inyGuimarasyonycommunity-basedyCRDyinitiativesyinitiated; yy Bi-annualyPublicyHealthyForumyonyNCDyProgramyandyControlystarted; yy UpdatedyFrameworkyforyActionyforyNCDyPreventionyandyControlyinythey PhilippinesydevelopedybasedyonyWHOyGlobalyPlanyofyActionyandyWesterny PacificyRegionalyStrategyyforyPreventionyandyControlyofyNCDs.
5
2003
2004
2001
2005
2002
2006
2007
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
management; y Encourages partnerships and advocates for whole-of-government and whole-of-society approaches; y Ensures sustainability. The full document on the Integrated NCD Prevention and Control Framework can be read in Appendix A. The WHO Western Pacific Regional Framework is likewise shown in Appendix B
Program implementation
yy AdoptyandyimplementytheyNCDy preventionyandycontrolyprogramytoy theywholeyprovince; yy Provideytechnicalyassistanceytoy municipal/ycityyinyimplementingy NCDypreventionyandycontroly measures; yy ConductybaselineysurveyyonyNCDy inypartnershipywithytheycity/ municipality; yy Upgradeyprovincialyandydistricty hospitalsyasyreferralycentersyfory higherylevelyofycareyneededyiny managementyandytreatmentyofy NCDs; yy Trainymunicipal/cityyhealthyservicey providersyonyNCDypreventionyandy control;y yy Coordinateywithynational,yregional,y provincialylevelsyforytechnicaly assistanceyandysubmitydocumentsy andyreportsyasyneeded; yy Conductybaselineysurveyyoryrapidy assessmentytoyestablishyNCDystatusy inytheiryrespectiveylocalities; yy Establishyandyoperateyaytwo-wayy referralyschemeytoyensureypatientsy needingyhigherylevelyofycareyandy servicesytoyaccessythem; yy Establishylinksywithybarangaysy andycommunitiesyforysocialy mobilizationyandyparticipation yy Provideypackagesyofyservicesy/ interventionsyatytheymunicipaly levelytoypreventyandycontrolyNCDs.
Program Management
yy Conductyregularysupervisionyofymunicipal/ cityylevelyserviceyprovidersyinytheydeliveryy ofyNCDypreventiveyandycontrolyservices; yy Provideyfinancialyandylogisticsy augmentationyasyable; yy ContinueytoysupportyPhilHealthy enrollmentyandyadvocateyadoptionyofy otheryfinancingymechanism; yy Establishylinksywithypartneryagenciesyandy solicitytheirysupportyandyparticipation; yy Monitoryandyevaluateyprogressyandy statusyinyNCDyPlanyimplementationyandy outcomesyofyefforts.y
Local Level
Local Level
Table 2. Roles of Health Workers at Different Levels of Implementation Policy and program development
Departmentyofy Health
MunicipalityyCityy
Program implementation
yy Provideytechnicalyassistanceytoythey CHDs,yLGUsyandyotherypartners:ytoy includeysupportyforytheyfollowing: y Developystandardsyandy protocolsytoyguideythey programyimplementation; y Designyandyprovideytrainingytoy addressycapabilityygaps; y DevelopyprototypesyofyIECyandy advocacyymaterials
Program Management
yy Designyandyadvocateyfinancingy mechanismsytoyhelpyLGUsysustainydeliveryy ofytheyNCDypreventionyandycontroly services; yy EnsureycomplianceyofyLGUsytoythey provisionsyofypassedylaws,ypolicies,y standardsyandyprotocols yy Coordinateywithyinternationaly developmentypartnersyforytechnicaly updates yy Collaborateywithydonoryagenciesytoy harmonizeyinvestmentsyandyassistance; yy Developyguidesyonysupervisionyandy surveillanceysystem yy Conductymonitoringyandyevaluation yy Upgradeyandymaintainyoperationsyofy regionalymedicalycentersyandyDOH-retainedy hospitalsyasyreferralycentersyforyadvancedy managementyandytreatmentyofyNCDycases. yy Establishylinksywithypartneryagenciesytoy generateysupportyandyparticipation yy Provideyfinancialyandylogisticsy augmentationytoyLGUsyonyNCDypreventiony andycontrol yy Conductyregularymonitoringyandy evaluation
National Level
yy Setyoverallypolicyy directions; yy FormulateyNationaly StrategicyPlanyofyAction; yy Advocateyforythey draftingyandypassageyofy bills/laws; yy Developynationaly agendayforyresearchy andypolicyyactions; yy Disseminateypolicies,y guidelinesyandy standards;y
yy Adoptyandyformulatey theiryownyMunicipal/ CityyIntegratedyNCDy PreventionyandyControly PolicyyandyProgram; yy Formulateylocalypoliciesy andyordinancesytoy provideyaysupportivey policyyenvironmentyfory theyimplementationy ofyNCDypreventionyandy control; yy Enforceycomplianceytoy NCD-relatedynationaly lawsyandypolicies;y
yy Upgradeyfacilities,ydeployystaffyandyequipy themytoydeliveryqualityyNCDypreventiony andycontrolyservices; yy ProvideyregularybudgetyallocationyforyNCDy preventionyandycontrol; yy Complyywithytheyaccreditationyandy licensingyrequirementsyofyPhilHealthyandy DOH; yy Continueytoyenrollyindigentymembersy toyPhilHealthytoyimproveyaccessytoyNCDy services; yy Designyandyoperateylocalyfinancingy schemeyinysupportytoyNCDypreventionyandy control; yy Establishyandyimplementyyfunctionaly surveillanceysystemyforyNCD; yy Conductymonitoringyandyevaluation; yy Provideybudgetyallocationyforyessentialy medicinesyinyNCD; yy Exploreypossibilitiesyforylocalyhealthy financingyinysupportytoyNCDycases; yy Identifyykeyycommunityyleadersy toyparticipateyinytheyplanningyandy monitoringyofyrelevantyNCDypreventiony andycontrolymeasures; yy Establishyaycommunity-basedysurveillancey systemyonyNCDs;
Local Level
Barangay/y Community
Regional Level
CentersyforyHealthy andyDevelopment
yy Promoteyandyadvocatey adoptionyofythey NationalyPolicyyandy ProgramyonyNCDy PreventionyandyControly yy Ensureyimplementationy ofyImplementingyRulesy andyRegulationsy(IRR),yy policiesyandyguidelinesy issuedyatytheynationaly andyregionalylevel
yy Promulgateyordinancesy yy Provideypackagesyofyservicesy/ andyresolutionsytoy interventionsyatytheybarangayy/ supportyNCDypreventiony communityylevelytoypreventyandy andycontrol; controlyNCDs.y yy Enforceycomplianceytoy yy Organizeycommunityysupporty NCD-relatedynationaly groupsyforyNCDypatients:ydiabetesy lawsyandypolicies; club,ycardiovascularyclub,yetc. yy ContinueytoyprovideyIECyamongy householdymembersyonyhealthyy lifestyle;
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
y Review hospital records for reasons of admissions and discharges; y Randomly select patient records to review common risk factors. Upon availability of resources, LGUs may conduct a baseline survey to measure the prevalence of NCDs and unhealthy lifestyle practices, e.g. tobacco and alcohol use, unhealthy diet, and physical inactivity. WHO has developed a tool to help assess risk factor profiles the STEPwise approach to Surveillance (STEPS), which collects risk factor data as follows: y Step 1: Collecting questionnaire-based information about diet and physical activity, tobacco use and alcohol consumption; y Step 2: Using standardized physical measurements to collect data on blood pressure, height, and weight; y Step 3: Expanding physical measurements with the collection of blood samples for measurement of lipids and glucose status. An assessment of the physical and social environment can also be done, to include but not limited to the following: Determining the existence of policies and local legislations that promote healthy lifestyle or discourage NCD risk factors y Identifying social behavior and practices (e.g. low prevalence of exercise and physical activity, intake of fruits and vegetables, etc ) that contribute to NCDs and risk factors y Identifying physical structures (e.g. parks and open spaces for physical activity, biking and walking lanes, etc.) that serve as barriers or support for healthy lifestyle y Identifying physical structures (e.g. parks and open spaces for physical activity, biking and walking lanes, etc.) that serve as barriers or support for healthy lifestyle A stakeholders profile can also be developed to map up individuals and groups that can be
potential partners, targets, or beneficiaries for NCD interventions. The activity can identify partners in the public and private sectors and segments of population that can be targets for public health education. A capability assessment of the local health system to respond to NCD prevention and control can also be done by: y Identifying the availability and accessibility of service outlets (e.g. BHS, RHUs, hospitals, private clinics, school clinics, etc.), including existence of referral mechanisms for continuity of care across levels of the health care system y Determining the availability of trained staff, logistics, equipment, etc. for the delivery of HL services y Determine existence of inter-local health zone or other forms of inter-LGU coordination mechanisms The LGU, with technical assistance from CHD, shall organize a series of meetings with local health officials and stakeholders to formulate their Plan of Action to address the identified NCD problems and issues in their locality. The Plan shall contain the following: (1) key action points, (2) target indicators (3) locus of responsibility, and (4) resources required. This Plan shall be presented to the Local Chief Executives (LCE) and other stakeholders for adoption and implementation. STEP 2: Developing the Local NCD Prevention and Control Plan After analyzing local NCD needs, there is a need to formulate the vision, goals, objectives and identifying key strategies in addressing NCD problems in the locality. Vision: Describes the end-condition of the population which the locality would like to see happen as a result of NCD prevention and control measures in their area after a certain period of time. Goals: Sets the outcomes to be realized in
9
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
NCD prevention and control. The main goals for chronic disease prevention and control include the following: y improve the health of the population especially the most disadvantaged; y respond to the needs and expectations of people who have chronic diseases; and y provide financial protection against the costs of these diseases Objectives: Refers to desired intermediary results which can be measured in shorter period of time. Objectives may be established according to desired results for each of the targeted segments of the population, or may be set according to the results of key interventions or measures. The following are examples: According to Targeted Population Segments y Reduce the prevalence of smoking among the youth y Increase the proportion of households eating vegetables in the right quantity and quality y Improve the proportion of the general public undertaking regular physical activities According to Key Intervention Measures y Establish a supportive policy environment for adopting and practicing healthy lifestyle y Expand and strengthen the service delivery network of NCD prevention and control services y Strengthen the coordination of NCD-related prevention and control measures The following are proven to have been associated with successful local policy and program implementation: y High level political mandate in policy formulation. Policies emanate from local government authorities, particularly local chief executives, the legislative officials and other executive departments;
10
y The participation of a committed group of advocates. The advocates assist in assessing the local NCD situation, advocate for appropriate actions, and participate in the development, implementation, monitoring, and evaluation of interventions.; y Collaboration with external agencies and institutions at the national or international levels that provide technical updates and assistance; y Wide consultation in the process of drafting, formulations and finalizing the plan until such that the final document is endorsed; y Recognizing that the process of consultation is as essential as the content of the policy framework and plan; y With accompanying communication approach consistent from the start of the process to the end; y Simple and clear vision with set of outcomeoriented goals and objectives STEP 2: Identifying Key Interventions and Means of Implementation, Monitoring, and Evaluation The third planning step is to identify the key interventions for the achievement of program goals and objectives and determining appropriate implementation, monitoring, and evaluation strategies. It is advised that localities adopt the STEPWISE approach to planning, which identifies interventions as core, expanded, or desirable, depending on their feasibility in time. The comprehensive approach requires a wide range of interventions to be implemented depending on their feasibility and likely impact on the local conditions taking into consideration the potential constraints and barriers during implementation. This requires decisions to be made based on the resource available and most likely to be mobilized, the evidences available, known experiences that worked as well as the level of advocacy that can be mounted to support the identified measures.
Strategies and activities can be classified as core, expanded, and desirable. y Core: interventions that are essential and feasible to implement with existing resources in the short term y Expanded: interventions that can be done when more resources are available y Desired: interventions that are beyond the reach of existing resources but can be implemented when optimal amount of resources becomes available The local plan should be comprehensive and should consist of a combination of interventions that target the whole population and high-risk individuals. It should also contain strategies for program monitoring and evaluation. The following provides a menu of options that can be implemented per identified strategy 3.1.2.1 Promoting Healthy Lifestyle y Develop information, education and communication (IEC) materials that will improve knowledge and behavior of the target population on healthy lifestyle y Conduct advocacy campaigns and activities among identified partners who have direct impact or influence to preventing and controlling NCDs, e.g. education, agriculture, private sector, etc. y Coordinate with different community groups youth, informal sector, sports clubs, civic organizations where healthy lifestyle can be integrated in their activities and regular meetings y Convene barangay officials to cascade the healthy lifestyle promotion initiatives down to the community level y Implement healthy settings, primarily healthy workplaces and health-promoting schools, for promotion of healthy lifestyle
3.1.2.2 Building Healthy Public Policies and Supportive Environments y Develop or adopt policies that support local NCD prevention and control:
Local ordinances to implement RA
9211, specifically, banning of smoking in public places, schools, amusement parks frequented by children, workplaces, government buildings, hospitals; regulation of sale of cigarettes among minors; and banning of advertisements of tobacco products in the community Local ordinances or resolutions enjoining the communities, workers and children to join exercise programs School ordinance to support smoke-free, alcohol-free, drug-free and sports-oriented schools to promote health and well-being of students, faculty and other school personnel; provision of healthy foods in the school canteen and banning of foods that are deemed unhealthy; y Orient stakeholders regarding impact of transport design to physical activity of the population y Encourage LGU to build parks and areas for recreation and physical activity, e.g. bicycle lanes, walk pathways, etc y Organize community activities to promote healthy diet and physical activity y Regularly monitor compliance to the regulations and consistently administer agreed-upon penalties to those found not complying to the regulations 3.1.2.3 Establishing Coalitions and Partnerships y LGUs need to engage potential partners including those outside the health sector to participate in the implementation of the local NCD prevention and control program y LGUs can establish a local coalition to facilitate multisectoral activities. They can review
11
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
existing committees that can serve as the coordinating body. 3.1.2.4 Making Health Services Available and Accesible y Ensure availability of package of interventions in the local health facilities y Make available affordable medications y Adopt the Risk Assessment tool in all health facilities y Adopt and comply with DOH-endorsed clinical practice guidelines y Strengthen referral systems among health facilities y Organize support groups, e.g. obesity and diabetes clubs, cancer support, etc 3.1.2.5 Strengthening Program Management y Collect and analyze data using DOH-prescribed monitoring and evaluation tools y Conduct semi-annual program review y Disseminate results of monitoring and evaluation y Submit accomplishment reports
y Document good practices in the implementation of the program y Utilize results in subsequent planning and policy and program development 3.1.2.6 Ensuring Stable Financing y Advocate for LGUs to increase budget allocation for NCD prevention and control y Conduct resource generation from development agencies, private sectors and other partners y Expand PhilHealth membership for the support of some clinical packages in NCD y Design a local financing scheme as needed and develop corresponding guidelines and protocols for its implementation y Monitor the collection and utilization of finances to ensure that these are prioritized for promoting healthy lifestyle Promoting healthy lifestyle is geared towards the process of enabling people to increase control over their health and to improve their health behaviors in relation to prevention and control of NCDs. It is about people making healthy choices and living healthy lives.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Pre-testing may involve asking potential users individually to review the materials and answer a series of questions, or they may involve a group setting as in focus groups. It is also important to give service providers an opportunity to review and comment on materials before they are finalized. y Produce and distribute the material. The number of materials to be produced and distributed should ideally correspond to the number of intended audiences. Consider posting or making them available in strategic places (e.g. BHS, RHU, Schools, Barangay Hall, Municipal Hall, public markets, etc.). y Monitor and evaluate IEC use. Monitoring and evaluation provide inputs for fine-tuning messages and materials and overall IEC approach, as needed. This can be done locally by doing exit interview of clients at the health center or during home visits by asking of their understanding of the message in the IEC materials and what action did they do after seeing/reading the materials.
y y y y y
messages to their clients through texting (SMS) Evaluate the impact of the messaging to the intended audience through informal interviews with clients visiting the clinic or during mothers class Healthy lifestyle expo or exhibit Home visits Client education/counseling Client testimonials Health events (e.g., heart month, cancer awareness month, diabetes week, etc.)
Box 1. Promoting Healthy Lifestyle in Bangued, Abra Healthy Lifestyle: The Bangued Way
TheyMunicipalityyofyBanguedyinytheyProvinceyofyAbrayandyunderytheyCordillerayAdministrativeyRegiony(CAR)yincludesyhealthyasyaypriorityy concern.ySubscribingytoytheyLatinyadageyMensySanayinyCorporeySanoy(ayhealthyymindygoesywithyayhealthyybody),yseveralyprogramsytoy promoteyayhealthyylifestyleyinytheymunicipalityyhadybeenyintroducedyandyimplementedyasyfollows. yy EnactmentyofyExecutiveyOrderyNo.y14yiny2001ywhichymandatedytheyconductyofyayone-hour,ybi-weeklyyphysicalyfitnessyprogramycalledy HatawyNa:yTheyTaeboyChallenge.yyThisywasycomplementedybyytheyintroductionyofytheyHatawyexerciseyprogramyiny2003.yy yy VariousyformsyofyphysicalyexercisesywereyintroducedytoytheyBangued-LGUysuchyasybriskywalking,yjogging,ydancingyandyotheryindoory activities. yy Sportyfacilitiesywereyimprovedyandyprocuredytoyfurtheryengageytheysupportyofytheymunicipalyemployees.yyEvenytheyvenuesyofythey physicalyexercises/activitiesywereyenhancedynotyjustyforytheyemployeesybutyforytheypublicytoyuseyasywell.yExampleyofywhichyisythey MunicipalyPlazaywhichyservesyasytheyperfectyhavenyforyearlyymorningyjoggers/walkers. yy Otheryprogramsyincludeytheyanti-smokeybelchingycampaign,yEco-Parkyconstruction,yCleanyandyGreenyProgramyandyannualymedicaly check-upyforyallymunicipalyemployees. Bangued-LGUycontinuesytoybeycommittedytoybringyhealthyylifestyleytoytheycoreyofytheycommunitysyeverydayylife.
14
15
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
5.1.1 Examples of Policy and Legislation to Support NCD Prevention and Control
There are several areas where local policy and legislation can support NCD prevention and control. For instance, LGUs can strengthen local implementation of the following national laws through some suggested action areas: y Anti-Tobacco Law (Republic Act 9211) Prohibiting the sale of cigarettes to minors Prohibiting the sale of cigarettes near school premises Declaring public areas as non-smoking areas y Sanitation Code Enforcing food establishments to meet sanitary and hygienic requirements Encouraging food establishments to sell safe, healthy and nutritious food Local legislations are formulated and the passed through the mandated local legislative body of the government the Sanggunian bodies at the provincial, city, municipal and barangay levels.
(2) prompt concerned offices or bodies to implement, and (3) follow-up and monitor compliance of target stakeholders at various levels of operations. Localities can do a lot to help implement policies and ensure safety, quality and accessibility to health care and services related to NCD prevention and control as follows: y Ensure that its health facilities (e.g. hospitals, laboratories, clinics) comply with the licensing requirements set by the DOH; y Ensure that health officials and staff only procure drugs and medicines that are included in the essential drugs list and from qualified suppliers by BFAD; y Ensure that medical instruments and equipment and other technical devices are procured by the LGUs are those that have been certified and endorsed by BFAD; y Monitor food products sold in malls, supermarkets, sari-sari stores, etc. to carry warning statements, nutrient claims and nutrition information profiles; y Designate and authorize specific offices to enforce national laws and policies and provide orientation on the provisions of national laws and policies; Health Office through the Sanitary Inspectors:
monitoring of local implementation of RA
to encourage walking as a form of physical activity o designating public space or area for mass physical exercise or sports y Ensure that commercial food establishments, business corporations and other facilities are inspected and complying with standards and requirements before the issuance or renewal of permit to operate; y Ensure that clients with chronic diseases, especially the poor are not deprived of health care and services due to imposition of user fees or high cost of medicines or treatment.
sponsorship of sports and cultural events; monitor compliance of stores banning the sales of cigarettes to minors compliance of the public to designated smoke-free areas y Monitor compliance to ordinances or resolutions passed by the Sangguniang Pangkalusugan in promoting practice of healthy lifestyle practices: o designating lanes/streets for pedestrians
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
include the creation of partnerships, networks and coalition to promote health action. (see section on forming coalitions and partnerships)
Box 2. Enforcing Anti-smoking Campaign in Davao City Advancing the Anti-Smoking Initiatives in the City: The Davao Experience
Dr. Domilyn C. Villarreiz, Co-Chairperson, Anti-Smoking Task Force Davao City
In health there are no compromises No smoking is now a discipline, a habit and a way of life for the people of Davao.
TheypursuityofytheyAnti-SmokingyTaskyForceyofyDavaoyCityytogetherywithytheyturned-advocateyDabawenosyofytheyvisionyforyaySmoke-Freey DavaoyCityyrequiredyaytwo-prongedystrategy:ypromotingyaysmoke-freeyenvironmentybyystrictlyyenforcingytheysmokingybanyinyenclosedyplacesy andypublicyplaces;yandypreventingytheyinitiationyandyincreaseytheycessationyonycigaretteysmokingybyyincreasingytheyawarenessyofytheypublicy onytheyeffectsyofysmokingytoyonesyhealthyandyonytheyAnti-SmokingyLaws.y Smokingyhasybeenyactuallyybannedyinyallyestablishmentsyexceptyforythoseywithyapprovedysmokingyroom/area.yThoseyapplyingyforysmokingy roomsyareystrictlyyinspectedypriorytoyapprovalybyytheyCityyEngineersyOfficeyandytheyAnti-SmokingyTF.yPostingyofyappropriateysignagesyarey ensuredyforysmoke-free/smoke-regulatedyestablishments.yThoseyfoundyviolatingytheylawyareyapprehended.y Withyregardytoysellingyofycigarettes,ytheyTFyseesytoyitythatyallypointsyofysaleyforycigarettesyapplyyforypermitytoysell:y(i)yStoresywithiny100ymetersy fromylearningyfacilitiesyandyrecreationalyplacesyareynotyallowedytoysellycigarettesywhiley(ii)yStoresywithyapprovedypermitsytoysellycigarettesy areyrequiredytoyplaceyaysignythatyminorsyareynotyallowedytoysellycigarettes.yRestrictionsyareyalsoyimposedyonyadvertizingycigarettes.yAlly advertisementsyofytobaccoyproductsynearylearningyfacilitiesyandyrecreationalyplacesywereyremovedywhileynewybillboards/signagesyarey screenedybyytheySignageySectionyofytheyBuildingyOfficial.y Theseyrulesyandyprohibitionsycouldynotyhaveybeenyeasilyyenforcedyifynotyforyseriesyofyinformationycampaignsyundertakenyamongyvariousy groupsyofystakeholders.yToydiscourageyinitiationyandyencourageycessationyofycigaretteysmoking,ylecturesyonytheyeffectsyofysmokingytoyhealthy inyschools/workplaces/communitiesywereyundertaken.yMedicalygroupsyassignedyinydifferentyschools/yhospitalsywereyencouragedytoyputyupy smokingycessationyclinics.yAytri-mediaycampaignyofytheyeffectsyofysmokingywasyalsoymounted.y Toyensureythatytheseyinitiativesyareynotyningas-cogonyinytheymaking,ysustainabilityymeasuresyincludeythey(i)yincorporationyofytheyCompliancey ofyEstablishmentsytoytheyAnti-SmokingyLawyinytheyHealthyyPlacesyInspectionyandyRating;y(ii)ytheycreationyofyayBarangayyAnti-SmokingyTeamy toyenforceylawsyatytheylowestylevel;y(iii)yorganizationyofytheySmoke-FreeyDavaoyAdvocates,yAnti-SmokingyYouthyClubyandyAnti-Smokingy KiddieyClub.yAllyestablishmentsyassignedytheiryrespectiveyAnti-Smokingypointypersonytoyensureytheiryownyestablishmentsycomplianceytoythey Anti-SmokingyLaws.yHealthyprofessionalsyalsoysignedyupytheyDeclarationyofyCommitmentyforytheyCampaign;ywhileyanyExecutiveyOrderywasy issuedytoycelebrateyNoyTobaccoyDayyeveryyMayy31yinyDavaoyCity.
Cigarette and Alcohol Quitters Club; y Peer counselors in communities, schools and workplaces; y Task Forces for monitoring compliance to local policies and legislation on tobacco and alcohol use.
Particular Groups
LocalyChiefyExecutives
18
19
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Sectoral Partners
4.yBeneficiary
Particular Groups
Allybene-ficiaries
Sectoral Partners
2.y Governmenty Partners
Particular Groups
Municipal/ CityyHealthyOffice
DepEdyoryschoolyadministrationyatytheylocalylevel
yy atytheynationalylevel,ycanysupportypassageyofylawsyandybillsyinysupportytoyHLypromotion yy districtysupervisingydoctors/nursesyincludingyschoolyclinicystaffycanybeytrainedyonyHLy promotionyandyserveyasyprovidersyofyNCD-relatedyhealthyservicesytoyfacultyymembersy andystudents yy schoolyadministratorsycanypassypolicies/guidelinesytoyypromoteyhealthyylifestyley practicesyamongytheystudentsy(e.g.yenforcingynon-smokingypolicyywithinyandyoutsidey theyschoolypremises,yminimizingytheysaleyofysoftydrinksyandyjunkyfoodyinytheiryschooly canteen yy atytheynationalylevel,yDepEdycanystrengthenyintegrationyofyyHLypromotionyintoythey schoolycurricula yy facultyymembersycanyintegrateyHLytopicsyinytheirylessonyplansyandyschoolyactivities yy proposeypoliciesytoyimproveytheypopulationsydietyandynutritiony yy leadyinymonitoringycomplianceytoynationalylawsyandyordinances yy coordinateynutrition-relatedyprogramsyandyprojectsytoyensureyconsistencyyandy harmonizationyofyeffortsytowardsygoodynutritiony yy Organizeyphysicalyexercisesyforyemployees yy Promoteyhealthyylifestyleytoytheiryrespectiveyclients yy PlanningyandyDevelopmentyOfficeyincorporateyprogramsyandyactivitiesyforyNCDy preventionyandycontrolyintoytheylocalydevelopmentyandyinvestmentyplan;yconsidery provisionyforyspaceyandyproperyzoningytoyallowysafeyandycomfortableyareayforyphysicaly activities,yandyforypublicytoyencourageywalkingy;y yy SocialyWelfareyOfficeytoyintegrateyinytheyParentyEffectivenessyServicesytopicsyonyHLy practices yy AgricultureyOfficeytoyplanyandyimplementyprogramsytoyproduceyorymakeyavailableyfruitsy andyvegetablesytoytheypublic yy CommercialyestablishmentsycanybecomeysourceyforyfinancialyassistanceyforyHLyactivities yy CorporateyofficesycanyhelpyestablishyHLyprogramsyinytheyworkplacey(e.g.yno-smokingy policy,yhealthy-nutritiousyfoodyservedyinytheirycanteens/cafeteria,ysponsoryannualy check-upsyofyemployees,ytheiryclinicsycanyadministeryriskyassessmentyandyprovidey necessaryycounselingyandyinformationyservices;yorganizeyandyimplementyphysicaly activitiesyforyemployees yy Makeymenuyoptionsyavailableyforyyhealthyyandynutritiousyfoodsy(e.g.yysalad,yvegetables,)y andyynon-useyofyporkylard,yetc. yy Observeyhygienicyandysafeyfoodyhandlingypracticesy
NutritionyCommittee
Communityymembers
OtheryExecutiveyOffices
steps that can be can be undertaken: 1. Identify the potential partners (see Table 4).
4. Establish the organizational structure of the Coalition, keeping in mind the following:
The organizational structure of the coalition
2. Invite the identified partners to join the coalition by sending letters of invitation, organizing meetings or conducting office visits. 3. Set-up the first meeting. This meeting must establish clearly the NCD situation, highlight the need to integrate efforts and the importance of sharing technical expertise and resources. Agree to reconvene in order to come up with a holistic plan of action to address the NCD issues in the locality. Participants to the meeting should have identified specific areas where they can contribute as part of their organizational mandate, programs and activities.
PrivateyCorps/yCompanies/y Factories
Foodyestablish-ments
would vary depending on the complexity of the NCD situation in the area and the size of membership. However, it is advisable to keep the organizational structure as simple as possible. The organizational structure may comprise of the coalition itself with elected officers, and with the support of a secretariat. Technical committees on various concerns (e.g. policy/local legislation committee, advocacy committee, service delivery committee, etc.) may be formed on an ad hoc basis depending on need. Define the roles and functions of the Coalition and the Secretariat:
21
20
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Coalition Body: may be comprised of heads of participating offices/ organizations or their designated alternates Governing Officers: may include a chair, a co-chair, secretary, treasurer elected or agreed-upon by the members Overall Function: Set the overall direction and thrust of NCD prevention and control measures in the area and serves as the coordinating body of programs and activities in support to NCD prevention and control Specific Functions: (1) Provide support to the development of local policies and legislation, frameworks, standards and guidelines for NCD prevention and control; (2) Conduct various advocacy and information initiatives in order to gain the commitment of the political , social, religious and traditional leaders at different levels of society; (3) Provide support to resource mobilization and facilitate pooling of human and financial resources among members; (4) Provide support to surveillance, monitoring, and evaluation of NCDs; Secretariat: This maybe designated to one office (e.g. MHO/CHO or a team of technical/administrative staff from the member organizations
Overall Function: To provide administrative and technical assistance to the operations of the NCD Coalition Specific Functions: (1) Prepare all technical materials for discussion of the Coalition; (2) Collects information/data as needed by the Coalition in order to be able to make sound decisions; (3) Track progress of implementation of decisions made by the Coalition; (4) Identify and summarize issues to be addressed by the Coalition; (5) Draft proposals/position papers or other technical documents that might be required by the Coalition for decisions, discussions, etc. (6) Organize and schedule meetings and follow-up members to attend meetings and document proceedings of all Coalition meetings 5. Develop the Coalition workplan. 6. Organize meetings to discuss updates on workplan implementation and issues and concerns on local NCD prevention and control. 7. Provide opportunities for continuing education and technical updates on NCD prevention and control for Coalition members. 8. Mobilize resources to sustain activities of the Coalition.
22
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
e.g., Diabetes Club, Cancer Support Group, etc., are important elements for holistic care within this level. Tertiary level of care refers to hospitals, usually located in urban areas, which provide highly specialized medical care for patients who are usually referred from secondary level care centers. Minimum basic services should include the package of services under secondary level of care PLUS the following: more advanced diagnostic procedures like angiography, diagnostic imaging (CT scan, MRI, etc), echo-cardiography, ultrasound, pathological diagnosis, etc, specialized treatment (medical management, surgery, radiotherapy, and/ or chemotherapy), palliative and rehabilitative care. Tertiary package of services often can be made available in the regional hospitals, medical centers and/or specialty hospitals. To be able to deliver the package of services for the various levels of care, certain requirements or standards in the type of health personnel required (includes appropriate training and competencies), medicines, supplies and equipment, health promotion aids and recording and reporting tools Figure 1. Delivery Flow of NCD Prevention and Control Services
should be administered to all clients who come in for consultations, regardless if the main reason for visit to the health facility is NCD-related or not. It should be administered even to clients who are not sick but come in for regular health services (e.g. pregnant women and lactating women, children brought in for immunization, etc.). Risk assessment requires thoroughness, completeness and accuracy in obtaining information and measurements.
started smoking, average number of cigarettes smoked per day and the number of quit attempts he/she made last year y For Former Smokers: Ask age when he/she started smoking and at what age he/she quit. Inquire about the average number smoked at the time of regular smoking y For Passive Smokers: Ask if he/she is exposed to second-hand smoke, setting (home, office, etc.) and establish level of exposure 7.2.1.2 Assess nutritional status or diet This normally requires a comprehensive assessment, which includes: (1) a detailed food recall, (2) an extensive questionnaire on food frequency, and (3) estimation of food nutrients using the Food Composition Table and Food Exchange List. However, a more simple tool for assessment of nutrition/diet is recommended for easier administration in the health facilities, especially if there is a long queue of clients awaiting services. y Establish the amount and frequency of eating certain foods that contribute to NCD development. (List foods that are particularly common in the locality). y Ask about the amount and frequency of food eaten particularly (a) vegetables, (b) fruits, (c) fat, (d) sodium or salt, and (d) sugars or simple carbohydrates. Compare their actual intake of the above with the prescribed number of servings as shown in the attached guide. y Further qualify the following practices:
For Vegetables: what are the usual types of
not at risk
at risk
without NCD
with NCD
HL Info/ education
Lifestyle Modification
In assessing use of tobacco or smoking, it is essential to determine: (1) the smoking status (smoker or non-smoker); (2) the trend in clients smoking practice; and (3) exposure to secondhand smoke (i.e. passive smoker). y For Current Smokers: Ask age when he/she
vegetables eaten For Fat: which part of the food (e.g. skin of the chicken) is eaten, how often they eat fried foods and how often they go out to fast food restaurants For Sodium and Salt: how often preserved, canned and instant foods are eaten per week, and how much salt is used when cooking For Sugars: how often table sugar is used,
25
24
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Formula
weightyinykilos heightyinymeters2
How to Measure
Categories
<y18.5 18.6-22.9 y23.0 23.0-24.9 25.0yy29.9 y30.0 Underweight Healthyyweight Overweight AtyRisk Obesey1 Obesey2 normal atyrisk normal atyrisk normal androidyorycentralyobesity normal androidyorycentralyobesity <y-2SD -2SDytoy+y2ySD >y+2SD
y Recommended amount of physical activity to achieve desired health benefit: Regular physical activity: minimum 30minutes daily or most days of the week If moderate intensity: 5 or more days of the week If vigorous intensity: 3 or more days of the week 7.2.1.4 Assess for alcohol drinking The practice of excessive alcohol drinking is not encouraged considering the increasing deaths due to vehicular accidents and effects on the liver (e.g. cirrhosis). y Determine if the individual has a habitual alcohol intake or a risky behavior (e.g., driving or operating a machine) while intoxicated; y Quantify the amount of drinking. Probe further if the individual does not provide an exact amount (e.g. a little, once in a while, only during special occasions, etc.) y Find out the specific type of beverage since the type determines the alcohol or ethanol content. 7.2.1.5 Assess for level of stress and coping
y Find out the specific factors causing the individual to be stressed or under pressure. 7.2.1.6 Summarize results of risk assessment Results of the risk assessment must be communicated at once to the client in a customer-friendly manner. y If the client does not manifest any of the risk factors yet, congratulate him/her for good lifestyle practices and reiterate the message to continue with the practice of not smoking, eating a healthy diet and maintaining a regular physical activity. y If the client is found to have one of the 5 risk factors, engage in lifestyle modification (see section 7.2.2), determine if he/she needs further screening or diagnostic procedures (see section 7.2.3). y If the client is diagnosed to have any of the NCD, make the appropriate treatment and management (see section 7.2.4).
WaistyCircumferencey foryadults
waistycircumferenceyiny inchesyorycms
WaistyHipyRatioyfory adults
WeightyforyAge (forychildren)
and frequency of carbohydrates drinking soft drinks, cakes, chocolates, candies and other sweetened food products y Assess for the Presence of Body Fat (Overweight and Obesity).The presence of excess fat in the body is usually demonstrated by being overweight or obese.
Overweight or obesity is best assessed
weight, height, waist circumference and hip circumference. Compute for BMI and waist-hip ratio using the formula found below. Compare the results of the actual measurements with the standards shown in Table 5. 7.2.1.3 Assess for physical inactivity
The degree under which the individual is subjected to stress or pressure is considered another risk factor that may lead to other unhealthy practices leading to NCDs. Stress is a condition or feeling experienced when a person perceives that the demands exceed the personal and social resources the individual is able to mobilize. Individuals must be screened on the degree of stress they face. y Determine if the individual is suffering from any form of stress. This may come in the form of physical, emotional, psychological, mental problem or issue. y Try to establish the degree or extent of stress or pressure the individual is subjected to day to day.
using the Body Mass Index (BMI) and waist circumference. (Take note, however, that these do not account for frame size, cannot be adjusted for age and do not indicate fat distribution). Other means of assessing for overweight or obesity include: weight for age among children and waist-hip ratio
26
In assessing physical inactivity, obtain information on the (1) type of work of the individual clients, (2) means of transportation, and (3) time for leisure activities like sports and formal exercise. y In general, at least 30 minutes of cumulative physical activity, moderate in intensity, is recommended for most days of the week.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
and exacerbations. It affects not just the active smokers but also those who are exposed to second-hand smoke (passive smokers). Smoking cessation is known to greatly reduce risk to NCDs. Promoting a smoke-free environment also helps individuals quit smoking. Some pointers in promoting smoking cessation: y Be guided by the following measures in assisting clients to quit smoking: Update and record smoking status of clients during every visit. Take every opportunity to counsel smoking clients who visit the health facility. Always discuss maintenance of cessation with clients who have quit. Rearrange facility systems/procedures to facilitate delivery of smoking cessation. Get technical updates on smoking cessations. Link with other concerned personnel and institutions in providing interventions since smoking cessation requires behavioral and pharmacological management. Be a role model. If you are a smoker yourself, avoid smoking in front of your clients and comply with the policies regarding no-smoking areas. y Follow the 5 As in helping clients to quit smoking: ASK client of his/her smoking status Step 1: Assess the smoking status of client. Step 2: Find out if client has considered or tried quitting and determine the stage of change (e.g. pre-contemplation, contemplation, decision, action or maintenance). ADVISE client to stop smoking and that smoking can cause disease, even death. Step 3: Urge all cigarette smokers to quit ASSESS clients willingness to quit Step 4: Target clients motivation to quit Step 5: Encourage complete cessation
28
Step 6: Discuss alternatives and substitutes to smoking ASSIST client in quitting Step 7: Develop a quit plan with the client. Set a Quit Date Step 8: Provide supplementary materials to assist the client Step 9: Develop a plan to prevent relapse ARRANGE follow-up Step 10: Set follow-up sessions to monitor progress and prevent relapses y Work for the establishment of a Smoking Cessation Clinic in your locality or link with a nearby facility which can provide cessation interventions to your smoking clients who expressed the desire to quit. y Help promote a smoke-free environment: Take every opportunity to educate and inform people outside the health facility about the harmful effects and hazards of smoking. Advocate for the passage of local legislations in support to the following: Limiting access of children and youth to cigarettes (e.g. prohibiting the sale of cigarettes in nearby schools and prohibiting sale to minors); Declaring enclosed places and public utilities, especially health facilities as no-smoking areas; Making sure that cigarette labels have prominent warning signs on the dangers of smoking; and Banning the advertisements and sponsorships of activities directed to children and youth.
Establish local coalitions to support
to cardiovascular diseases while diets low in fiber and complex carbohydrates increases the risk of cancer and diabetes. A diet of low salt, low fat and high fiber helps decrease these risks. Promoting proper nutrition will entail the following tasks: (1) nutrition counseling, (2) nutrition education for specific target groups, and (3) supportive environment for healthy nutrition. y Provide Nutrition Counseling. It is not enough to perform risk assessment and screening of individuals. Whenever screening is done, there is ethical responsibility to assist and provide support to individuals who turn out to be at risk or positive for disease. One intervention is to provide nutrition/diet counseling. It is a more individualized health education and addresses the specific problem of the client. Educate and counsel clients found with the following nutrition- related problems that lead to NCDs: (1) obesity; (2) increased fat intake; (3) increased intake of salt and/ or processed and instant foods; (4) and inadequate dietary fiber. Provide specific information and assist the person to modify his/her risk. Take note of the following guide as you educate or counsel them on their nutrition-related problems: Aim for ideal body weight. If client is found to be overweight or obese, he/she should be helped to get back to his/her desirable body weight and maintain it at this level. Maintaining a desirable body weight entails the following: Recognize the eating pattern by keeping a food diary; Observing helpful diet practices such as not losing weight too fast or taking eating small portions of food slowly to end up eating less, etc.; Regular exercise to accompany change in eating habits to make weight reduction more effective.
Build healthy nutrition-related practices.
foods;
Exclusively breastfeed infants up to 6 months and
then give them appropriate complementary foods while breastfeeding up to 24 months; Consume milk, milk products and other calcium rich foods; Eat clean and safe food; Avoid drinking of alcoholic beverages
Choose food wisely. Advise client to select the
individuals break free from their addiction to smoking. 7.2.2.2 Promoting proper nutrition Promoting proper nutrition is essential in the prevention of major non-communicable diseases, particularly cardiovascular diseases, diabetes mellitus and cancer. It is known that diet high in calories and fats increases the risk
Encourage client to consume adequate and well-balanced diet and adopt desirable food and nutrition practices. Eat variety of foods everyday;
proper kind of food to eat especially processed foods by giving careful attention to their labels. Advise them how to interpret the nutrition facts in the food labels. They must take note also of the freshness of the food while checking out on the kinds of additives that were used. Break-off from fast food. Remind clients that the key to breaking a bad habit is to replace it with a new, positive one. Be guided by the following steps in helping clients break any bad habit. Help them define the bad habit. Be sure to describe a bad habit in a specific manner. For example, instead of saying I dont eat very well, describe a specific behavior that demonstrates the problem: I eat too much potato chips. Assist client set a goal. A goal describes the behavior to be substituted for the bad habit. It should be specific and clear and should have a realistic deadline. It should also emphasize doing something, e.g for snacks, choose foods low in fat, such as fruit and low-fat cheeses. If a goal is broad, it should be broken into sub goals. Design with the client an action plan. (a) Monitor the bad habit. Spend a week carefully observing and recording bad habit. (b) Write the plan. Describe in detail the specific day-to-day changes to reach goals. The plan should be a gradual, step-wise process. (c) Keeping a record. Record new behavior daily, including setbacks.
29
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
members and friends. Family and friends should keep an eye on the clients progress, and keep a handy list of the benefits of new behavior. Surroundings should be structured to support efforts.
Should an extensive nutrition counseling be required,
refer the client to the nutritionist for further action. y Conduct Nutrition Education for Specific Target Groups. Nutrition education is a key strategy in the promotion of good nutrition among target population. With the increasing prevalence of NCDs, the need to provide nutrition education among target clients specifically on healthy diet and the promotion of a supportive environment for good nutrition is very important. It is one of the major tasks and a challenge among health workers mainly responsible for public health care and service delivery. Focus your nutrition education efforts to the following groups of clients: Clients who are well, at risk, or even with disease Mothers, food handlers and food service people Stakeholders in key positions to influence others like teachers, day care workers, community and civic leaders
When conducting health education for a
provide the cheapest and most accessible source of fruits and vegetables. Support government programs that encourage gardening and vegetable farming; Collaborate with the Department of Agriculture and other government agencies to help conduct trainings and seminars as to the proper way of growing fruits and vegetables (e.g. which plant would survive in which type of soil and other conditions such as amount of water and minerals that specific plants need); Promote fruits and vegetables as special prizes or rewards in school affairs and in certain barangay events, such as fiestas and other public celebrations.
Campaign for nutrition-friendly
and obesity including colon and breast cancer, high blood pressure, lipid disorder, osteoporosis, depression and anxiety. Clients that manifest physical inactivity during risk assessment should be provided with clear information and guide how to establish a regular physical activity or exercise. y Clarify first the difference of physical activity from exercise. Physical activity refers to something that you do at home (e.g. washing of dishes, sweeping the floor, etc.) and also things that are done outside the house (e.g. gardening, washing car, etc.). Exercise is a planned, structured and repetitive movement (e.g. jogging or walking daily for 2 hours, basketball once a week, etc.) done to improve or maintain one or more components of physical fitness, namely: cardio-respiratory, endurance, muscle strength, and toning or weight loss. y Explain the benefits of physical activity. Regular physical activity improves health and reduces the risk of premature death. It provides physiological gains like (1) increased efficiency of the heart to function, (2) improved blood circulation/ supply to the heart, (3) increased blood volume, number of red blood cells and high-density lipoprotein; and (4) decreased levels of bad cholesterol. It provides emotional benefits like mental alertness, concentration, self-image, self-confidence and lowered stress and anxiety. y Promote Physical Activity Client needs to improve the performance of daily activities by integrating and putting in more activities into the daily routine (e.g. walking, cycling, jogging to work, taking the stairs instead of elevators, take fitness breaks instead of coffee breaks, perform gardening, cleaning the house, scrubbing, etc.).
physical activity required to achieve health benefits is: at least 30 minutes, cumulative of moderate intensity for 5 or more days a week (e.g. walking briskly, mowing the lawn, dancing, swimming, etc.); at least 30 minutes, cumulative of vigorous intensity, 3 or more days a week (e.g. jogging, chopping wood, bicycling uphill, etc.)
Emphasize that physical activity should be
environments
Advise client to buy fresh food instead of commercially
processed food items. Encourage selling of farm products produced in the community, making sure they are fresh and safe. Fresh foods are usually more nutritious and safe from all the chemical additives present in processed foods; Encourage them too to campaign against the proliferation of commercial establishments (e.g. fast food buildings or stalls) in the area which could become source of unhealthy food and food products. Campaign for proper zoning to limit these food establishments.
Advocate clients to support health and
done as a habitual practice, meaning that it should be done regularly. Clients who are currently performing moderate physical activity should be encouraged to increase the intensity of their activities while those who are already performing vigorous intensity activities should maintain them so. y Promote Exercise Plan with the client which of the four components of the exercise he/she would like to achieve. Based on this, identify specific exercise activities that the client would like to engage in. Incorporate during planning the three factors of FIT Principle: (1) frequency of the exercise, (2) intensity of the exercise; and (3) time allotted for the exercise. Advise the client to monitor the intensity of the exercise through the following: (1) perceived exertion, and (2) target heart rate and estimate d heart rate Advise the following safety measures during exercise There is a need to warm up and cool down before and after the exercise; Observe precaution to avoid soreness or injury to the musculoskeletal system; Advise clients who experience the following forms of cardiovascular diseases (high blood pressure, high blood cholesterol, family history of heart disease, diabetes mellitus and obesity) to seek medical evaluation before engaging in exercise programs. y Promote physical activity in the workplace, in
31
nutrition policies
Support the formulation and implementation of policy
group
Readiness to change Development stage and their immediate concerns
y Promote Supportive Environment for Healthy Nutrition. Providing nutrition education or counseling to individuals is not enough to promote good nutrition. The environment plays a major role in influencing nutrition-related behavior, particularly in the availability and access to healthy food. It is essential that you advocate among your clients the following behaviors: Encourage client to put up vegetable gardens in their backyard. Aside from being a healthy outdoor activity, it would
30
in prohibiting drinking of alcohol beverages, limiting the sale of soft drinks and junk foods in the school canteen and prohibiting students from buying their food for lunch from the street vendors; Advocate and influence health school and local government officials for the strict implementation of school policies. 7.2.2.3 Promoting physical activity and exercise The importance of physical activity or exercise in the prevention of NCDs cannot be overemphasized. Sedentary lifestyle or the lack of physical activity has grave consequences to ones health. It is highly associated with the increased risk to cardiovascular diseases, diabetes mellitus
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
school, church, among youth clubs, informal sector groups or other segments in the community. y Involve target clients in designing the physical activity and exercise programs to help sustainability of the activity 7.2.2.4 Promoting avoidance of alcohol use y Help clients recognize that alcohol is not good for the body. Chronic alcohol use can lead to dependence, neurological problems, and vitamin deficiency. y Determine the scale of drinking by asking clients to record the amount of alcohol consumed in a week or a month and help then decide to stop the habit. y Analyze the pattern of drinking to successfully stop the habit. If drinking mainly with friends, advise to stay in or look for other activities such as any sports event, trip to the movies or the mall, or walk in the park. y Advise clients to avoid keeping alcohol in the house. y Determine whether clients need professional help to stop drinking alcohol and refer. 7.2.2.5 Promoting stress management The effect of stress depends on how the client handles it. Handling and management of stress depends mainly on being able to recognize it, knowing where the stress is coming from and understanding the stress-management options best suited for each particular situation. y Identify symptoms of stress. Manifestations of stress are numerous and varied but they generally fall into 5 categories, namely: physical, mental, emotional, behavioral and interpersonal. Several stress reactions that persist for long periods of time and recur without warning after a traumatic event or even after an intense experiences such as an accident, hospitalization, or loss, may become a post-traumatic stress disorder (PTSD) requiring professional assistance to overcome.
32
y Identify sources of stress. There are two kinds of stressors, (1) internal and (2) external. Internal Stressors
Lifestyle choices: caffeine, not enough
slows breathing helps muscles relax gives the body time to eliminate lactic acid and other
sleep, overload schedule Negative self talk: pessimistic thinking, selfcriticism, overanalyzing Mind traps: unrealistic expectations, taking things personally, all or nothing thinking and exaggerating, rigid thinking Stressful personality traits: Type A, perfectionist, workaholic, pleaser Major life events: death of a loved one, lost of job, promotion, marriage, separation or divorce, new baby, illness, calamity and disasters
waste products eliminates stressful thoughts helps clear thinking helps with focus and concentration reduces stress headaches
External Stressors
Physical environment: noise, bright lights,
heat, confined spaces Social interaction: rudeness, bossiness, aggressiveness on the part of someone else Organizational: rules, regulations, red tapes deadlines, reorganizations Daily hassles: commuting, traffic, mechanical breakdown, misplacing of things such as keys, documents, bills y Promote stress management techniques. Spirituality. Spirituality can be exercised through meditation. The idea of meditation is to focus ones thoughts on one relaxing things for a sustained period of time. It gives the body time to relax and recuperate and clear away toxins that may have built up through stress and mental or physical activity. Meditation should be done in a position that one can comfortably sustain for a period of time (20-30 minutes is ideal). The lotus position may be appropriate or sitting in a comfortable chair or lying on a bed can be equally effective. Meditation can have the following effects: lowers blood pressure
getting in touch with ones feelings or being open to experiences. It increases sensitivity to inner self and to relationship with the world around, how one responds to people and the effects on them. It is important in evaluating ones abilities realistically, identifying the areas in which one needs to improve on, recognize and build strengths to develop more effective interpersonal relationship, understand the kind of motivation that are influencing such behavior, develop empathy and understanding to recognize both personal needs and needs of other people. Scheduling: Refers to time management. It is important to begin accepting time as the most important resource, a tool which can be drawn upon to accomplish results, an aid that can take care of need, an assistant in solving problems. Managing time means managing oneself in such a way as to optimize the time available so that it will yield gratifying results. Siesta. It means taking a nap, a short rest, a break or recharging of battery in order to improve productivity. It helps relax the mind and the body muscles. A study has shown that siesta invigorates the body. Performance of an individual scored high when siesta is observed for 15-30 minutes. If one exceeds 30 minutes, one will feel groggy and ineffective. Siesta can be done by having a nap, lying down, closing your eyes and resting your head. Stretching. These are simple movements performed at a rhythmical and slow pace executed at the start of a demanding
33
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
activity to loosen muscles, lubricate joints and increase bodys oxygen supply. It requires no specific equipment, no special clothes, no special skills and can be done anywhere and at any time. Stretching encompasses the following:
Breathing Control. Deep breathing is a key element
following example: Form a fist and clench your hand as tight as you can for a few seconds Then relax your hand to its previous tension Then consciously relax it again so that it is as loose as possible Feel the deep relaxation in the muscles
Imagery. This is a powerful method of stress reduction
of everything from taking deep breaths approach to calming someone down, to yoga relaxation and Zen meditation. It works well in conjunction with other relaxation techniques. Concentrate on breathing in and out Accompany this by counting your breaths using the numbers 0 to 9. Visualize the images of the numbers changing with each breath Alternately visualize health and relaxation flowing into your body when you inhale, and stress or pain out when you exhale
Exercise. Frequent exercise is probably one of the best
physical stress-reduction techniques available. Exercise not only improves ones health but also relaxes the tense muscles and helps you sleep. Other benefits of exercise include: Improves blood flow to the brain, bringing additional sugars and oxygen which may be needed when one is thinking intensely When thinking hard, the neurons of the brain function more intensely and build up toxic waste products that cause foggy thinking. Exercise speeds up the flow of blood through the brain , moving the waste products away faster Releases chemicals called endorphins into the blood stream which give a feeling of happiness and well-being.
Progressive Muscular Relaxation (PMR). It
is a purely physical technique for relaxing the body when muscles are tense. The idea behind PMR is that a group of muscles is tightened as they are tightly contracted as possible by holding them in a state of extreme tension for a few seconds first, and relaxing them back again to their previous state. This can be applied to any or all of the muscle groups in the body depending on the need and preferences. Try the
34
when combined with physical relaxation methods such as deep breathing and PMR. Knowing that certain types of environment can be very relaxing while others can be intensely stressful, the imagery technique makes use of the imagination to recreate a place or scene that is very relaxing. The more intensely one uses his/her imagination to recreate the place or situation, the stronger and more realistic the experience will be. Imagine a scene, place or event that you remember as peaceful, restful and happy; Bring all your senses into the image, with sounds of running water and birds, the smell of lavender, the taste of cool spring water and the warmth of the sun, etc.; Use the imagined place as a retreat from stress and pressure Sensation Techniques. The sense of touch is a powerful and highly sensitive form of communication. It is a natural reaction to reach out and touch, whether to feel the shape or texture of something or to respond to another person. Massage helps soothe away stress, unknotting tensed and aching muscles, relieving headaches and helping sleep problems. It is also invigorating as it improves the functioning of many of the bodys systems, promotes healing and tones muscles, leaving with a feeling of renewed energy. Sports. These are skills and games which involve the participation of group of people or a person, competing with others for a common goal. In sports, the mind and body work together as a single unit and therefore affects the bodily system. In particular, it has effects on the heart muscle, blood pressure, pulse rate, red blood corpuscles and the nervous system. It is important to engage
in sports activities that create awareness. Sports have been identified as one way to manage and relieve stress. Socials. Man is a social being who exist in relationship with his physical environment and in relationship with people and society. Socialization plays a very important role in the development of interpersonal relationships. Through it, life comes meaningful, happy and worthy. On the contrary, without socialization, life will be boring and empty. One form of a social activity is dancing. Through dancing, man enjoy his bodys love and expresses gesture and releases tension through rhythmic movement Sounds and Songs. Music plays an important part in everyday life of an individual. It provides the medium of expression of thoughts and emotions. It is also the best means to relieve tension, stress, fears and anger. Music is believed to have tremendous moral and social forces, arousing an individual into action and giving him/her awareness of the world of peace and beauty. Sound is a form of music where it stimulates a motion of molecules in the air. This chain reaction continues as it strikes the card rum where the nervous system picks up the impulses and transmits it to the brain and finds them fascinating and satisfying. Songs on the other hand is the most natural form of music. Issuing from the body, it is projected by means of the voice. Speak to Me. Communication is the means by which people make their needs known. It is the way people gain understanding, reinforcement and assistance from others. Talking to someone when one feels overwhelmed or unable to deal with the stresses in his/her life is often the best medicine. Stress Debriefing. Critical incident stress debriefing is assisting crisis workers or team members to deal positively with the emotional impact of a severe event or
disaster, and to provide education about current and anticipated stress responses, as well as information about stress management. Critical event is any unusually strong or overwhelming emotional reactions which have potential to interfere with work during the event or thereafter among the majority exposed. Smile. It has been observed that individuals who always smile are healthy people. Smile is an expression of pleasure, amusement, affection and irony. Studies have shown that smiles relive all kinds of stresses, physical or mental. It is also considered as one of the ingredients that will motivate and encourage individuals to work harder and improve level of performance. When one smiles, muscles are relaxed because only 15 muscles are working while frowning affect about 65 muscles.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Hypertension
portrays any of the following situations: (1) an increased incidence of a condition; (2) a significant prevalence of the condition; and (3) a recognized element of high risk within the group. This however is quite expensive considering the mass of people who will be subject to screening tests. 7.2.3.2 Specific Screening Tests Screening is usually disease-specific. Hence, specific screening tests are applied for each of the following diseases. Hypertension: A sustained elevation in mean arterial pressure which results from changes in the arterial wall such as loss of elasticity and narrowing of blood vessels, leading to obstruction in blood flow that can damage the heart, kidney, eyes and brain Elevated Blood Cholesterol: Defined by having cholesterol level higher than normal levels which is either classified as elevated may be at risk (200-239 mg/100 ml) and elevated at risk (240 mg/100 ml) Diabetes Mellitus: A genetically and clinically heterogeneous group of metabolic disorders characterized by glucose intolerance with hyperglycemia present at time of diagnosis elevated amount of sugar in the blood Cancer: Growth of abnormal cells in specific parts of the body much faster than normal cells do, thus outliving them and continue to compete for blood supply and nutrients that normal cells need COPD: Characterized by airflow limitation that is not fully reversible. It is usually both progressive and associated with abnormal inflammatory response of the lungs to noxious particles or gases Asthma: An inflammatory disorder characterized by increased airway hyper-responsiveness manifested by a widespread narrowing of air passages which may be relieved spontaneously or as a result of therapy. Other clinical manifestations
36
include paroxysm of breathlessness, chest tightness, breathing and coughing. The screening tests to be applied per disease, the classifications of the results obtained from the tests and guides for frequency of tests or interpretation are summarized in Table 6. y Be reminded of the following guide as you screen clients: Remember that screening is only a way to detect if individuals are at risk or with possible disease. Hence, Do Not Label individuals at this stage yet as hypertensives, diabetics,or asthmatics at this stage since it may result to extreme anxiety on the part of the clients and their families. If screening turns out to be positive, there is a need to further confirm the diagnosis and repeat the test or refer clients to appropriate institutions if the condition warrants specialized diagnosis and treatment. On the other hand, if the result is negative, it does not also mean that a person is disease free. It is best to schedule client for a repeat testing. Inform clients of the meaning and limitations of the results. Explain that this can contribute to the development of the disease if not controlled. Educate clients how to modify the risk factors and promote positive lifestyle change. Monitor and follow-up clients based on the recommended schedule. y If there are risk factors present: CONFIRM retesting if needed and frequency of retesting. For example, a client with 140/90 BP is classified to be in Stage 1 and needs to be confirmed in 2 months. EXPLAIN the significance of the finding and that this can contribute to development of disease if not controlled. EDUCATE on how to modify risk factors
Diabetes Mellitus
yy ChestyX-Rayyeveryy6ymonths yy Sputumycytology yy yy yy yy
SuspectyCOPDyinypersonsywithytheyfollowing: >y50yyearsyold ysmokingyforymanyyyears withysymptomsyofyprogressiveyandyincreasingyshortnessyofybreathyonyexertionyand/or chronicyproductiveycough Suspectyasthmaypersonywithytheyfollowing:
Asthma
37
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
and promote positive lifestyle change. MONITOR and follow-up based on recommended schedule. REFER for confirmation of diagnosis especially if screening was done by a nondoctor to a medical specialist or center if condition warrants specialized diagnosis and treatment.
when cooking and avoiding salty foods like processed meat, peanuts, and other commercial products. Expend energy through physical activity and exercise. y Identify stage of hypertension (see Appendix E for details). Prescribe lifestyle modifications for all patients with pre-hypertension (120/80139/89 and hypertension (140/90). y Treat BP<140/90 mmHg or BP<130/80 mmHg in patients with diabetes or chronic kidney disease. y Improve adherence to drug therapy. Empathy increases patients trust, motivation, and adherence to therapy. Consider patients cultural beliefs and individual attitudes. y Urgently refer patients in hypertensive emergencies or situations which that require urgent blood pressure reduction to prevent or limit organ damage (e.g. unstable angina, acute myocardial infarction, acute ventricular failure with pulmonary edema, aortic dissection, eclampsia, and hypertensive encephalopathy). 7.2.4.1.2 Coronary Artery Diseases Two major coronary artery diseases are angina pectoris and myocardial infarction. In either case, drug therapy is still the main treatment. These medications work either by reducing the oxygen demand of the heart, by helping the supply of blood or both. Management and treatment include the following: y Angina Pectoris Prevention of Acute Anginal Attack Use of nitroglycerin in different forms: sublingual, oral, ointment, patch
Treatment of Acute Anginal Attack Use of any of the following drugs as may be indicated: sublingual nitroglycerin
long-acting nitrates: beta adrenergic antagonist (any) calcium channel blockers sedatives, tranquilizers and anti-depressants digitalis and diuretics anti-arrhythmic drugs
y Myocardial Infarction (MI) As soon as a patient suspected of having suffered from a MI is brought in, the following measures must be immediately carried out:
Provide oxygen through a face mask or
of blood clots could be life-saving. Recent blockage coronary artery may also be managed surgically. y Drug therapy can include the following: anti-coagulant medications (for ischemic strokes) anti-platelet medications steroids mannitol 7.2.4.1.4 Cancers Prevention and control of cancers require the following major approaches: 1. Primary prevention focuses on eliminating the conditions that cause cancer to develop and is being advocated as an important control strategy 2. secondary prevention refers to early detection coupled with effective therapy 3. definitive diagnosis and management refers to treatment and after cure of diagnosed cancers 4. supportive care (rehabilitation and pain relief ) refers to provision of continuing care and rehabilitation of post treatment cancer patients and the terminally ill Treatment of cancer may include surgery, chemotherapy, radiotherapy, immunotherapy or combinations of these. This section is focused on the treatment and management of cancers, primarily of the leading specific sites which include: lung, breast, and cervix. y Lung Cancer Classify and identify the stage of lung cancer. Follow the recommended protocols for treating lung cancer. Refer to Appendix E for the algorithm on screening for lung cancer and treatment
39
nasal prong For patients experiencing fibrillation or arrhythmias, defibrillation should be done Drugs most commonly used in cases of acute MI include the following: analgesics nitrates thrombolytic therapy beta-blockers anti-arrhythmic drugs sedatives laxatives 7.2.4.1.3 Cerebrovascular Accident (Stroke) and Transient Ischemic Attack (TIA) Stroke is an emergency. It is important that it is recognized immediately and referred to a secondary or tertiary level care facility. The aim of management is to stop its progression and prevent recurrence. y During the acute phase, it is important to maintain fluids and electrolytes (e.g. sodium and potassium), avoid low blood pressure and to avoid paralysis and secondary complications such as pneumonia, urinary tract infection, muscle contractures and bedsores. y Surgery is usually not used to treat an acute stroke; however it may be indicated for hemorrhagic strokes in which evacuation
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
protocol. y Breast Cancer Identify the stage of breast cancer. Follow the recommended protocols for treating breast cancer. Refer to Appendix E for the staging for breast cancer and treatment protocols. y Cervical Cancer Perform clinical evaluation for possible staging of cancer. Follow the recommended protocols for treating cervical cancer. Continue patient education to encourage patient follow-up. 7.2.4.1.5 Diabetes Mellitus Management of diabetes mellitus includes team-based care, patient education, nutrition, physical activity, pharmacologic treatment, and monitoring of glycemic control.
Team-based care. Diabetes mellitus is
nature of the disorder symptoms of diabetes risk of complications (and in particular the importance of
foot care) individual targets of treatment individual lifestyle requirements and meal planning importance of regular exercise interaction of food intake, physical activity, and oral hypoglycemic drugs, insulin, or other drugs self monitoring of blood or urine glucose, the meaning of blood glucose results, and what actions need to be taken how to cope with emergencies e.g. illness, hypoglycemia, stress and surgery women with existing diabetes require special attention during pregnancy
Nutrition. Effective management of
best managed by a team which includes not only the health care professionals but also the patient. The team-based approach allows flexibility in delivery of care and improves communication among the health care professionals. Standard members of the core team should ideally include the physician, diabetes educator, and nutritionist/dietitian but need to be tailored to local situations. Additional members of the team can be added when necessary and available, e.g. ophthalmologist, nephrologist, cardiologist, obstetricians, psychologists, etc. Patient education. Patient education is more than helping people with diabetes monitor their blood glucose or take their medications as prescribed. It must be an ongoing process rather than a one time event because a persons health status and need for support changes over time. The patient with diabetes should be educated on the following:
40
diabetes cannot be achieved without proper attention to diet and nutrition. The goal of nutritional management should be focused on: (1) achieving and maintaining optimal blood glucose levels; (2) reducing vascular risk factors, including dyslipidemia and hypertension; and (3) providing a balanced diet Advise patients to eat a balanced diet, with sufficient variety which the whole family can follow and enjoy. Eat most: Use one or more of these foods as the basis of every meal; e.g. vegetables, legumes, noodles, rice, bread, grains, wholegrain cereals, nonsweet fresh fruits Eat moderately: have small servings of proteinrich foods; e.g. fish, seafood, eggs, lean meat, skinless chicken, low-fat cheese, low-fat yoghurt, low-fat milk, nuts Eat least: Minimize fats, sugar, salt and alcohol; e.g. butter, oil, cream, coconut milk and cream, processed meat, fried foods, preserved or processed foods, pastries, sweets, biscuits, soft drinks
Advise overweight patients to lose weight of about
energy intake. Avoid or limit the following: fatty meals, full cream dairy products, palm oil, coconut oil and processed foods. Use monosaturated and polyunsaturated fats in place of saturated fat. Carbohydrate should provide 50-55% of the total energy intake. Meals should contain mostly carbohydrate with an emphasis on high fiber foods such as vegetables, legumes, whole grain cereals, yams, and fruits. Sucrose should provide no more than 10% of total food intake. Small amounts of sugar can be consumed as part of a healthy eating plan and non nutritive sweeteners can be used to replace larger quantities of sugar. Eat three meals daily to distribute carbohydrate intake during the day. Protein should provide 15-20% of total energy intake. Good sources of protein are fish, seafood, lean meat, chicken, low-fat dairy products, nuts and legumes. Restrict salt intake to less than 6 grams per day, particularly in people with hypertension. Limit foods which are high in salt such as preserved and processed foods and sauces (e.g. soy, oyster and fish sauces).
Physical Activity. Physical activity plays
activity hazards such as cuts, scratches, and dehydration, and special care of the feet should be taken. If physical activity is sudden and/or vigorous, advise patient to adjust their food intake or medications in order to avoid hypoglycemia
Pharmacological Treatment Drug treatment should be added only when diet,
5-10% of the body weight over 3 to 6 months by reducing total energy intake by reducing portion sizes and avoiding excessive intake of fats and sugar; and to maintain achieved weight loss and prevent regaining of weight Fat intake should be no more than 30% of total energy intake. Restrict saturated fat to less than 10% of total
an important role in the management of diabetes. It improves insulin sensitivity, thus improving glycemic control and may help with weight reduction. The common goal of physical exercise should be to achieve at least 150 minutes of moderate intensity physical activity each week. Physical activity program/s have to be appropriate for the patients age, social, economic, cultural and physical status. Advise patient to undertake physical activities and adopt healthy lifestyle practices within daily living Do everyday: Adopt healthy lifestyle habits; e.g. walk to the shops instead of driving, use the stairs rather than the elevator, walk to the office of colleagues instead of using the telephone, walk the dog Do regularly: Participate in leisure time physical activity and recreational sports activities; e.g. briskwalking, tai-chi, cycling, golf, strength training, ball games Do sparingly: Avoid sedentary activities; e.g. watching television, using the internet, playing computer games
Careful attention should be paid to potential physical
physical activity and education have not achieved the treatment targets. If the patient is very symptomatic or has very high blood glucose level, diet and lifestyle changes are unlikely to achieve the target values. In this instance, pharmacological therapy should be started without delay. The pharmacological treatment of hyperglycemia is based on the two key metabolic abnormalities in diabetes mellitus: (1) insulin resistance; and (2) impaired insulin secretion. Each hypoglycemic agent targets one of these abnormalities, and combination therapy is often required to address both components. See Appendix E for details on pharmacologic treatment Pharmacological treatment of diabetes should be tailored for patients in special situation. These include the children and adolescents, the pregnant women, those undergoing surgery, the elderly and those with psychiatric disorders.
Monitoring of glycemic control The gold standard for assessment of long-term
glycemic control is glycosylated hemoglobin (HBA1c) and this should be measured every 3-6 months. Monitoring of glucose levels can be done by either blood or urine testing. Blood testing is optimal, but if this is not available, urine testing is an acceptable compromise. Urine testing does not detect hypoglycemia and is not useful where the renal threshold is elevated. The frequency of monitoring depends on the available resources. Self-monitoring of blood glucose levels should be regarded as essential to improve the safety and quality of treatment for those who are treated with insulin and during pregnancy Management of diabetes requires active partnership between patients, their families, and the health care team. Every one, thus, has a role
41
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
to play in improving health outcomes for people with diabetes. 7.2.4.1.6 Chronic Respiratory Diseases Common Chronic Respiratory Diseases include asthma and the chronic obstructive pulmonary diseases (COPD) such as chronic bronchitis and emphysema. Attacks of CRDs may vary from gradually increasing respiratory distress to sudden or acute respiratory distress with feelings of suffocation, inability to speak, chest tightness, wheezing and cough with thick, clear or yellow sputum. y Asthma The goal of the management of asthma is to achieve control of asthma, which is defined as: minimal chronic symptoms, including nocturnal symptoms minimal exacerbations minimal need for prn beta-2 agonist, ideally none no limitations on activities, including exercise normal PEFR PEF variability is < 20% Minimal adverse effects from medications
Control Triggers of Asthma. Triggers are risk factors involved in the development
blankets weekly in hot water 55 degree C or more for at least 7 minutes avoid sleeping or lying on furniture upholstered with fabric remove carpets. If not possible, spray 3% tannic acid once a month use chemical agents, if available to kill mites or alter the mite antigens in the house Pharmacologic Therapy of Asthma The choice of management should be guided by the severity of the patients asthma, and the benefits, risks, cost and availability of the various forms of asthma treatment A stepwise approach to pharmacologic therapy, in which the number and frequency of medications increase as asthma severity increases, is recommended. The aim is to accomplish the goal of therapy with the least possible medication Inhalation therapy is the optimal form of treatment. In instances where the ideal is not practical, a stepped-care approach using oral formulations is an alternative. Rational drug therapy of asthma necessitates the use of the right mix of CONTROLLER medications (those that can keep asthma under control) and RELIEVER drugs (those than quickly reverse airway obstruction and its associated symptoms) for the degree of asthma severity. See Appendix E for list of controller and reliever drugs in asthma
Patient Education for Asthma The aim of patient education is to provide the asthma
is not fully reversible. This airflow limitation is usually progressive and associated with an abnormal inflammatory response of the lung to noxious particles or gases. The most common risk factor is tobacco smoke. Other factors include chronic exposure to occupational dusts and chemicals (vapors, irritants, and fumes), indoor air pollution (from burning of wood and other biomass fuels) and sometimes outdoor air pollution. Diagnosis of COPD depends on the presence of dyspnea, chronic cough or sputum of production, and/or history of exposure to the above risk factors. Diagnosis should be confirmed by spirometry. The goal of COPD management include: Relieve symptoms Prevent disease progression Improve exercise tolerance Improve health status Prevent and treat complications Prevent and treat exacerbations Reduce mortality Prevent or minimize side effects from treatment
Management of COPD includes:
depression or anxiety Social and family support available to the patient Possibilities for reducing risk factors, especially smoking cessation (2) Reduce risk factors Smoking cessation is the single most cost-effective intervention to reduce the risk of developing COPD and slow its progression Counseling to quit smoking (follow 5As) Pharmacotherapy, such as nicotine replacement, buproprion/ nortryptiline, and/or varenicline) is recommended when counseling is not sufficient to make patient stop smoking Encourage comprehensive tobacco control policies and programs Eliminate or reduce exposures to various substances in the workplace, causes of indoor and outdoor air pollution (3) Manage stable COPD Patient education can help improve skills, ability to cope with illness and health status. It is an effective way to accomplish smoking cessation, initiate discussions about end-of-life issues and improve responses to acute exacerbations. Pharmacologic treatment can prevent and control symptoms, reduce the frequency and severity of exacerbations, improve health status and improve exercise tolerance. Drugs can include bronchodilators and glucocorticosteroids. See Appendix E for details on drug therapy. Non-pharmacologic treatment includes rehabilitation, oxygen therapy and surgical intervention. (4) Manage exacerbations An exacerbation of COPD is defined as an event in the natural course of the disease characterized by a change in the patients baseline dyspnea, cough, and/or sputum that is beyond normal day-to-day variations, is acute in onset, and may warrant a change in regular medication
of asthma exacerbations by inducing inflammation or provoking acute broncho-constriction or both. Triggers vary from person to person and from time to time. They include: (1) further exposure to causal factors allergens and occupational agents that have already sensitized the airways of the person with asthma, and (2) exposure to irritant gases, weather changes, cold air, exercise, respiratory infections, certain foods, additives, drugs. Taking a careful history is necessary in attempting to identify each individuals trigger. Some control measures include avoidance of exposure to these triggers. In particular are the house dust mites which are the most common cause of asthma worldwide. encase mattresses in allergen-nonpermeable cover such as plastic either encase pillows or wash them weekly soak beddings, such as bed sheets, pillow cases,
42
patient and his/her family with suitable information and training so that the patient can maintain good health and adjust treatment according to a medication plan developed with the clinician. The patient should be made to understand that he/she shares the responsibility of managing his/her condition with his physician and is eventually responsible for leading a normal, active life. Patient education can be achieved in two ways: (1) through individualized education by the physician or the counselor; and (2) through group education. Further details on patient education can be found in Appendix E. y Chronic Obstructive Pulmonary Disease COPD is a preventable and treatable disease that is characterized by airflow limitation that
(1) Assess and monitor disease - Get detailed medical history: Exposure to risk factors including intensity and duration Past medical history, including asthma, allergy, sinusitis, or nasal polyps, respiratory infections in childhood, and other respiratory diseases Family history of COPD or other chronic respiratory disease Pattern of symptom development History of exacerbations or previous hospitalizations for respiratory disorder Presence of comorbidities, such as heart disease, malignancies, osteoporosis, and musculoskeletal disorders, which may also contribute to restriction of activity. Appropriateness of current medical treatments Impact of disease on patients life, including limitation of activity, missed work and economic impact, effect on family routines, and feelings of
7.2.5 Rehabilitation
Chronic diseases are major causes of disability,
43
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
including blindness, lower limb amputation, motor and sensory dysfunction following stroke, chronic pain, and impaired functioning following heart attack. Rehabilitation is intended to enable people to continue to live full lives as part of society. In some conditions, notably after heart attack, rehabilitation reduces mortality. Rehabilitation services are ideally provided by a team of specialized personnel, including medical doctors, dentists, prosthetists, physiotherapists, occupational therapists, social workers, psychologists, speech therapists, audiologists, and mobility instructors. In many communities, this may not be feasible owing to shortage of health workers and other resource constraints. In these situations, community-based rehabilitation is a viable alternative, using and building on the communitys resources as well as those offered at district, provincial, and central levels. Community-based rehabilitation is implemented through the combined efforts of people with disabilities, their families, organizations and communities, as well as the relevant governmental and nongovernmental health, education, vocation, social and other services. The focus has expanded to health care, education, livelihood opportunities, and participation/inclusion.
advanced cancer, the therapeutic imperatives lean heavily in favor of symptomatic patients. Something must be done, and as a rule, something can be done. Pain must be relieved, and anxiety must be reduced. Definitive therapy in symptomatic patients is not primarily concerned with the objective measures of response such as decrease in size or number of lesions, but rather in the association of measurable response with actual relief of symptoms. When resources are a problem, which is usually the case, prioritization must tilt in favor of the adequate care of symptomatic patients. y The treatment of asymptomatic patients with advanced cancer is approached from an altogether different perspective, and the therapeutic imperatives are neither urgent nor as clear. In these cases, the purpose of treatment is to contain and reduce the existing lesions, thus delaying the emergence of symptoms and the disability which will inevitably come, if the patient is left untreated. 7.2.6.2 Guidelines for Pain Relief y Cancer pain can and must be treated. y A thorough history must first be obtained and the patient examined carefully. Acute conditions that require specific treatment should be excluded. y While the nature and the cause of the pain are being assessed, therapy should be started with an appropriate analgesic drug. Drugs usually give good relief, provided that the right drug is administered in the right dose at the right intervals. An appropriate drug should be selected and treatment should be started at once; y It is advisable to follow the 2-step analgesic ladder: (1) non-opioid analgesics; and (2) strong opioid analgesics. See Appendix E for list of drugs for cancer pain relief. y Anti-neoplastic treatment analgesic and adjuvant drug therapy should be considered the primary treatment for cancer pain. It is necessary to be familiar with one or two
Box 3. Cardiovascular Program by the District Health Board in Cavite Province MagNaMarTe ILHZ: Kapuso Kasi Kapamilya!
Ma. Vilma V. Diez, MD, MHA, PHSAE Provincial Health Officer II InytheyMunicipalitiesyofyMagallanes,yNaic,yMaragondonyandyTernateycollectivelyycalledyMagNaMarTeyInter-LocalyHealthyZoney(ILHZ)yofyCavitey Province,ycardioyvascularydiseaseyranksyfirsty(1st)yamongytheyleadingycausesyofydeathyandythirdy(3rd)yamongytheyleadingycauseyofyillness. Asyanyinter-localyhealthyzone,ytheyMagNaMarTeyenjoinedyhandsytoyreduceytheymorbidity,ydisabilityyandymortalityyfromyCVDyinytheiryzone.y Specifically,ytheyILHZyaimedytoymakeyavailableyaycomprehensiveypreventionyandycontrolyinterventionyprogramyonyCVDytoytheirycatchmenty populationybyyimplementingy5-prongedystrategicymeasures:y 1.y PromotiveyMeasuresywhichyentailedythey(a)ytheypromotionyofyHealthyyLifestyle,y(b)yAdvocacy;yandy(c)ySocialyMobilizationyofytheyvariousy stakeholders.y 2.y PreventiveyMeasuresywhichyplacedyfocusyony(a)yconductyofyHLyactivitiesyandyregularyexerciseyprograms;y(b)yBPyscreening;y(c)ylaboratoryy screening;y(d)yelectrocardiogramyexamination;yandy(e)yre/trainingyofyBHWsyandyhealthystaff. 3.y CurativeyServicesywhichyrequiredythey(a)yestablishmentyofyCVDyandyDiabetesyclinics;y(b)ymakingyavailableymedicinesyandysupplies;y(c)y renovationyandyexpansionyofylaboratoryyservices;yandy(d)yinstallationyofytheyreferralysystem.y 4.y ComprehensiveyPhysicalyTherapyy(PT)yServicesythroughythey(a)yestablishmentyofyPTyclinic;y(b)yre/trainingyofyBHWs,ymidwivesyandyRHUy staffyonyCommunityyBasedyRehabilitationyProgramy(CBRP);yandy(c)yimplementationyofytheyCBRP. 5.y ResourceyGenerationydrawnyfromy(a)yformingymulti-sectionalylinkages;y(b)yfundyraising;y(c)yLGUycontributions;yandy(d)ychargingyofy usersyfees. Theseyeffortsyhaveypavedytheywayyforytheyfollowingypositiveyresults:y yy CVDycasesyandydeathsydecreasedybyy57%yandy15%yrespectivelyyfromy2000y-2002,y(beforeyprogramyimplementation)ytoyitsyfully implementationyiny2003-2005. yy KnowledgeyonypreventionyofyCVDywasyputyintoypracticeyprimarilyythroughycommunityyinitiatedyandymanagedyregularyexerciseyprogramsy andyHLyactivitiesywithyCVDyclubsyandyDiabetesyclubs.yyy yy TheypopulaceyofyMagNaMarTeygainedyaccessyandyavailedyofyPTyservicesywhichyatytheysameytimeygeneratedyincreaseyinyincomeythaty resultedytoysustainabilityyandyselfyreliabilityyofytheyprogram.y ThisylocalizedyNCDypreventionyandycontrolyprogramyhasyprovenythatytheyILHZywithycommunity-managedyactivitiesyisyanyeffectiveystrategyy inytheyimprovementyofytheydeliveryyofypriorityyhealthyservices.yTheyMagNaMarTeyInter-LocalyHealthyZoneyattributeytheirysuccessytoythey followingyfactors: yy theyunwaveringycommitmentyandyresoluteyspirityofylocalyhealthyworkersyparticularlyytheyPHOyandyMHOs yy theysupportiveylocalychiefyexecutivesyofyeachyparticipatingymunicipality yy theyveryyactiveydistrictyhealthyboardy yy theyprovisionyofytechnicalyassistanceybyytheyDOH,yCHDyIV-A yy committedyandyactiveyNGOsyandypeoplesygroups;yandy yy activeyandysustainedyparticipationyofytheycommunity
45
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
alternatives for use in patients who cannot tolerate the standard preparation. y If the recommended dosage and frequency is not effective in relieving the pain, a drug in the strong opioid group should be given. Adjuvant drugs should be added to the opioid and nonopioid drugs, if required for specific indications. Only one drug from each of the groups should be used at the same time. If a drug ceases to be effective, do not switch to an alternative drug or similar strength but prescribe a drug that is definitely stronger. y Analgesics should be given on a regular basis. The dose of an analgesic should be titrated against the patients pain being gradually increased until the patient is comfortable. The next dose is given before the effect of the previous one has fully worn off. In this way, it is possible to relieve the pain continually. For persistent pain, the drugs should be taken
regularly by the clock and not as required. y For mild to moderate pain, the patient should be prescribed a non-opioid drug and the dose adjusted to the optimum level. If necessary, an adjuvant drug should be used. If and when these no longer relieve the pain, the patient should be prescribed a strong opioid, together with a non-opioid adjuvant drug if appropriate. y The patient must be supervised as often as possible to ensure that treatment continues to match the pain and to minimize side effects. y The following is a list of alternative treatment for patients with difficult or specialized pain problems unresponsive to conventional anti-neoplastic or drug treatment. These patients should be treated in consultation with physician specialized in pain treatment: (1) anesthetic techniques; (2) neurosurgical techniques; and (3) behavioral techniques.
8.1.2.1 Identifying Learning Needs Identify what the health worker is expected to do and areas of work that need improvement. This information can be obtained by conducting focus group discussion or interview. Learning needs can be met by revising an existing training program or appropriate training content can be developed. Some questions that may guide in identifying learning needs are: y Who are the targets? Who will benefit the most? y What behavioral components are amenable to change? y Learning needs of the targeted groups of knowledge, beliefs, attitudes, skills? y Resources/services available to them? y Barriers to behavior change? 8.1.2.2 Identifying Goals and Objectives For an objective to be effective it should identify as precisely as possible what the individuals will do to demonstrate what they have learned, or that
47
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
the objective has been reached. They should also describe the important conditions under which the individual will demonstrate competence and define what constitutes acceptable performance. 8.1.2.3 Developing Learning Activities Learning activities enable learners to demonstrate that they have acquired the desired skills and knowledge. To ensure that employees transfer the skills or knowledge from the learning activity to the work, the learning situation should simulate the actual work as closely as possible. The determination of methods and materials for the learning activity can be as varied. Practicum can be used as a method for testing demonstration of skills. 8.1.2.4 Conducting the Training An effective training program allows learners to participate in the training process and to practice their skills or knowledge. They should be involved in the training process by participating in discussions, asking questions, contributing their knowledge and expertise, learning through hands-on experiences, and through role-playing exercises. 8.1.2.5 Evaluating the Training Evaluation will help determine the amount of learning achieved and whether a health workers performance has improved. The ultimate success of a training program may be changes throughout the workplace that result in proper implementation of the program. Evaluation can also help decide whether the training session should be offered again at some future date or whether it is necessary to revise the training program or provide periodic retraining.
an essential component in the provision of quality healthy lifestyle interventions by improving the performance of service providers in the various aspects of HL promotion, particularly in (1) assessing clients for high-risk factors to NCDs, (2) determining appropriate interventions in response to their identified needs; (3) helping clients modify their lifestyle; and (4) referring those that need further treatment and follow-up care. The following guide on supervision is limited only to settings or health facilities where there is an administrative link between the supervisor and the supervisee. In the public health network, this may apply to the RHU nurse supervising the work of the midwives in the main health center or at the BHS level. This may also apply to city health district supervisors handling the Healthy Life Style program over health center staff administratively under them. In other clinic settings, e.g. school clinics, the supervising doctors/nurses at the district level may apply the same to the school clinic staff.
those trained staff to follow the application of what they learned in the training and to further hone their knowledge, attitude and skills which cannot be developed during the training period. Supervision is a one-on-one interaction between the supervisor and the staff administratively under her/him. Supervision is not done by group as this requires focused attention to a particular staff allowing freer interaction between him/her and the supervisor and ensure privacy and confidentiality. Supervision must be planned in advance and purposive. The supervisor must know specifically who among the staff that need closer supervision and what particular aspect the staff would require help or assistance; All supervisory interactions need to be documented as basis for monitoring progress on the part of the staff and to guide the supervisor further actions to take; Results or findings of the supervision must be kept confidential between the staff and the supervisor.
y The supervisor will select the most appropriate method to adopt in her supervisory session with the staff. Supervision may be done in different forms. A supervision interaction though may include the following: actual observation how the staff delivers the service to a client; review of records and documents; an open discussion of issues and concerns affecting the staff performance of her tasks mentoring or coaching of how service can be improved; joint planning of key actions to be undertaken recording of findings and agreements y The supervision activity must be able to focus if the service provider appropriately carried out the following: applying risk assessment to all clients making consults in the facility regardless of the initial complaint or presentation; results of risk assessment are appropriately recorded and diagnosed intervention/s provided are appropriate for the identified risks or disease clients requiring further diagnosis or treatment are properly referred education and/or counseling provided to clients are consistent with standard messages services are provided in a customer-friendly manner clients are reminded when to come back for follow-up check-up or intervention y The supervisor may use the Observation Checklist in conducting the supervision. See Appendix F. y The Supervisor checks the completeness and accuracy of the clients records and other related documents; y The Supervisor discusses the results of the observations and records validation with the supervisee and helps identify areas where improvements are needed; y If possible, the Supervisor may already provide immediate intervention to the supervisee
49
8.2 Supervision
Supervision is the process of directing and supporting staff in order that they may effectively perform their mandated functions and tasks. It is
48
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
(coaching or mentoring); y The supervisor plans with the staff key actions to be carried out; and the specifies the type of assistance needed by the supervisee. y The Supervisor records own the findings and recommendations on the Supervisory Logbook. Date Findings Actions Taken Recommendations (Further Actions Needed)
what information they need. Monitoring and Evaluation must serve the information needs of the intended users. 2. Feasibility. In designing the Monitoring and Environment and surveillance, there must be a clear estimate of how much money, time, and effort are to be put into it. The system or scheme must be realistic, prudent, diplomatic, and frugal. 3. Propriety. Measures must be undertaken to ensure that the evaluation is ethical or follows the basic principles of human rights like confidentiality, privacy, etc. The Monitoring and Environment must be within legal and ethical grounds and has regard for the welfare of those involved and those affected. 4. Accuracy. The Monitoring and Evaluation system must be designed to generate accurate, timely and complete information which must be shared, revealed and conveyed appropriately to those concerned.
includes specifying the information on how the M and E program is intended to function and the way it will actually be implemented. It must also describe the contexts that are likely to influence conclusions regarding the program. This helps improve the fairness and accuracy of the M and E system, permits a balanced assessment of strengths and weaknesses and helps stakeholders understand how program features fit together and relate to a larger context. Step 3- Focus the monitoring and evaluation design This step entails planning in advance where the M and E is headed, what direction it will go and the steps to be undertaken to reach this direction. This helps keep the project on track. Step 4 - Gather credible evidence This step requires the need for set of indicators, identifying the sources of these indicators, both quantitative and qualitative in scope. Logistics support to collect, process and consolidate these information must also be taken into consideration. This step is vital in enhancing the utility and accuracy of the M and E, guides the scope and selection of information and gives priority to the most defensible information sources. Step 5 - Justify conclusions Justifying conclusions requires a set of standards, an analysis and synthesis of data collected, correct interpretation and judgment as well as making the right recommendations. Conclusions are justified when they are linked to the evidence gathered and consistent with agreed on values or standards of stakeholders. This step is essential as it reinforces the conclusions central to the M and Es utility and accuracy. It clarifies values, involves analysis and synthesis of qualitative and quantitative data, allows a systematic interpretation, and provides appropriate comparison against relevant standards for judgment.
Step 6 - Ensure use and share lessons learned Feedback, follow-up and dissemination of the results of the M and E ensure that: (1) stakeholders are aware of the evaluation procedures and findings; (2) the findings are considered in decisions or actions that affect the program (findings use); and (3) those who participated in the evaluation have had a beneficial experience (process use). This helps ensure that the M and E achieves its primary purpose of being of use.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
y Evaluate how policy and environmental strategies are implemented y Evaluate the extent to which their program is being implemented as intended y Determine whether their program is appropriately focusing its NCD efforts, especially toward priority populations. 1. Evaluating Capacity Building Programs Purpose: To determine whether local health agencies have increased their capacity to perform tasks needed to address NCDs in a comprehensive manner and to reach the longterm goals of the NCD Prevention and Control Program. Evaluation Question(s): What progress has been made in addressing the capacity building? Expectations for Capacity Building and LGUs Basic Implementation: Demonstrate an increasing ability over time to perform the eight core capacity building activities, as measured by the Monitoring and Evaluation for Equity and Effectiveness (ME3). Data Collection: DOH has developed a suggested LGUs ME3 scorecard that local governments can use to track their capacity building. The reporting form includes information on the core capacity building activities discussed in the program description. 2. Evaluating Disease Burden through Surveillance Purpose: a. To collect (i) epidemiologic data from the Behavioral Risk Factor Surveillance
52
System- Adult (national sources: National Nutrition and Health Survey, BRFSS) and Youth (Global School-based Student Health Survey or Youth Behavioral Risk Factor Survey), (ii) mortality and morbidity reports (civil registry and FSHIS), hospital discharge data, and other statebased data sources so changes in a populations NCD burden and related risk factors and conditions can be tracked; b. To aggregate years of NNHeS and or BRFSS core data for priority populations to determine whether NCD rates have changed or if NCD disparities have been reduced at least at the provincial level; c. To collect data on existing policies and environmental changes across regions using established indicators; and d. To monitor use of secondary prevention strategies (through Peer Reviewed Organizations data and other appropriate data sources). Evaluation Questions: a. What changes are occurring in the local populations NCD burden and risk factors over time? b. What changes are occurring specifically in priority populations over time? c. What policy and environmental changes have taken place over time? d. What changes are occurring on the use of secondary prevention strategies over time? Expectations for Capacity Building a. Demonstrate scientific capacity to define NCD burden (at least core risky behaviors, incidence and prevalence of, and top leading mortality) in their locality. b. Demonstrate the ability to track the following trends in NCDs in the general population and priority populations over time: NCD mortality, morbidity, disability, and risk factors; patients age at onset of NCDs, and the disparity in these factors
between general and priority populations. Regions and provinces should collect NCDrelated data using the protocols and time line (STEPS, BRFSS, NNHeS). Regions and provinces are recommended to collect data using the STEPS and or BRFSS modules on hypertension awareness, cholesterol awareness, and cardiovascular disease. Likewise, LGUs provided external funding especially the provinces are recommended to collect data using the BRFSS Module on heart attack and stroke signs and symptoms at least every five years or, if possible, every three years. c. Publish a document describing the regional, provincial NCD burden every 5 years and collect burden data at least every 3 years or as needed for program planning.
High blood pressure High blood cholesterol Tobacco use Poor nutrition Physical inactivity NCD-related conditions: Obesity Diabetes, etc. y Knowledge of signs and symptoms y Secondary Prevention 3. Evaluating Program Intervention
Purpose To monitor the implementation and outcomes of the program interventions. Evaluation Questions
Did NCD program interventions influence
Basic Implementation (province level) should meet the three expectations plus the following:
a. Demonstrate that they have collected and analyzed indicators of NCDrelated policies and environmental supports for NCD. b. Demonstrate that they can collect data on secondary prevention strategies at least every three years or as needed for program planning. Data Collection The following are the main variables to consider when measuring a populations NCD burden: Age Gender Socioeconomic status (SES) Deaths due to heart disease and stroke, other NCD y NCD prevalence and average age of NCD patients at disease onset y NCD disability rates y Prevalence of NCD risk factors: y y y y
policy or environmental supports? Did educational interventions increase public awareness of NCD (e.g., its signs and symptoms)? Were interventions implemented as expected? Were program evaluation results used for program improvement and to identify models that work? Were interventions conducted in priority populations using culturally appropriate strategies?
Expectations for LGUs Capacity Building: Capacity Building are not expected to implement major populationbased interventions. If Capacity Building chooses to conduct pilot interventions or receive supplemental funds for interventions, the interventions should be evaluated. Expectations for LGUs Basic Implementation a. Develop and implement populationbased intervention strategies for general and priority populations. b. Show that interventions result in policy
53
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
and environmental changes. Educational interventions should increase public awareness of NCD issues, increase support for policy and environmental changes to improve peoples health, and increase public knowledge about the signs and symptoms of NCDs. Over time, LGUs should address policy and environmental changes at the local level, in all four settings, in the general population, and in all priority populations. In addition, they should document anticipated and unanticipated outcomes, lessons learned, and models that work and use these findings for program improvement. Data Collection: Basic Implementation should provide process and outcome data and other information regarding
was met Demographic characteristics of the population served by the intervention Settings for the intervention (community, school, worksite, health facility) The geographic region in which the intervention was conducted Materials developed The target disease (e.g., heart disease, stoke) Risk factors addressed (e.g., hypertension, high cholesterol, tobacco use, obesity, nutrition) National Objectives for Health 2010 addressed
Policy changes achieved Environmental changes achieved Outcome measures to be used Lessons learned The interventions impact on participants and setting The theoretical model used for the intervention
Table 7. Summary of NCD Program Components and Related Activities Program Component LGUs Capacity Building Activities
yy yy yy yy yy yy yy DevelopytheyscientificycapacityytoydefineytheyNCDyburdenyandytoyevaluateyprograms.y Developyanyinventoryyofypoliciesyandyenvironmentalysupports.y DevelopyoryupdateyaylocalyNCDyoryHealthyyLifestylesyplan.y Provideytrainingyandytechnicalyassistance.y Developypopulationbasedystrategies.y Developyculturallyycompetentystrategiesyforypriorityypopulations.y DevelopyanyNCDyinfrastructureywithinytheylocalygovernmentyhealthyunits
Surveillance
yy STEPSy(Core)yand/oryBehavioralyRiskyFactorySurveillanceySurvey y Hypertensiony y Cholesteroly y HeartyAttackyandyStrokeySignsyandySymptomsy y Tobaccoy y Nutritiony y PhysicalyActivityy y Obesityy y Diabetesy yy Peeryreviewyorganizationydatay yy Policyyandyenvironmentalyindicatorsy yy Mortalityydatay yy Hospitalydischargeydata yy Regionallevelyandylocallevelyinterventionsy yy Settinglevelyinterventionsy yy Interventionsyinydifferentycontextsyincludingypriorityypopulationyinterventions,yandyculturallyyappropriatey interventions
Program Intervention
y Hospital Discharge Data. Hospital discharge data are the abstracted records associated with a patients stay in a short-term hospital. These data typically contain diagnosis, treatment, and payment information. Region or provincialbased hospital discharge data are collected, maintained, and analyzed by individual provinces and regions. Hospital discharge data for Medicare beneficiaries are handled by the Philippine Health Insurance Corporation. y Death Certificates. Philippine laws require death certificates to be completed for all deaths, and mandates national collection and publication of deaths and other vital statistics data. The Philippine Health Statistics is the result of the cooperation between National Statistics Office and the DOH to provide access to statistical information from death certificates. Mortality data are used to monitor the underlying and contributing causes of death for persons dying and to determine life expectancy. y Tobacco Data Sources. The Global Tobacco Surveillance System of the WHO and CDC, is an electronic data warehouse containing up-to-date and historic national-level data on tobacco use prevention and control. The GTS System is designed to integrate multiple data sources, provide comprehensive summary data, and facilitate research with consistent interpretation of data. National and regional revenue agencies are an alternative source of information on national and local tobacco sales. y Renal Disease Data Sources. The National Kidney and Transplant institutes Renal Disease Registry is a national data system that collects, analyzes, and distributes information about end-stage renal disease (ESRD) y Youth Risk Behavior Surveillance System (or Global School-based Student Health Survey). Monitors priority health risk behaviors that contribute markedly to the leading causes of death, disability, and social problems among youth and adults in the country. These behaviors, often established during childhood and early adolescence, include
55
54
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
tobacco use, unhealthy dietary behaviors, inadequate physical activity, alcohol and other drug use, risky sexual behaviors, and behaviors that contribute to unintentional injuries and
violence. Conducted as a school-based survey every 3 years, includes national, regional representative samples of students in high school years.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
1. Create a separate budget line item for NCD prevention and control in the LGUs annual health budget y Existing budget structure in most LGUs does not provide for a separate line item for NCD prevention and control nor any specific public health programs. In most cases, budget for health services are lumped under the Maintenance Operating Expenses (MOE), mainly as drugs/ medicines or supplies, traveling expenses, utility services, etc.. This applies to the provincial, city and municipal budget structure. The absence of a specific line item for NCD prevention and control in the local health budget limits the implementation of appropriate interventions. The following provides some guide in establishing a separate budget line item for NCD prevention and control in the annual health budget of the LGUs. y Budget line item for NCD prevention and control must first be supported with an annual plan which specifies the different activities that the LGU intent to implement for the next year. This must be part of the planning done by the local health office on an annual basis; y Include health promotion activities and specify basic NCD services such as the procurement of equipment for risk assessment, for essential drugs such as diuretics and anti-hypertensives or for reproduction of IEC materials, etc.; y Based on this Work Plan, budgetary requirements are estimated and incorporated in the annual budget submitted by the local health office; y It is advisable that the line item be part of the regular LGU budget over that from 20% development fund or supplemental budget, since the last two options require special ordinance on an annual basis. Priorities on the use of the 20% Development Fund or Supplemental Budget may change from year to year or from one administration to another; y Advocacy must be undertaken among the local chief executives and members of the Sangguniang body, particularly the Chair of
58
the Sangguniang for Health on the importance of the NCD prevention and control plan and budget request; If this cannot be accommodated within the regular budget of the local health office, budget requirements for NCD prevention and control must be advocated annually to the 20% development fund or supplemental budget. An ordinance supporting this allocation must be worked out annually by the local health office. The establishment of a budget line item for NCD prevention and control is not limited to the municipal or city levels. The assistance of the provincial government as well as the barangay councils can be tapped. Health staff should lobby for a share of the barangay development funds during the annual budget preparation in the barangays. In addition, other local government departments outside the health office may also be encouraged to include in their Work Plan and Budget, funding for activities that promote and support healthy lifestyle such Sports Fest/Leagues, celebration of Healthy Lifestyle Week or other month themes (Cancer Control Week, Nutrition Month, etc.). Public schools may be able to use the Economic Support Fund (ESF) (1/2 of the real property taxes collected annually) for healthy lifestyle activities for teachers and students. It is best that the Work and Financial Plan for NCD prevention and control is prepared and endorsed by the multisectoral coalition created for HL promotion.
2. Mobilizing Resources from the Private Sector The private sector remains a viable source of resources for the prevention and control of chronic diseases. These resources may come in the form of actual funds, their participation in service delivery or provision of technical expertise. Their contributions could be significant if they are properly oriented and enlightened of their roles.
y The private sector may include nongovernment organizations, the church, professional societies, socio-civic groups, private companies or corporations, the pharmaceutical industry or support groups or associations; y Be prepared with the presentation of the NCD situation in your locality. Orientation may be done as a whole group or can be carried out by individual organizations; y It is advisable to project in advance the areas or form of assistance that the following private sector groups can contribute: a. Private Companies/Corporations Business establishments may be sought for sponsorship, e.g. sports meet, marathons, Private companies are mandated by the Department of Labor and Employment to have a health program for their employees, i.e. occupational and health program. The local health executive may advocate for a health promotion program, i.e. Healthy Lifestyle in the Workplace Program and subsidies for medical check-up, etc. b. Private Practitioners. May accept clients with special needs which the public health facilities cannot handle c. Private Schools. Can finance healthy lifestyle promotion activities for the students and the faculty. Parents-Teachers Associations in schools can be encouraged to sponsor HL promotion activities for their children and their association. d. Church Organizations/Socio-Civic Groups. May be tapped to sponsor healthy lifestyle promotion activities (e.g. Sports fest/ leagues, provision of drugs/medicines or necessary equipment) e. Pharmaceuticals: Establish partnership for the right kind of drugs/medicines to be made available and work out discounts in prices for clients already with chronic diseases (e.g. members of the Diabetic Club/Association) y In order to sustain the participation and contributions of these private organizations, they can be encouraged to become members
of the coalition. If not, they must be given progress reports on the utilization and results of their assistance 3. Establish Local Health Financing Schemes Each LGU can come up with their own local financing schemes to support the NCD prevention and control activities in their locality. These may come in the form of user fees, the pooling of contributions from private individuals with common NCD concern or among organized members of the community. y User Fees. These refer to the fees or payments collected from the individual clients availing services from health facilities or service providers. In the private sector, these are usual payments made by the individual clients out of pocket. Several LGUs have began to establish user fee collections for certain services offered in the public health facilities from clients who are able to pay. The following are the steps in setting up user fees for certain NCD prevention and control services: a. Identify specific NCD prevention and control services which can be charged to the paying public. In many LGUs, user fees are usually applied for clinical and x-ray laboratory and dental services. Because of the recurring cost of medications, only starter doses, when available, are provided without cost. But due to limited funds of the LGUs, the subsequent doses are paid for by the clients; b. This cost-recovery scheme must be supported with an ordinance or as part of the local taxation code of the LGU; c. Ensure that the imposition of user fees will only be applied to clients with the capacity to pay. In this regard, the LGU must be able to come up with a system to segment their clients who are really poor and needy from those who have means to pay; d. Massive orientation must be undertaken among concerned segment of the population, particularly clients who are
59
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
expected to pay for these services. The same must be done among the poor to prevent misunderstanding of their right to avail of said services for free; e. Support of the barangay and municipal/city officials and community leaders must be harnessed; f. All charges or collections must be properly receipted; g. In designing the scheme, it must be made clear under which specific account the user fees will be deposited as well as the conditions when and how these can be used. y Pooling of Resources Among Patients with Similar Situation and Interests. Patients with suffering from similar chronic diseases may be organized and as a group, can pool their funds in order to buy medicines or other health services by bulk, thus lowering the cost. An example is a Diabetic Association where members can bargain a bigger discount of drugs and medicines. Pooling of resources may also apply to members of an organization or community to finance the conduct of their common interests related to HL promotion. Example of this will be pooling of funds to pay for trainer during a physical activity sessions, i.e. dance exercise, aerobics, taebo, etc. or inviting resource persons to give them seminar or orientation on special topics of interest. 4. Philippine Health Insurance As mentioned earlier, the Philippine Health Insurance Corporation (PhilHealth) is considered as the primary financing mechanism for health care in the country. However, reimbursement of NCD-related expenditure from PhilHealth is still very limited. Those mentioned in the DESIRED Financing Milestone may be too early for the Philippine government to mount up. At present, the following are the existing benefit packages which the enrolled PhilHealth member can avail of for NCD-related services:
60
a. In-Patient Package. Any client enrolled in PhilHealth requiring in-patient management and treatment for any NCD-related problems is entitled to reimbursement from PhilHealth. Amounts to be reimbursed differ according to the type of interventions provided, length of stay in the health facility, etc. These are governed by PhilHealth guidelines and provisions. b. Out-Patient Benefit Package. This entitles indigent family members avail of outpatient services from PhilHealth-accredited health facilities. Among the preventive services covered are for the promotion of healthy lifestyle practices as well as screening services of various risk factors. PhilHealth Circular #13, s. 2002 specify the following preventive services under its Out-Patient Benefit (OPB) Package: Preventive Services with minimal or no cost implications such as health screening activities, health education and counseling including: (1) (2) (3) (4) (5) (6) (7) Visual Acetic Acid Screening for cervical cancer Regular blood pressure measurements Annual digital rectal exam Body measurements Periodic clinical breast examination Counseling for cessation of smoking Lifestyle modification counseling
benefit package and an ordinance on the PhilHealth capitation fund. This capitation fund may be mobilized to support HL promotion activities in the locality. Fourfifths (80%) of the capitation fund received by the LGUs may be used for operating expenses. At present, DOH in collaboration with PhilHealth is working on the benefit package for hypertension and diabetes mellitus. Much can be done to further strengthen sustained financing through PhilHealth: (1) advocate among local officials to expand the coverage and sustain the enrollment of indigents to PhilHealth;
(2) campaign even among non-indigent families to enroll in PhilHealth; (3) inform PhilHealth enrolled clients of the benefit packages they can avail of; (4) establish network with other PhilHealth accredited health facilities where clients can be referred for other advanced management and treatment; 5. Fund Generation Schemes The following are certain schemes where additional funds for NCD prevention and control can be generated. The Tobacco law provides for the allocation of 20 percent of the annually collected sin taxes from the tobacco industry to be filtered back to support health promotion. This has not been in effect yet since the passage of
Box 4. Financing of NCD Prevention and Control Services in the Municipality of Pateros
Dr. Francisca Cuevas, Municipal Health Officer TheyMunicipalityyofyPaterosyhasyestablishedyseveralyfinancingymechanismsytoysupportyandysustainytheydeliveryyofyhealthycareyandyservicesytoy itsyclients,yincludingycareyandyservicesyforyNCDypreventionyandycontrol. 1.y BeginningytheyfullyadoptionyofytheyIntegratedyCommunity-basedyNCDyPreventionyandyControlyProgramyiny2004,ytheyMunicipalityyofy PaterosyhasyincludedyinyitsyannualyhealthybudgetyprovisionsyforyhealthypromotionyactivitiesyandyNCDyneeds.yOfytheytotalymunicipaly healthybudgetyiny2007,yPaterosyhasyallottedyPhpy14,500yforyhealthypromotionyinyitsyregularybudget.ySinceyitsyinceptionyiny2004,ythisy budgetyforyNCDyhasyremainedyintact. 2.y Iny2004,yPaterosyadoptedythroughyaymunicipalyordinance,yayfee-for-serviceyprogramyforycostyrecovery.yThisyschemeyinvolvesythey paymentyofyminimalyfeesyforyallyservices.yCommunityypreparationywasyvitalyinytheysuccessyofythisyresourceygenerationyscheme.yThey communityywasyinformedyofytheyneedytoysetyupytheysystemyandyconsultedyinydeterminingytheyfees.yItywasyclearlyyconveyedytoythemythaty noyserviceywillybeywithheldyfromyanyoneywhoycannotyaffordytoypay.ySo,ytheyschemeyhasynoyopt-outymechanismyoryclientysegmentationy andyallyservicesyareyprovidedyregardlessyofytheyclientsycapacityytoypay.yTowardsytheyendyofyserviceyprovision,yaysummaryyofychargesy similarytoyaybillingystatementyisygivenytoytheyclient,yandyhe/sheymayypayywhateveryamountyhe/sheyisyable.yOutreachyservicesywerey intensifiedytoyfollow-upyclientsywhoymayyhaveybeenyrepelledybyytheycharges.yLaterytheyfeesywereyincorporatedyinytheyLocalyTaxyCode.y 3.y TheypatientsyofytheydiabetesyclinicyofyPaterosyorganizedythemselvesyandyformedytheyDiabetesyLayyAssociationyofyPateros.yBecauseyofy theirybigynumber,ytheirybargainingypowerywasylikewiseybig,ysuchythatyfromytheyfundsytheyypooled,ytheyywereyableytoypurchaseydrugsy fromypharmaceuticalycompaniesyatyaylowycost.yAtytheysameytime,ytheseycompaniesyregularlyysponsoryclinicydaysyandyprovideyclientsywithy drugysamplesyandyfreeyFBSydeterminationyandyotheryservicesysuchyasyboneyscan,yECG,yhealthyeducationyclasses,ylipidyprofile,yetc. 4.y TheymemberyagenciesyofytheyHealthyyPaterosyTaskyForceyhaveybeenyactivelyyinvolvedyinytheypromotionyofyhealthyylifestyleyandyhavey earmarkedyfundsyforythis.yTheyysponsorycommunity-basedyactivitiesysuchyasysportsyandyexerciseyclinics,yannualyriskyscreeningy(includingy clinicalybreastyandycervicalycanceryscreening)yandymedicalycheckyupyandyhaveyfinancedyreproductionyofyhealthypromotionymaterialsysuchy asyflyersyandyposters. 5.y PaterosypartneredywithyPhilHealthytoymodifyyitsyOutpatientyBenefityPackageyinyorderytoywidenytheyservicesycovered.yThisyhasyledytoythey inclusionyofyFP,yimmunization,yoralyprophylaxis,ymaternalycareyandyPhpy800yworthyofydrugsyandymedicines.yTheyPhilHealth-enrolledy clientsycontinueytoyavailysaidyservices. AsyofyDecembery2006,yPaterosyhasyearnedyaytotalyamountyofyPhpy441,279.58yunderyitsycapitationyfundyandycollectedyaytotalyofyPhpy6.2yMy fromyuseryfeesyoveryayperiodyofy5yyears.yTheyMunicipalyHealthyOffice,ythroughyanyordinanceyisytheyonlyyauthorizedybodyytoymakeyuseyofythesey funds.yy
The OPB operates on the partnership between the LGU and the national government. Under the Indigency Sponsored Program, the premium amount of Php 1,200 per family per year is shared by PhilHealth and the LGU. In some LGUs, member families also share with the cost of premium payment. A capitation fund of 300 pesos per beneficiary for outpatient benefit is provided to the LGU provided that it meets the following requirements: at least 200 families enrolled, health facility is accredited by PhilHealth for outpatient
61
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
the Law in 2003. At the local level, the following mechanisms may also be established: a. Some LGUs have legislations to regulate the sale of tobacco and alcohol. One ordinance is the payment of additional fees by store owners for license to sell tobacco, tobacco products and alcoholic beverages. These fees are paid annually during the renewal/ issuance of the LCEs permit. These fees may be channeled to health promotion programs, through a clear provision in the local ordinance. b. Likewise, penalties from violations of
ordinances on tobacco and alcohol sale/ use may also be used to finance NCD services. In the City of Makati, for example, owners of food establishments (restaurants) that choose to put up a smoking section pay an annual fee of 10,000 pesos. These fees are used by the Makati Health Department to support their HL promotion program and other health-related activities. Box 4 describes the different financing schemes the Municipality of Pateros has introduced in support for NCD prevention and control in their locality.
62
63
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
various age groups and addressing age-related needs should be made available. Healthy habits start early, and should be encouraged during childhood and adolescence. Maternal conditions (e.g low birth weight) and social conditions (e.g. adverse childhood experiences) have been associated with the development of NCDs in later life; programs and services that address these risks should be strengthened. 6. It encourages evidence-based program management. Research should be encouraged to provide the knowledge base for the development of appropriate policies and actions on NCDs. Surveillance, monitoring, and evaluation should be institutionalized, as data from these activities contribute to sound policy formulation, planning of actions, designing interventions and making appropriate decisions concerning NCD-related issues and concerns. Capability of stakeholders to collect, analyze, disseminate, and utilize evidences must be enhanced. 7. It encourages partnerships and advocates for whole-of-government and whole-ofsociety approaches. Many of the critical interventions to prevent and control noncommunicable diseases lie outside of the direct sphere of influence of the health sector. Thus, in addition to collaborative undertakings within the health sector, multisectoral partnerships are essential. Working in partnership ensures synergies, avoids overlapping and duplication of activities, and prevents unnecessary competition. 8. It ensures sustainability. NCD programs should work for sustained funding and institutionalized roles of stakeholders within and outside the health sector. Commitment of stakeholders to the national plan of action on NCDs should be strengthened. Monitoring and evaluation mechanisms should be put in place to ensure effective implementation and planning for next actions.
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
and institutions bound by common purpose and dedication to address NCD mortality and morbidities in the country. 3. Enhance Community Participation. The promotion of healthy lifestyle is heavily anchored on the participation and involvement of community members. Enhancing community participation is aimed at making the community members more receptive to changing their lifestyles. It could make them better advocates and supporters for others to follow. They can also become a source of financial support or other resources as they become involved in various campaigns and activities. At the end, the community members will be instrumental in bringing more members to avail of services, thus begin to develop and adopt new healthy lifestyle and practices. 4. Create a Supportive Organizational and Physical Environment. NCD prevention and control services are traditionally delivered through the network of public health facilities. A supportive organizational environment requires not only strengthening the capacities of the network public health facilities but also expanding the service delivery points to other health units in the private sector and in other institutions like that of the schools and corporations. Likewise, healthy lifestyle promotion must be integrated into the existing programs and activities of the LGUs, the church, academe and the community. Meetings and assemblies of formal and informal groups alike (e.g. professional societies, interest groups, informal sector transport associations, market vendors, street vendors, etc.) can serve as delivery points for promotive and preventive care. Correspondingly, a supportive physical environment must also be put in place. These may come in different forms as in providing a space for staff or community members to do their physical exercise or physical activity (e.g. sports tournament), decongesting walk
66
pavements to encourage the populace take a walk rather than ride, ensuring continuous traffic flow to ensure safety of pedestrians, providing lot and space for planting fruits and vegetables, and others. 5. Intensify Health Education and Public Information. Prevention of NCDs banks largely on the success of changing poor health habits and practices into healthy lifestyle. Health promotion efforts will take various forms in order to effect change in lifestyle and behavior. These include: (a) information, education and communication (IEC) intervention measures both for the individuals and the general public, (b) social mobilization that include the generation of participation and involvement of the community, service providers, program managers and other partners in making key decisions, assessment and planning, implementation and monitoring of NCD related efforts, and (c) advocacy among mandated agencies or institutions and concerned officials for direction and support. Key messages appropriate for each target group must be defined and geared to changes in behavior that are desired. 6. Strengthen Clinical Preventive Services. Clinical services must complement health promotion efforts. Critical to NCD prevention and control is the identification of the major common risk factor/s that exposes the individuals or groups of individuals to increased likelihood of developing NCDs. It is imperative that an assessment and screening of these risks in individuals and communities must be done in every opportunity using a simple tool. Results of the risk assessment must be used to guide the proper selection of appropriate lifestyle modification interventions for the concerned individuals and groups. Lifestyle modification interventions (which may come in different forms) must comply with the set standards and protocols to ensure quality of service provided to the clients. In this regard, competencies of service providers
along the delivery of these standard services must be developed while appropriate logistics/supplies, equipment and facilities must be in place. Critical to the strengthening of clinical prevention is the identification and referral of individuals needing advanced or more specialized care to a clinic or facility with established expertise in providing said management, treatment and care. Referral system be established and strengthened to ensure continuum of care and support of those needing secondary or tertiary care. 7. Institutionalize Planning for Promotion of Healthy Lifestyle. Assessment and Planning is a precursor to an effective implementation of NCD prevention and control program at the local level. Every locality is encouraged to undertake their own assessment of the current situation of NCDs in their area and identify the major risk factors exposing their population to NCD diseases. This is critical in the selection of interventions in response to their identified needs and particular situations. The plan for Healthy Lifestyle must be integrated into the current development plan of the LGUs, and inputted into their Philippine Health Investment Plan (PHIP) in F1 areas in order that efforts for HL will gain equitable support from various investments. LGUs must be provided with a guide on how to assess NCD-related issues and planning parameters to consider in selecting and designing appropriate interventions. 8. Expand Capability Building. Training on Healthy Lifestyle has been undertaken nationwide in the past. The coverage however was limited only to the network of public health facility staff. There is a need that this training be expanded to other groups of service providers outside the public health network and be offered to private practitioners those working in NGOs, church, private and public schools and the corporate institutions. Training will be expanded to include building competencies not only of service providers but
also of program managers on other aspects of health promotion, particularly advocacy, social mobilization and communication. An advanced training on Course for Program Managers on NCD Prevention and Control has been developed and provided to the regional NCD Program Coordinators and Health Education Program Officers (HEPOs). This training needs to be cascaded down to the local levels to enable them become better managers and advocates for NCD prevention and control. 9. Reinstall Supervision. Supervisory system needs to be reinstalled at each locality to ensure that the delivery of NCD prevention and control services follow the desired protocols and standards. Supervision must be purposive, planned in advance and the results of which are properly documented and tracked. Supervision calls for on-site training, problem solving and monitoring by the health facility supervisor on a regular basis. This component requires the supervision to be done in the context of enabling spirit rather than as a fault-finding mission. It requires the identification of actions, reaching an agreement with the supervisee what need to be done, and documenting these actions. Guide of supervision for the delivery of NCD prevention and control services has been initiated under the SS Certification Supervisory Package. LGU supervisors must be given special orientation on the said package. 10. Establish Financing Schemes. The implementation of NCD prevention and control measures requires substantial amount of resources. Financing options must be explored to sustain support for delivery of NCD services, promotion and other supportive mechanisms. Three tracks will be pursued to improve financing for healthy promotion activities. First is advocate for LGUs to increase budget allocation for NCD prevention in the health department and in other government offices (e.g. DILG, DSWD,
67
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
LCEs office, etc.) from the province to the barangay level. Second, entail mobilization of resources from the private sector, particularly the professional societies (e.g. church, corporations, clubs/ associations, and other NGOs), as well as contributions from the community, and external sources. Third, explore PhilHealth coverage of selected NCD prevention and control services, including mobilization of capitation funds for healthy lifestyle promotion. 11. Install Regulatory Mechanisms. Advocacy must be undertaken to prompt LGUs designate offices or organizations accountable for instilling compliance to national laws and policies related to NCD prevention and control. More importantly, the political will of local chief executives to adopt and implement the laws and policies must be harnessed. Officials and staff from these duly designated offices must be provided with proper orientation on the laws and policies, and should be helped in developing their guidelines and procedures for monitoring compliance. Prominent officials or celebrities can be tapped to champion the cause of NCD prevention and control. The role of BFAD in ensuring healthy food products must
be strengthened, and support of sanitary inspectors must be maximized. Support of the various agencies and participation of NGOs in monitoring compliance must be mobilized. 12. Unify Monitoring and Evaluation Efforts. Just as assessment and planning is a precursor to an effective NCD intervention implementation, monitoring and evaluation is equally vital in ensuring that intervention measures are properly implemented, regularly enhanced and focused to their targeted beneficiaries. Monitoring NCD status and progress of interventions as well as evaluating the results of initiatives are helpful in facilitating and redirecting focus and attention. Surveillance is one component of NCD monitoring and evaluation where there is a pro-active identification of people at risk to NCDs. This requires coordinated efforts between community and the implementing agencies in a given locality and must be strongly linked with higher level of administration. LGUs must be oriented on surveillance systems and monitoring efforts must be aligned with the M3 system (monitoring for equity, effectiveness and efficiency) being implemented by the Department of Health.
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
Vision and Focus
Vision: A Region free of avoidable NCD deaths and disability Focus: The Western Pacific Regional Action Plan is focused on practical, cost-effective and evidencebased interventions that Member States can adopt to achieve a reduction in NCD risk factor prevalence, and NCD mortality and morbidity. 4. Encompassing the entire care continuum The Regional Action Plan affirms the importance of a balanced approach to noncommunicable diseases, beginning with prevention and health promotion, lifestyle interventions to modify risk factors, screening, clinical interventions for high-risk individuals and groups, all the way through to chronic care, rehabilitation and palliation. This implies that the active participation of the entire health system is fundamental to creating impacts on population health. 5. Involving the whole of society Many of the critical interventions to prevent and control chronic diseases lie outside of the direct sphere of influence of the health sector. Thus, multisectoral partnerships are essential to successful NCD prevention and control. 6. Integral to health systems strengthening Noncommunicable diseases impact on the health care system not only in terms of increased service utilization and the associated costs, but also in the nature of the demands on service delivery to meet the needs of patients requiring long-term care. Health systems, in general, are designed to provide acute illness care, not chronic care. As such, most health systems fall short in the following areas: a. the patients responsibility and role in disease management are not emphasized; b. follow-up is sporadic; c. community services tend to be ignored; and d. prevention is underutilized and underemphasized. As the NCD burden grows, ensuring that health systems can adequately address noncommunicable diseases becomes integral to augmenting the capacity of health systems
69
Key principles
The Western Pacific Regional Action Plan is built around eight key principles: 1. People-centred health care Interventions and initiatives must adhere to the principles and values outlined in the People-centred Health Care policy framework of the Western Pacific Region (http://www.wpro. who.int/sites/pci/). 2. Cultural relevance Policies, programmes and services must respect and take into consideration the specific cultures and the diversity of populations within the Region. 3. Focused on reducing inequities The Regional Action Plan recognizes that the burden of chronic diseases is disproportionately borne within countries, by the poorer and less advantaged sectors, and across countries, by those at the lower stages of economic development. Other social determinants of health, such as race and gender, can also influence differential health outcomes from noncommunicable diseases. Thus, interventions must address the need to reduce inequities across and within countries by considering the social determinants of health to enable the attainment of healthy outcomes by all.
68
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
to meet evolving health challenges. For this to occur, integrating NCD prevention and management into primary health care is essential. 7. Consistent with the Global Action Plan, and supportive of existing regional strategies and action plans Recommended actions are in line with the objectives of the Global Action Plan, and with the strategies and principles of previous regional plans. This plan utilizes the best available science in selecting strategic actions while acknowledging the current limitations of research into the effectiveness of NCD interventions. 8. Flexibility through a phased approach Recognizing that countries and areas are at different stages of capacity for NCD prevention and control, the Regional Action Plan aligns its strategic actions along a continuum consistent with the NCD causation pathway. This phased approach allows countries to intervene at different points along the continuum depending on their local situation, capacity and resources.
seeks to effect change at three levels: 1. at the environmental level, through policy and regulatory interventions; 2. at the level of common and intermediate risk factors, through population-based lifestyle interventions; and 3. at the level of early and established disease, through clinical interventions targeted at the entire population (screening), high-risk individuals (risk factor modification) and persons with established disease (clinical management). To support change in these three levels, additional actions are needed in the following areas: 1. advocacy; 2. research, surveillance and evaluation; 3. leadership, multisectoral partnerships and community mobilization; and 4. health systems strengthening. In summary, the approach recognizes seven strategic action areas (Figure 2) along an intervention pathway that corresponds to the NCD causation pathway
Figure 2. Strategic approach and action areas in the Western Pacific Regional Action Plan for Noncommunicable Diseases
1.y EnvironmentalyyInterventionsy (macroeconomicyandypolicyychanges)y yy Governancey yy Policyyandylegislationy yy Creatingysupportivey yy environments 2.y yy yy yy yy LifestyleyInterventionsy
Behaviouralyinterventionsy Healthypromotion Informationyandyeducationy Improvingytheybuiltyyenvironment
3.y yy yy yy yy yy
ClinicalyInterventionsy
Clinicalypreventiveyservicesy Riskyfactorydetectionyy(screening)yandycontroly Acuteycarey Chronicycareyandyrehabilitationy Palliativeycare
6.y yy yy yy
Whole-of-governmentyyandywhole-of-societyyresponsey
Leadershipy Multisectoralypartnershipsy Communityymobilization
Strategic Approach
The Western Pacific Regional Action Plan for Noncommunicable Diseases utilizes a comprehensive approach that simultaneously
Specific regional actions under each of these action areas were mapped to the Global Action Plan. Where appropriate, specific actions from established regional and global frameworks and plans of action are included, demonstrating that these various disease and risk factor-specific action plans can be systematically integrated into one comprehensive strategy. Indeed, these various frameworks should be considered as pieces of a puzzle, which, when assembled, provide components of a coherent and organized response to the challenge of chronic diseases. The process consists of four major steps: (1) profiling; (2) planning and priority setting; (3) putting into practice (implementation); and (4) evaluation. Using an iterative process, countries move from their baseline situation in relation to noncommunicable diseases to progressively higher levels of capacity and action.
mortality and disease burden in developing countries. These four are cardiovascular disease (coronary heart disease and stroke), cancer, chronic respiratory disease and diabetes. Because these four diseases, and their shared risk factors, make the largest contribution to the Regions mortality, they are the major focus of this Regional Action Plan. However, other noncommunicable diseases, including blindness, deafness, oral diseases, certain genetic diseases and a number of infectious diseases that have a chronic nature, such as HIV/AIDS and tuberculosis, remain priority health problems in the Western Pacific Region. Noncommunicable diseases also include injuries that have an acute onset but are followed by prolonged convalescence and impaired function, as well as chronic mental diseases and substance abuse disorders. This Regional Action Plan recognizes that Member States must assess, and health systems must respond to, the health burden specific to each countrys situation, realizing that many of the interventions specified in this strategy have broad application and utility.
71
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
Specific regional actions under each of these action areas were mapped to the Global Action Plan. Where appropriate, specific actions from established regional and global frameworks and plans of action are included, demonstrating that these various disease and risk factor-specific action plans can be systematically integrated into one comprehensive strategy. Indeed, these various frameworks should be considered as pieces of a puzzle, which, when assembled, provide components of a coherent and organized response to the challenge of chronic diseases. The process consists of four major steps: (1) profiling; (2) planning and priority setting; (3) putting into practice (implementation); and (4) evaluation. Using an iterative process, countries move from their baseline situation in relation to noncommunicable diseases to progressively higher levels of capacity and action.
must assess, and health systems must respond to, the health burden specific to each countrys situation, realizing that many of the interventions specified in this strategy have broad application and utility.
social and economic policies. a. Increase awareness among regional, national and community leaders and other partners of the magnitude of the NCD burden, and the wider societal benefits of addressing it in terms of economic and social development, and advocate for their commitment to whole-of-government and whole-of-society approaches to control noncommunicable diseases and their risk factors b. Engage with other Member States and relevant regional and international bodies to address NCD risk factors and disease issues that cross national borders. As examples, consider the public health impact on respiratory health during crosscountry discussions on haze control, and incorporate health impacts of unhealthy products in trade agreements, such as those arising from the Association of South East Asian Nations (ASEAN) and the Pacific Island Countries Trade Agreement (PICTA). 3. Adopt approaches to policy development that involve all government departments, ensuring that public-health issues receive an appropriate cross-sectoral response. 4. Implement programmes that tackle the social determinants of noncommunicable diseases with particular reference to the following: health in early childhood, the health of the urban poor, fair financing and equitable access to primary health care services. a. Identify and utilize opportunities to merge NCD prevention and control into related health and non-health policy areas relevant to the Western Pacific Region, such as those that address urban development
(e.g. Healthy Cities), poverty alleviation, gender and health, workers health (e.g. Healthy Workplaces) and sustainable development (e.g. Healthy Islands). Recommended actions for WHO 1. Raise the priority given to the prevention and control of noncommunicable diseases on the agendas of relevant high-level forums and meetings of national and international leaders. a. Actively advocate for governments and other regional stakeholders to support efforts to integrate NCD prevention and control into the global development agenda, and to allocate resources for the expansion of the implementation of chronic disease prevention and control strategies regionally at forums such as the Pacific Islands Forum and the annual meeting of ASEAN heads of state and government. b. Coordinate and expedite efforts by Member States to reduce the burden of noncommunicable diseases in the Region. c. Develop regional leadership programmes to support country-level leadership initiatives that promote political champions for NCD prevention and control, building on existing models such as Pro-Lead1 , and using existing venues such as the annual Saitama NCD training course. 2. Work with countries in building and disseminating information about the necessary evidence base and surveillance data in order to inform policy-makers, with special emphasis on the relationship between noncommunicable diseases, poverty and development.
Pro-Lead (http://www.prolead.org) is a leadership development programme that focuses on applied leadership and management in health promotion intended for advocates, practitioners and partners in the health sector, government and private sector and civil society, for the promotion of health.
73
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
a. Facilitate dialogue among relevant stakeholders at the regional level to ensure that regional, multilateral and bilateral policies and other regulatory agreements are consistent with the evidence base for NCD prevention and control. 3. Develop and disseminate tools that enable decision-makers to assess the impact of policies on the determinants of, risk factors for, and consequences of noncommunicable diseases; and provide models of effective, evidence-based policy-making. a. Provide countries with technical assistance in the development, implementation and assessment of effective advocacy campaigns for the prevention and control of noncommunicable diseases. b. Work with WHO collaborating centres and other partner institutions and agencies to establish and maintain a repository or clearinghouse of best practices and successful strategies for policies to reduce prevalence of NCD risk factors and to promote the adoption of healthier lifestyles. c. Provide technical guidance to countries in formulating and implementing policy and regulatory interventions designed to create supportive environments for NCD prevention and control based on existing guidance documents. Recommended actions for international partners and WHO collaborating centres 1. Include the prevention and control of noncommunicable diseases as an integral part of work on global development and in related investment decisions. a. Work with WHO to facilitate regional collaborative partnerships among countries, WHO collaborating centres
74
and relevant partners to advocate for investments in regional NCD prevention and control initiatives as part of the regional development agenda. For example, consider the model used by the Western Pacific Declaration on Diabetes as a partnership model for WHO, International Diabetes Federation Western Pacific Region, Secretariat of the Pacific Community (SPC) and Member States. 2. As appropriate, work with WHO to involve all stakeholders in advocacy in order to raise awareness of the increasing magnitude of the public-health problems posed by noncommunicable diseases, and of the fact that tackling the determinants of and risk factors for such diseases has the potential to be a significant method of prevention. a. Provide technical assistance to countries and areas through a regional clearinghouse of best practices and successful strategies for NCD advocacy. 3. Support WHO in creating forums where key stakeholders including nongovernmental organizations, professional associations, academia, research institutions and the private sector can contribute and take concerted action against noncommunicable diseases. OBJECTIVE 2: To establish and strengthen national policies and plans for the prevention and control of noncommunicable diseases. Recommended actions for Member States National multisectoral framework for the prevention and control of noncommunicable diseases 1. Develop and implement a comprehensive policy and plan for the prevention and control of major noncommunicable diseases, and for the reduction of modifiable risk factors.
2
a. Design and implement an advocacy campaign to mobilize political and grassroots support for the national action plan for NCD prevention and control. b. Support the integrated approach to NCD prevention and control through policy statements and official guidelines. As an example, consider Japans Peoples Health Promotion Campaign for the 21st Century (Health Japan 21), which endorses a comprehensive approach to NCD as a core element of Japans national public health agenda. 2. Establish a high-level national multisectoral mechanism for planning, guiding, monitoring and evaluating enactment of the national policy with the effective involvement of sectors outside health. 3. Conduct a comprehensive assessment of the characteristics of noncommunicable diseases and the scale of the problems they pose, including an analysis of the impact on such diseases of the policies of the different government sectors. 4. Review and strengthen, when necessary, evidence-based legislation, together with fiscal and other relevant policies, which are effective in reducing modifiable risk factors and their determinants. a. Establish fiscal policies that reinforce healthy lifestyle choices through pricing, taxation, subsidies and other market incentives. b. Regulate2, to the fullest extent possible, the sale, marketing, advertising and promotion of unhealthy commodities to create a social and media environment supportive of healthy lifestyles. c. Regulate the built environment to promote physical activity and social interaction
and to protect people from hazardous exposures such as second-hand smoke. Integration of the prevention and control of noncommunicable diseases into the national health development plan 1. Establish an adequately staffed and funded noncommunicable disease and health promotion unit within the ministry of health or other comparable government health authority. 2. Establish a high-quality surveillance and monitoring system that should provide, as minimum standards, reliable population-based mortality statistics and standardized data on noncommunicable diseases, key risk factors and behavioural patterns, based on the WHO STEPwise approach to risk factor surveillance. 3. 3. Incorporate evidence-based, costeffective primary and secondary prevention interventions into the health system with emphasis on primary health care. Reorientation and strengthening of health systems 1. Ensure that provision of health care for chronic diseases is dealt with in the context of overall health system strengthening and that the infrastructure of the system, in both the public and private sectors, has the elements necessary for the effective management of and care for chronic conditions. Such elements include appropriate policies, trained human resources, adequate access to essential medicines and basic technologies, standards for primary health care, and well-functioning referral mechanisms.
Regulate refers to a variety of social and legal instruments to govern behaviour, and is not intended to refer exclusively to legislation
75
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
a. Reorient and reinforce health systems, using the six building blocks,16 to enhance responsiveness and capacity to address the challenges of NCD prevention and control, guided by the recommendations of the 2007 WHO Regional Meeting on Strengthening Health Systems to Improve Chronic Disease Prevention and Control. One example is Mongolias Master Plan for Health System Development 20062015, which uses an integrated approach to NCD prevention and control as an anchor for health systems strengthening. Another is the Republic of Koreas Comprehensive Preventive National Health Management System, which incorporates lifecycle-specific services for health promotion and NCD prevention into the national health-service delivery system. b. Strengthen primary health care to respond to all chronic diseases regardless of aetiology, using the Chronic Care model. c. Explore innovative service delivery models that encompass both populationbased preventive and behavioural services and clinical services for chronic disease management. For example, consider the Sentrong Sigla3 model of the Philippines. 2. Adopt, implement and monitor the use of evidence-based guidelines and establish standards of health care for common conditions like cardiovascular diseases, cancers, diabetes and chronic respiratory diseases, integrating, whenever feasible, their management into primary health care. a. Disseminate health service frameworks, clinical practice guidelines and evidencebased decision-making support tools to health care providers to ensure timely screening, diagnosis, and treatment of
3
noncommunicable diseases, consistent with country-specific burden and taking into account the health infrastructure and capacity. b. Implement and scale up proven costeffective NCD interventions, beginning with: (i) tobacco control, (ii) salt reduction, (iii) multidrug treatment for individuals with high risk for cardiovascular disease. c. Promote clinical practice guidelines that use the integrated disease model, such as those issued by the International Diabetes Federation (IDF) Western Pacific Region. 3. Implement and monitor cost-effective approaches for the early detection of breast and cervical cancers, diabetes, hypertension and other cardiovascular risk factors. 4. Strengthen human resources capacity, improve training of physicians, nurses and other health personnel and establish a continuing education programme at all levels of the health care system, with a special focus on primary health care. a. Use innovative approaches to health workforce development to equip health care providers with the necessary skills, knowledge and attributes to deliver effective, people-centred care for chronic diseases regardless of aetiology. b. Foster leadership for noncommunicable diseases within the health care sector by building on existing models such as ProLead, and using existing venues such as the annual Saitama NCD training course. 5. Take action to help people with noncommunicable diseases to manage their own conditions better, and provide education, incentives and tools for self-management and care.
a. Promote the people-centred approach to health care, as outlined in the recent WHO publication, People at the Centre of Health Care: Harmonizing Body and Mind, People and Systems.17 b. Establish programmes to empower individuals and communities to develop health literacy, to take on self-care responsibilities and to become resources for themselves and others in disease management and prevention. c. Adopt interventions to improve the quality of life of individuals with noncommunicable diseases. 6. Develop mechanisms for sustainable health financing in order to reduce inequities in accessing health care. a. Establish financing mechanisms to channel sustainable funding to NCD prevention and control initiatives, such as through earmarking tobacco and alcohol taxes for health promotion, as was done in Australia by the Victorian Health Promotion Foundation (VicHealth) and in the Republic of Korea, and was initiated in Malaysia, Mongolia and Tonga. b. Promote equitable access to and rational use of cost-effective medical products and commodities related to NCD disease management.
and disseminate lessons learnt. [Action to be led by WHO Headquarters.] 2. Recommend, based on a review of international experience, successful approaches for intersectoral action against noncommunicable diseases. (a) Build on previous intersectoral initiatives in the Region, such as the WHO/FAO Meeting on Food Standards to Promote Health and Fair Trade in the Pacific (December 2007) and the WHO Healthy Cities and Healthy Islands Initiative. (b) Highlight successful national examples of intersectoral strategies that address noncommunicable diseases and their risk factors, such as New Zealands Healthy Eating Healthy Action4. 3. Provide guidance for the development of national policy frameworks, including evidence-based public health policies for the reduction of risk factors, and provide technical support to countries in adapting these policies to their national context. Integration of the prevention and control of noncommunicable diseases into the national health development plan 1. Expand, over the time frame of this plan, the technical capacity of WHOs regional and country offices and develop networks of experts and collaborating or reference centres for the prevention and control of noncommunicable diseases in support of national programmes. 2. Develop norms for surveillance and guidelines for primary and secondary prevention, based on the best available scientific knowledge, public-health principles and existing WHO tools. [Action to be led by WHO Headquarters.] (a) Disseminate to Member
Recommended actions for WHO National multisectoral framework for the prevention and control of noncommunicable diseases
1. Conduct a review of international experience in the prevention and control of noncommunicable diseases, including community-based programmes, and identify
4
Sentrong Sigla is a quality improvement programme of the Philippines Department of Health that confers recognition to health centres and hospitals for excellence in health service delivery, including the use of an integrated approach to disease management.
Healthy Eating Healthy Action is the New Zealand Ministry of Healths strategic approach to improving nutrition, increasing physical activity and achieving healthy weight for all New Zealanders. It uses a whole-of-society approach to address NCD risk factors in the population (www.moh.govt.nz/ healthyeatinghealthyaction).
77
76
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
States existing surveillance standards and clinical practice guidelines, such as WHOs Prevention of Cardiovascular Disease: Guidelines for Assessment and Management of Cardiovascular Risk and the International Agency for Research on Cancers Handbooks of Cancer Prevention. 3. Review and update diagnostic criteria, classifications and, where needed, management guidelines for common noncommunicable diseases. [Action to be led by WHO Headquarters.] 4. Provide support to countries, in collaboration with international partners, in strengthening opportunities for training and capacity-building with regard to the public-health aspects of the major noncommunicable diseases. a. Support countries and areas with periodic technical assistance and training at the national and regional level, including training in the selection of appropriate clinical interventions that are feasible to implement even within a developing country setting, and in the people-centred approach to noncommunicable diseases. Reorientation and strengthening of health systems 1. Ensure that the response to noncommunicable diseases is placed at the forefront of efforts to strengthen health systems. a. Promote a regional framework for health systems strengthening in relation to noncommunicable diseases (building on the Chronic Care model and similar concepts) that is relevant to and adaptable for the Region. b. Support Member States in their efforts to strengthen their health systems and re-orient their systems of care to
78
address chronic diseases, as guided by the Strategic Plan for Strengthening Health Systems in the WHO Western Pacific Region. c. Reinforce the integrated approach to noncommunicable diseases by articulating this in policy statements and guidelines. 2. Provide technical guidance to countries in integrating cost-effective interventions against major noncommunicable diseases into their health systems. a. Provide countries with technical assistance regarding service delivery models for chronic disease, with an emphasis on integrating NCD prevention and control interventions into primary health care. For example, consider integration of brief interventions for tobacco cessation into all clinical encounters. b. Encourage and assist Member States to develop appropriate national health care guidelines that incorporate noncommunicable diseases and other chronic disease care into the overall health care package. 3. Provide support to countries in enhancing access to essential medicines and affordable medical technology, building on the continuing WHO programmes promoting both good-quality generic products, and the improvement of procurement, efficiency and management of medicine supplies [2008 2009]. a. Disseminate guidelines for rational use of medicines and technology for NCD prevention and control, as an integral part of health systems. 4. Assess existing models for self-examination and self-care, and design improved affordable versions where necessary, with a special focus on populations with low health awareness and/or literacy.
contained in the WHO Framework Convention for Tobacco Control: y monitor tobacco use and tobacco prevention policies; y protect people from tobacco smoke in public places and workplaces; y offer help to people who want to stop using tobacco; y warn people about the dangers of tobacco; y enforce bans on tobacco advertising, promotion and sponsorship; and y raise tobacco taxes and prices. In particular: a. Delineate and implement interventions to reduce the demand for and limit the supply of tobacco, including chewing tobacco with betel nut. b. Introduce interventions to facilitate and increase access to smoke-free facilities. Promoting healthy diet 1. Implement the actions recommended in, but not limited to, the Global Strategy on Diet, Physical Activity and Health. In particular: a. Delineate and implement interventions to reduce the demand for and limit the supply of unhealthy foods. b. Promote the consumption of healthy local foods, as is happening in some Pacific island countries (e.g. promotion of local bananas rich in vitamin A in the Federated States of Micronesia). Promoting physical activity 1. Implement the actions recommended in, but not limited to, the Global Strategy on Diet, Physical Activity and Health. a. Increase access of communities to
79
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
exercise facilities (e.g. Tongas Walking Path, Malaysias ProActive Scheme5). Reducing the harmful use of alcohol 1. Respond effectively to the public-health challenges posed by harmful use of alcohol in accordance with existing regional strategies and guided by the outcome of current and future WHO global activities to reduce harmful use of alcohol. a. Adopt and begin implementation of the Western Pacific Regional Strategy and Regional Action Plan to Reduce Alcoholrelated Harm. Additional recommended regional actions (1) Utilize media and social marketing to promote healthy choices and to increase knowledge and awareness of NCD risk factors. Apply lessons learnt from previous initiatives, such as the WHO Regional Offices Its OK to Say You Mind campaign on second-hand smoke, using culturally relevant messages. 2. Incorporate NCD prevention and control interventions into the Healthy Settings approach. As an example, consider Papua New Guineas pilot obesity and physical activity programme for workplaces, conducted jointly by the Ministry of Health and the Papua New Guineas Sports Federation.
Strategy for Infant and Young Child Feeding, which have been the subject of resolutions adopted by the World Health Assembly, in order to provide technical support to countries in implementing or strengthening nationwide action to reduce risk factors for noncommunicable diseases and their determinants. (a) Develop and disseminate appropriate technical guidelines on population-based strategies to motivate behaviour change, when none currently exist. 2. Guide the development of pilot or demonstration community-based programmes of intervention. (a) Consider support to countries for pilot or demonstration projects for promising interventions that have not been extensively studied for applicability and relevance to the Region. (b) Document and disseminate lessons learnt and assist countries to replicate and scale up proven interventions. For example, share lessons learnt from community-based interventions for salt reduction as implemented in the Tianjin Study, China with other Member States. 3. Support the development of networks of community-based programmes at the regional and global levels. 4. Provide support to countries in implementing the MPOWER package and provide technical support to implement other measures contained in the WHO Framework Convention on Tobacco Control in response to specific national needs. a. Support countries and areas with periodic technical assistance and training at the national and regional level, including training in the use of evidence to guide the selection, development
and implementation of population-based lifestyle interventions. 5. Ensure synergy with the work of the Convention Secretariat and the implementation of the WHO Framework Convention on Tobacco Control in applying the tobacco-control component of this plan. [Action to be led by WHO Headquarters.]
to oversee and manage national research initiatives for noncommunicable diseases. (c) Work with partners and academic institutions to prioritize implementation research for noncommunicable diseases. (d) Consider innovative approaches to behavioural research, such as community-based participatory research methods, for shifting population behaviour towards healthier choices 2. Encourage the establishment of national reference centres and networks to conduct research on socioeconomic determinants, gender, cost-effectiveness of interventions, affordable technology, health system reorientation and workforce development. Additional recommended regional action (1) Disseminate research findings through participation in existing information dissemination venues such as the Mobilization of Allies on Noncommunicable Disease Action (MOANA)6 and ProCOR7.
Malaysias ProActive scheme engages sports organizations and communities to develop community-based physical activities and active recreational projects, making physical activities attractive and accessible to community members who do not normally participate or are currently inactive (www. healthpromo.gov.my/healthpromo.asp?val=scheme2).
6 7
MMOANA is an NCD network in the Western Pacific Region, with an active web-based information dissemination and discussion group. ProCOR (www.procor.org), a programme of the Lown Cardiovascular Research Foundation, is an ongoing, e-mail and web-based electronic conference aimed at addressing the epidemic of cardiovascular diseases in the developing world
80
81
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
2. Encourage WHO collaborating centres to incorporate the research agenda into their plans and facilitate collaborative research through bilateral and multilateral collaboration and multicentre projects. Recommended actions for international partners and WHO collaborating centres 1. Include the prevention and control of noncommunicable diseases as an integral part of work on global development and in related investment decisions. 2. As appropriate, work with WHO to involve all stakeholders in advocacy in order to raise awareness of the increasing magnitude of the public-health problems posed by noncommunicable diseases, and of the fact that tackling the determinants of and risk factors for such diseases has the potential to be a significant method of prevention. 3. Support WHO in creating forums where key stakeholders including nongovernmental organizations, professional associations, academia, research institutions and the private sector can contribute and take concerted action against noncommunicable diseases. OBJECTIVE 5: To promote partnerships for the prevention and control of noncommunicable diseases. Recommended actions for Member States 1. Participate actively in regional and subregional networks for the prevention and control of noncommunicable diseases 2. Establish effective partnerships for the prevention and control of noncommunicable
8 9
diseases, and develop collaborative networks, involving key stakeholders, as appropriate. (a) Encourage and promote community participation and grassroots mobilization to establish a broad base of support for the prevention and control of chronic diseases and to ensure acceptability and effectiveness of policy and population-based interventions. For example, promote the growth of community coalitions for noncommunicable diseases, such as the Philippine Coalition for the Prevention and Control of NCD. (b) Explore working with appropriate partners, such as the food industry, to establish public health interventions for NCD prevention and control. For example, consider Singapores Nutrition Labelling programme8 and New Zealands Food Industry Group (FIG)9.
use cross-country alliances, networks and partnerships for NCD capacitybuilding, advocacy, research and surveillance (e.g. Alliance for Healthy Cities, MOANA). Cross-country alliances can also facilitate unified responses to transnational issues that affect noncommunicable diseases, such as trade issues and global marketing of unhealthy lifestyles. For example, follow up on the conclusions of the Meeting of the Ministers of Health of the Pacific Island Countries in Vanuatu, which call for engagement with the food and trade sectors to ensure that the health impact of trade agreements on diet is minimized. 3. Support and strengthen the role of WHO collaborating centres by linking their plans to the implementation of specific interventions in the global strategy. 4. Facilitate and support, in collaboration with international partners, a global network of national, regional, and international networks and programmes such as the WHO regional networks for noncommunicable disease prevention and control. [Action to be led by WHO Headquarters.] Additional recommended regional actions for WHO 1. Advise Member States on ways of engaging constructively with appropriate industries. (2) Provide technical assistance and other support to countries to promote social mobilization and community participation in NCD prevention and control. Recommended actions for international partners and WHO collaborating centres 1. Collaborate closely with and provide support to Member States and the Secretariat in implementing the various components of the global strategy for the
prevention and control of noncommunicable diseases. (a) Actively encourage international and appropriate private partners to support NCD prevention and control in the Region. 2. Give priority to noncommunicable diseases in international and regional initiatives to strengthen health systems based on primary health care. OBJECTIVE 6: To monitor noncommunicable diseases and their determinants, and evaluate progress at the national, regional and global levels Recommended actions for Member States 1. Strengthen surveillance systems and standardized data collection on risk factors, disease incidence and mortality by cause, using existing WHO tools. (a) Regularly participate and implement standard global and regional surveys, such as the WHO STEPS survey and the various surveys comprising the Global Tobacco Surveillance System, and use the data to guide NCD policy and programme development. 2. Contribute, on a routine basis, data and information on trends in respect of noncommunicable diseases and their risk factors disaggregated by age, gender, and socioeconomic groups; and provide information on progress made in implementation of national strategies and plans Recommended actions for WHO 1. Develop and maintain an information system to collect, analyse and disseminate data and information on trends in respect of mortality, disease burden, risk factors, policies, plans and programmes using currently available data sources like the WHO Global InfoBase and other existing global information systems. This database will be expanded to handle new information
83
Singapores Nutrition Labelling Programme (www.hpb.gov.sg/hpb) is a programme whereby the Ministry of Health works with the food industry to provide nutrition information on food packaging at the point of sale. The Food Industry Group of New Zealand (www.fig.org.nz) was formed to encourage food companies to work with the Government and the community to solve the problem of obesity.
82
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix B: The Western Pacific Regional Action Plan for Noncommunicable Diseases
on subjects such as health services coverage, related costs, and quality of care. [Action to be led by WHO Headquarters.] a. At the regional level, maintain a STEPS survey database, including use of STEPS data for policy. b. Make use of existing global databases and inform Member States of the availability of these databases. For example, promote the global cancer database of the International Agency for Research on Cancer (IARC). 2. Establish a reference group for noncommunicable diseases and risk factors, made up of experts in epidemiology, in order to support the work of the Secretariat and advise countries on data collection and analysis. [Action to be led by WHO Headquarters.] 3. Strengthen technical support to Member States in improving their collection of data and statistics on risk factors, determinants and mortality. (a) Continue to support STEPS training within the Region. 4. Convene a representative group of stakeholders, including Member States and international partners, in order to evaluate progress on implementation of this action plan. The group will set realistic and evidence-based targets and indicators for use in both the mid-term and final evaluations. a. Promote existing evaluation frameworks for Member States to utilize, such as the Diet and Physical Activity Strategy (DPAS) Framework to Monitor and Evaluate Implementation. b. Develop relevant indicators and milestones for the Region, where none currently exist, and encourage countries to develop and monitor indicators and milestones at the national level.
84
5. Prepare progress reports in 2010 and 2013 on the global status of prevention and control of noncommunicable diseases. [Action to be led by WHO Headquarters.] a. Within existing frameworks and mechanisms, contribute to global NCD progress reports by collating data on pertinent indicators at a regional level. Recommended actions for international partners and WHO collaborating centres 1. Work collaboratively and provide support for the actions set out for Member States and the Secretariat in monitoring and evaluating, at the regional and global levels, progress in prevention and control of noncommunicable diseases. 2. Mobilize resources to support the system for regional and global monitoring and evaluation of progress in the prevention and control of noncommunicable diseases.
Member States are also urged to use this guide in creating and implementing locally relevant policy and regulatory interventions, populationbased lifestyle interventions, targeted clinical interventions and supporting strategic actions to build healthy populations and communities living in environments that support healthy choices.
The Regional Action Plan is a work in progress. Its success will depend on the applications in this document, and on the collective ability of the countries and partners in the Region to learn from each other and share expertise, knowledge and resources, and demonstrate political commitment and leadership in effecting change for better health.
Final Word
This Regional Action Plan presents a way to operationalize the reduction of the burden of chronic disease in the Western Pacific Region. It integrates various frameworks, strategies and action plans addressing specific risk factors and particular diseases into a holistic and definitive approach to NCD prevention and control. The NCD burden within the Western Pacific is largely an avoidable burden. Current evidence indicates that a significant proportion of NCD morbidity, disability and premature deaths within the Region can be averted through prevention, lifestyle modification and the judicious control of a few common risk factors that underlie the major categories of chronic disease. Member States are requested to seriously consider the strategic actions put forward in the Regional Action Plan in light of their particular situation and national context.
85
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix C: Package of Intervention for NCD Prevention and Control by Level of Care and Standards and Requirements
Appendix C: Package of Intervention for NCD Prevention and Control by Level of Care and Standards and Requirements
Table 8. Package of Intervention for NCD Prevention and Control by Level of Care and Standards and Requirements Level of Care Intervention Package
Risk Assessment and Screening yy BloodyPressurey yy Weight yy Waisty circumference,y bodyymassyindexy (BMI) yy HealthyyLifestyley checkyony smoking,yalcoholy intake,yphysicalyy activity,yfruitsy andyvegetabley intake,ystressy level yy Clinicalybreasty exam Healthy Lifestyle Modification yy Educationyyandy counselingyony properydiet,y regularyphysicaly activity,ytobaccoy useycessation,y avoidanceyofy alcoholy Referral and Follow-up
Level of Care
Intervention Package
AboveyyPlus:y Screening yy Visualyinspectiony usingyaceticyacidy (VIA)yoryPapy smear yy Digital-Rectaly Examy(DRE) yy CBCy yy Urinalysisy yy AccessytoyFBS Management and Treatment yy hypertension yy diabetes yy chronicy respiratoryy disease yy smokingy cessation Palliative Careyy painymanagementy forycancerypatient Other Preventive Services yy HepayBy Immunization yy TreatmentySTIs Counseling/ Behavioral Therapy SupportyGroups
Minimum Staffing
AboveyPlus:y Nurse Nutritionistyory equivalent MedicalyDoctoryyyyyyyy Medicalyyyyyyy Technologist (oryany agreementy withyayreferraly laboratory)
Training/ Competencies
AboveyPlus:
Drugs/ Medicines
ForyCVD: yy Thiazidey diuretics yy Betablockers yy Calciumy Channely Blockersy (sustained yy releasedy yy formulations) yy Angiotensiny yy convertingy yy enzymey inhibitors yy Statinsy (optional) yy salbutamol/ B2yagonisty drugs ForyCancer -non-opiody analgesicsy Diabetes: yy Thiazolidinesy (TZD)y yy Metformin yy Alphayy GlucosidaseyIyyy yy inhibitorsy (AGI) yy Sulfonylureasy (SU) VaccinesyforyEPIy andymedicinesy forySTIs
Equipment/ Supplies
AboveyPlus: Accessyto:
Minimum Staffing
Midwife
Training/ Competencies
Trainingyony healthyylifestyley promotion
Drugs/ Medicines
None
Equipment/ Supplies
Stethoscopeyyyyyyyyyyyyyyyyyyy Non-mercurialyBPy apparatusyyyyyyyyyyyyyyyyyy Weighingyscaley yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy Tapeymeasureyyyyyyyyyyyyy Examiningytable Counselingyroom
Primary Level 1 yy Barangayy HealthyStationy (BHS)y yy Otherysimilary clinicsyinyothery governmenty agencies,yory inytheyprivatey sectory
yy Trainingyony VIA/PapySmeary yy Orientationy onyCPGsyony diabetes,y hypertension,y COPD yy Trainingyony Smokingy Cessationy yy Trainingyony Nutritionyandy Dietyyy
Counselingyfor:
86
87
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Appendix C: Package of Intervention for NCD Prevention and Control by Level of Care and Standards and Requirements
Level of Care
Intervention Package
AboveyPlus: Screening/ Diagnosis: yy ChestyX-Rayy yy BloodyChemistryyyy yy FBS yy ECG Treatment for: yy heartyattacky yy strokey yy RF/RHD yy diabetesywithy complicationsyyyyyyy yy COPD yy Cancer yy dietytherapy Palliative Care painymanagementyy (morphine,yopioids) Rehabilitative Care -yMaintenanceycarey andyfollowyup
Minimum Staffing
yy X-rayy technician yy Dietitian
Training/ Competencies
In-Servicey Trainingyonythey Managementyofy: yy Diabetesy yy Stroke yy Hypertension yy Cancer
Drugs/ Medicines
yy Benzatineyyyyyy penicillin,y1.2y millionyIU yy Nitratesy yy Morphine yy Otheryopioids yy IVymeds yy Otherymeds
Equipment/ Supplies
Ophthalmoscope X-rayyequipment ECGymachine Spirometer Glucometer/ wetymethodyfory bloodyglucosey determination
Level of Care
Intervention Package
AboveyPlus Advanced Diagnosis yy CTyscan/MRIy yy angiography,y yy mammography yy cardiacy catheterization Treatment and Management yy Radiationy Therapy yy Chemotherapy yy completey emergencyy treatmenty foryAMI-CVAy hypertensivey crisisyandyothery CVyemergencies yy insertionyofy pace-maker yy pericardiocentesis yy cardiovasculary surgeryyyyyyyyyyyyyyyyyyy
Minimum Staffing
yy Pathologist yy PT/OTy Thoracicy Surgeon yy Neurologist yy Othery specialists
Training/ Competencies
yy Specialtyy Training
Drugs/ Medicines
Drugs/medsyiny SpecialtyyCPGs
Equipment/ Supplies
AboveyPlus yy Dopplery Machineyy yy Advancedy diagnosticy imagingy equipmenty(e.g.y CTyscan,yMRI,y eco-cardiogramy etc.) yy Treadmilly ExerciseyTest yy mammogram
Tertiary
AboveyPlus: Screening/ Diagnosis: yy BloodyChemistryyyy (SGOT,yASO,yESR,y lipidyprofile,y electrolytes) yy Accessytoy pathologicaly diagnosis,y includingy sputumycytologyy forylungycancer Treatment:y surgery Physical & Psychoeducational rehabilitationy requiringytrainedy therapist
88
89
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Dateyyy
Htycm
Wtykgyyyy
BMIyyyy
Waisty cm
Hipy cm
W/Hy Ratioyyyyyyyy
BP yy
Hypertension Y yyyNyyyyyyyyyyyyyyyy
Address:
Dietary Fiber Intake: (i)yyServingsyofyfruitsyperydayyy:y_______yyyyyyyyadequateyyyyyyinadequateyy (ii)yServingsyofyvegetablesyperyday:y____yyyyyyyyadequateyyyyyyinadequate Hypercholesterolemia: yyyelevatedytotalycholesterolyy yyyelevatedyLDLyy yyyelevatedytriglyceridesyyy yyyLowyLDLyy
Ifytheyclientyisyoverweighty(BMIyisy>y23),ycheckytheyboxyforyatyriskyandycounselyaccordingly.
90
91
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
yy 11.y Withytheyuseyofytapeymeasure,ytakeytheyclientsywaistycircumferenceyinycentimetersyandyrecord.y
Sex Waist Circumference NotyAtyRisk Maleyy Female <y90 <y80 AtyRisk >y90 >y80
Ifytheyclientsywaistycircumferenceyfallsyunderytheyatyriskyclassification,ycheckytheyappropriateyboxyandycounselyaccordingly. 12.y Askytheyclientyifyhe/sheyregularlyysmokesycigarettes.yCheckyappropriateybox.yIfyhe/sheysmokes,yandyhasymadeyattemptsytoyquitysmoking,yputyay checkymarkyonyAttemptsytoyQuitySmoking.y 13.y Askyclientyifyhe/sheyisyexposedytoysecondyhandycigaretteysmokeyatyworkyand/oryatyhome.yIfyyes,yputyaycheckyonytheyappropriateybox.y 14.y Askyclientyifyhe/sheyregularlyyconsumesyalcoholicybeveragesyandycheckytheycorrespondingybox.y 15.y Askytheyclientyifyhe/sheyindulgesyinyphysicalyactivityyforyatyleasty30yminutesyperydayythreeyorymoreytimesyayweek.yIfyyes,ycheckytheyboxyony physicallyyactive.yIfynot,ycheckytheyboxyforysedentary.y 16.y Askyytheyyclientyyforyytheyydatesyyofyyheryylatestyyclinicalyybreastyyexaminationyyandyyaceticyyacidyywash.yyIfyhe/sheyyisyydueyyforyythese,yyprovideyytheyy servicesyyifyytheyytimingyyisyyappropriate.yyIfynot,ygiveyheryanyappointmentyforytheseyservices.y 17.y Printyyourynameyandysignyoveryit.y 18.y AfterycompletingytheyRiskyAssessmentyFormyandycounseling,yproceedytoydeliverytheyservicesyforywhichytheyclientycameytoytheyhealthyfacilityy for.
Figure 3. Proposed Algorithm for the Management of Hypertention in Adults (18 Years or Older) for Sentrong Sigla Health Facilities
BP>140/90 mmHG (on repeated measurements) Complete History Physical Exam
Re-check in 1 year
Confirm in 2 months
Normal BP
To be included in JNC7 LIFESTYLE MODIFICATION 1. Stop smoking 2. Weight reduction of 1lb or 0.5 kg per week until ideal BMI is attained 3. Regular physical activity (brisk walking, jogging, cycling 30-60 mins 3-4 times a week 4. Drink moderately 5. Moderation of dietary sodium
92
93
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
and renal ischemia should be avoided. Diuretics, ACE Inhibitor, Beta Blocker, Calcium Channel Blocker, methyldopa can be used alone or in combination. Sublingual administration of fast-acting Nifedipine should be avoided as degree of fall of BP may be too rapid.
8 hours Sedatives, tranquilizers and antidepressants Digitalis and diuretics Anti-arrhythmic drugs
Management of Cancers
Lung Cancer
Figure 4. Algorithm on Screening for Lung Cancer
History and Physical Examination
Angina Pectoris
y Prevention of Acute Anginal Attack Sustained-release Nitroglycerin Oral Nitroglycerin: 2.5 to 9 mg every 8-112 hours 20% Nitroglycerin ointment applied to tape and attached to skin: average dose is 1-2 inches of tape given every 4-6 hours Transdermal Patch: 2.5 15 mg daily y Treatment of Acute Anginal Attack Nitroglycerin, sublingual: 0.15-0.6 mg every 5-10 minutes for a total of three doses if pain is not relieved promptly. Long-acting Nitrates: Isosorbide dinitrate or tetranitrate tabs, sublingual: 2.5-10 mg q 3-4 hours; tablets, oral 20-60 mg q 6 hours; tablets sustained release 40-80 q 8-12 hours or q hours Beta Adrenergic Antagonist (any) Atenolol, 10 mg/d taken daily Metroprolol, 150-300 mg/d with disease schedule of q 12 hours Propanolol, 120-400mg/d with disease schedule of q 2 6-12 hours Calcium Channel Blockers: taken either alone or combined with beta-blockers in treatment of chronic stable angina: Nifedipine: 30-120 mg/d with dosage schedule of q 6-8 hours; Verapamil: 240-480 mg/d with dosage schedule of every 8 hours;
History of Smoking
Health Education
Definition
T3
Regionalylymphynodesycannotybeyassessed
95
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
TNM Classi-fication
Noyy N1 N2 N3 Distant Metastasis (M) Mx Mo M1 Stage Grouping Occult Carcinoma TxNoMo
Definition
Noydemonstrableymetastasisyinyregionalylymphynode Metastasisyinyipsilateralymediastinalynodesyand/oryipsilateralyhilarylymphynodes,yincludingydirectyextension Metastasisyinyipsilateralymediastinalynodesyand/orysubcarinaylymphynodes Metastasisyinycontralateralymediastinalyorycontralateralyhilar,yoryipsilateralyorycontraletralyscaleneyorysupraclavicularylymphynodes
TreatmentysameyasyT1N1Mo
Occultycarcinomaywithybronchopulmonaryysecretionsycontainingymalignantysellsybutywithoutyotheryevidenceyofytheyprimaryytumoryory evidenceyofymetastasisytoytheyregionalylymphynodesyorydistantymetastasis
yy StageyIyyyyyyyyyyy
TisNoMoyyyy T1NoMoyy T2NoMo Carcinomayinysitu TumorythatycanybeyclassifiedyT1yoryT2 Withoutyanyynodalyorydistantymetastasis
yy StageyIIyyyyyyyyyy
T1NoMo TumoryclassifiedyasyT1yoryT2ywithymetastasisytoytheylymphynodesyinytheyperibronchialyoryipsilateralyregiononlyyorybothywithoutydistanty metastasis
yy StageyIIIyyyyyyyyy
T3NoMoyyy T3N1Moyy T1-3N2Moyyyy TumoryclassifiedyasyT3ywithoutynodalymetastasisyorywithynodalymetastasisyconfinedy PeribronchialyoryipsilateralyhilarynodesywithoutydistantymetastasisyoryanyyT1-3ytumor Metastasisyinytheyipsilateralymediastinalyorysubcarinalynodesybutywithoutydistantymetastasisyyyyy
96
97
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Breast Cancer
Figure 5. Algorithm on Screening for Breast Cancer
Monthly Breast Self-Examination (30-60 years & above) Signs & symptoms of breast mass Monthly Breast Self-Examination (30-60 years & above) History and physical examination MD, Nurse, Midwife (+) or suspicious Mass: Referral for Diagnosis and proper management
Definitions
Regionalylymphynodesycannotybeyassessedy(e.g.ypreviouslyyremovedyoryy10notyremovedy forypathologicalystudy). Noyregionalylymphynodeymetastasis. Metastasisytoymovableyipislateralyaxillaryylymphynode(s).ypN1ayyyOnlyymicrometastasisy (noneylargerythany0.2ycm).ypN2byyMetastasisytoylymphynode(s),yanyylargerythany0.2ycm.y pN1biyyyMetastasisyiny1ytoy3ylymphynodes,yanymoreythany0.2ycmyandyallylessythany2cm.yiny greatestydimension,ypN1biiyyyMetastasisytoy4yorymoreylymphynodes,yanyymoreythany0.2y cm.yandyalylessythany2ycm.yinygreatestydimension.ypN1biiiyExtensionyofytumorybeyondy theycapsuleyofyaylymphynodeymetastasisylessythany2ycm.yinygreatestydimension.ypN1bivyyy Metastasisytoyaylymphynodey2ycm.yorymoreyinygreatestydimension. Metastasisytoyipsilateralyaxillaryylymphynodesythatyareyfixedytoyoneyanotheryorytoyothery structures. Metastasisytoyipsilateralyinternalymammaryylymphynode(s).
TXyyyyyyyyyyy TOyy
2. Stage Grouping
Stagey0 Stagey1 StageyIIA StageyIIB StageyIIIA StageyIIIB StageyIV Tis T1 T0yT1yT2 T2yT3 T0yT1yT2yT3 T4yAnyyT AnyyTyy NO NO N1yN1*yNO N1yNO N2yN2yN2yN1,yN2 AnyyNyN3 AnyyNyy MO MO MOyMOyMO MOyMO MOyMOyMOyMO MOyMO M1
Tis*yCarcinomayinysitu,yintraductalycarcinoma,ylobularycarcinomayinysituyoryPagetsydiseaseyofytheynippleywithynoytumor T1yyyy Tumory2ycmyorylessyinygreatestydimension.yT1ay0.5ycmyorylessyinygreatestydimension.yT2by moreythany0.5ybutynotymoreythany1ycmyinygreatestydimension.yT1cymoreythany1ycmybuty notymoreythany2ycmyinygreatestydimension. Tumorymoreythany2ycmybutynotymoreythany5ycmyinygreatestydimension. Tumorymoreythany5ycmyinygreatestydimension Tumoryofyanyysizeywithydirectyextensionytoychestywallyoryskin.yT4ayExtensionytoychestywall.y T4byEdemay)includingypeauydyorange)yoryulcerationyofytheyskinyofytheybreastyorysatellitey skinynodulesyconfinedytoytheysameybreast.yT4cyyyyBothy(T4ayandyt4b)yT4dyyyyInflamantoryy carcinoma.
T2 T3yyyyyyyyyyy T4**yyyyyyyyyy
NOTE: The prognosis of patients with pN1a is similar to that of patients with pN(1)
98
99
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Histopathologic Type. The histologic types are the following: Cancer, NOS (Not otherwise specified): Ductal Intraductal (in situ) Invasive with predominant Intraductal component Invasive, NOS (not otherwise specified) Comedo Inflammatory Medullary with lymphocytic Infiltrate Mucinous (colloid) Papilary Tubular Other Lobular In situ Invasive with predominant in sit Component Invasive Nipple Pagets disease, NOS (not otherwise specified) Pagets disease with intraductal Carcinoma Other Histopathologic Grade (G) GX Grade cannot be assessed G1 Well-differentiated G2 Moderately well-differentiated G3 Poorly differentiated G4 Undifferentiated Treatment for Locally Advanced Breast Cancer y Locally advanced breast cancer refers to the following Primary Tumor (T) definition in the TNM Staging System: T4* Tumor of any size with direct extension to chest wall or skin T4a Tumor of an extension to chest wall T4b Edema (including peau dorange) or ulceration of the skin of breast or satellite skin nodules confined to same breast.
100
ribs, inter-coastal muscles, and serraus anterior but not pectoralis) y It must be noted that in patients with locally advanced breast cancer, there is high probability that distant metastasis is present, even though it is still clinically undetected, and even in the occasional patient with negative axillary nodes. A combination of locoregional and systemic treatment should be given. y The loco-regional control of T4 lesions poses a distinctly therapeutic problem in breast cancer. Such tumors cause a great deal of discomfort and inconvenience among otherwise healthy individuals, often getting in the way of a productive and meaningful life. If improperly and inadequately treated, local recurrence is quite frequent, posing greater therapeutic problems. The treatment objective is the eradication of loco-regional disease. Whatever treatment combination and sequence is used, principles of cancer cell biology should be considered. An important principle is that both radiotherapy and chemotherapy are most effective, safe and efficient when dealing with a low total tumor mass. y For large and bulky T4 lesions, it is expecting too much from radiotherapy and chemotherapy, by themselves to eradicate all cancer cells. Surgery is still the better bulk exterminator. Whenever possible, and when safety and technical considerations allow, surgical excision should be the mainstay of loco-regional control. Systemic chemotherapy is necessary for the local as well as expected systemic disease. Radiotherapy is likewise important and can be given before and or after surgery. Treatment for Breast Cancer y Surgery remains to be the most widely acceptable modality of treatment for breast cancer.
mastectomy or lumpectomy or segmentory with auxiliary lymph node dissection plus comprehensive radiation therapy, which decreases the likelihood of local recurrence substantially. The selection depends on the extent of the primary lesion and therefore the cosmetic result, probability of multifocal disease pathologic features and last but not least, the wishes of the patient.
Stage III cleansing modified radical
on a widely tested CMF combination (cyclophosphamide, methotrexate, and 5-fluroiracil) given through 6 cycles. Although doxorubicin containing combinations have shown higher response rates than CMF in patients with advanced cancer, their use in the adjuvant setting is more for high risk, particularly premenopausal patients.
Adjuvant radiotherapy can be employed in
mastectomy is done if still operable followed by systemic chemotherapy and radiation therapy. y Radiation therapy after lumpectomy calls for meticulous techniques to include the entire breast, underlying pectoralis muscle, chest wall and the intercostals lymphatics. If the axillary nodes are positive for metastasis, the axillary supraclavicular and internal mammary nodes are also irradiated. Irradiations for patients after modified radical mastectomy (MRM) must be carried out with justification and the technique is similar to that used after lumpectomy. Primary radiation therapy is given to patients who refuses surgery and chemotherapy or when both modalities are medically contraindicated. y Axillary Nodal Sampling. The presence or absence of metastasis to the axillary nodes continues to be the most powerful influence on survival following treatment or curable breast cancer. Furthermore, knowledge on this prognostic variable is readily available, either from the mastectomy specimen, or by means of axillary nodal biopsy. y Postmastectomy Adjuvant Chemotherapy for Negative Axillary Node. The value of postmastectomy adjuvant chemotherapy for patients with axillary nodal spread is well established although the benefit derived seems to be more significant among premenopausal women.
order to reduce local recurrence. However it should be realized that in these patients radiotherapy is primarily concerned with preventing loco-regional recurrence and is not a substitute for chemotherapy which is concerned with eradicating systemic disease.
Cervical Cancer
y Detection. Any patient with a suspicious clinical lesion or a smear showing suspicious or neoplastic cells must have a definite tissue diagnosis before treatment can be given y Clinical Evaluation. For patients with histopathological findings indicating cervical cancer, a complete evaluation, including clinical staging, must be done as soon as possible. The results of each patients biopsies, x-rays and other tests, as well as a formal case summary should always be sent to the referral center. Clinical evaluation of all cervical cancers should be done by gynecologist in the referral hospital. In addition to the careful physical examination, chest x-ray, IVP, cytoscopy, photoscopy should be used as appropriate to define the stage. y Treatment. Treatment of invasive cervical cancer should be based on the clinical stage and surgical risk involved. This may be in the form of radical hysterectomy in early cases with good surgical risk or radiotherapy in advanced cases or in early cases with poor
101
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Diabetes Mellitus
Figure 7. Algorithm for Diabetes Mellitus
N0
N0
- Medical history of cardiovascular disease or CVA - History of smoking (# of sticks per day / duration) - Physical activity - Use of medication - Alcohol intake (amount / duration) USING RISK ASSESSMENT QUESTIONNAIRE
surgical risk. These must be done at a referral center with gynecological oncologist and radiotherapy facilities. y Radiation Therapy is used to damage the cancer cells so they cannot reproduce. The two types of radiation therapy are: Intracavitary Radiation Therapy. The client is hospitalized for a few days while a tiny metal cylinder containing a radioactive element is palced in or near the affected organ or tissue. This technique does not harm the surrounding tissue.
External beam radiation therapy. A
Investigation, if warranted - FBS - Lipid profile (TC, LDL, HDL) - Serum Creatinine - ALT
are injected into the body to change some cells activities and slow down or stop cancer growth.
Surgery. This is the surgical removal of the
High Risk Lifestyle Modification and treat accordingly Lifestyle Modification and treat accordingly
No
Yes
cancerous tissue or organ, like the uterus or ovaries. If a womans uterus is surgically removed by hysterectomy, she will never be able to bear children because there will be no place for them to grow.
Freezing Cancer Cells. This is another
The following are the values for the diagnosis of DM and other categories of hyperglycemia: Table 10. Categorization of Diabetes Mellitus Categories Plasma Venous Glucose mmol/L (mg/dl)
>y7.0y(126) >y11.1y(200)y
radiation beam is directed at the cancer. This treatment is done on an outpatient basis, and is usually given 5 days a week for several weeks.
Chemotherapy. This uses anti-cancer drugs
treatment for cervical cancer by freezing the cancer cells, and sending an electric current through them. y Follow-up. Cervical cancer can begin to develop at any time after a woman has become sexually active. A single cervical smear may be erroneously interpreted as negative even if it pre-malignant or if invasive disease exists. Therefore, all women should be systematically followed up. Continuing patient and community education are necessary to ensure good compliance with follow-up.
y When taken in isolation, blood glucose levels are not useful for the classification of diabetes. Even ketoacidosis considered as the hallmark of Type 1 diabetes, sometimes occur in Type 2. If there is uncertainty in diagnosis, a provisional classification should be made and reassessed after initial response to therapy.
Type 1: Usually called juvenile diabetes
DiabetesyMellitus yy fastingyand/ory2yhourypostyglucosey load/casual ImpairedyGlucoseyTolerancey(IGT) yy Fastingyconcentrationy(ifymeasured)y andyy2yhouryglucoseyload ImpairedyFastingyGlycemiay(IFG) yy fastingyandy2yhouryglucoseyloady(ify measured) 5.6yy6.9y(100-125) <y7.8y(140) y<y7.0y(126) 7.8yy11.0y(140-199)
that circulate throughout the body. These drugs can reach and kill cancer cells in the original growth and those that may have broken off and moved elsewhere in the body. In the process of killing the cancer cells, the drugs also kill some healthy cells. This causes side effects like weakness,
102
because it occurs most frequently in children. It is an autoimmune disease- the body is unkind enough to react against a vital part of itself, namely the beta cells of the pancreas. This will lead to the destruction of the beta cells and cause absence of insulin. Because of the lack of insulin, these patients can develop ketoacidosis.
103
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
although in recent years, more and more young individuals are getting it. Symptoms appear more gradually compared to Type 1. Patients are more likely to be overweight and obese. Type 2 diabetes runs in families. It is hereditary. Those with Type 2 diabetes are insulin-resistant, meaning their bodies resist the normal healthy functioning of insulin. This insulin-resistance combined with not enough insulin to overcome insulin resistance causes Type 2 diabetes. y Drugs. Sulphonylureas and glinides directly stimulate insulin secretion, while thiazolidinediones and metformin improve insulin sensitivity.
Metformin: It is recommended as the first
down carbohydrate absorption from the jejunum, and hence decrease postprandial blood glucose, and to a lesser degree fasting glucose, thus improving overall glycemic control. They have a weight-reducing effect, and can be used as first line therapy in association with diet, or in combination with sulphonyureas, metformin and insulin.
Glinides. These are a new generation
of sulphonylurea-like agents. They may be used as monotherapy or in combination therapy with biguanides or thiazolidinediones. They resude postprandial hyperglycemia, hence have to be taken with each meal.
Combination Oral Therapy. Metformin,
Increase dose of 1st agent and/or any of the two with SU and AGI inc. dose of SU SU + Metformin SU + TZD SU + AGI SU + Metformin + TZD
line therapy for obese and overweight patients, and is recommended as the first-line therapy among the non-obese patients in some countries. It is the only hypoglycemic agent that has been shown to reduce CVD. It does not cause hypoglycemia or weight gain but often leads to troublesome gastrointestinal side effects which are frequently dose-dependent.
Sulphonylureas. They stimulate insulin
suplhonylureas, thiazolidinediones and a-glucosidase inhibitors may be used in various combinations with each other or with insulin when treatment targets are not achieved. Combination therapy capitalizes on the complimentary modes of action of the different drug classes. There is some evidence to show that the use of combination therapy is superior to monotherapy in terms of glycemic control, with no increase in side effects.
Insulin. Insulin is often needed to achieve
Sufonylureas
Uncontrolled
secretion by the beta cells and lower HBA1c by 1-2%. They usually lead to weight gain, and can cause hypoglycemia especially among the elderly and those with renal or liver disease. Hence, they must only be used as second or third hand line agents.
Thiazolidinediones. They improve insulin
Insulin therapy
sensitivity by improving cellular response to insulin action. However, they do not enhance insulin production. They decrease HBA1c by 1-2% and do not cause hypoglycemia. One of the common side effects is weight gain, fluid retention may also occur, and may precipitate cardiac failure among those with pre-existing heart disease. Alpha-Glucosidase Inhibitors. They slow
104
good glycemic control, and should be considered for all patients on maximum oral therapy whose HBA1c is > 6.5 %. Early treatment of insulin should be strongly considered when unintentional weight loss occurs at any time during the course of diabetes, including at the time of diagnosis. Insulin is administered SC wither through a syringe or pen. The following are several forms of insulin: rapid-acting insulin analogues short-acting regular insulin intermediate-acting insulin premixed insulin long acting insulin analogues
HBA1C=9%
Overweight? N Underweight
Yes
Uncontrolled
Any of the above + Insulin Beyond this refer to diabetes center or diabetologist Uncontrolled
105
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
on the level stop for breath after walking about 100 yards or after a few minutes on the level breathless to leave the house or breathless on dressing or undressing emphysema or chronic bronchitis or COPD diagnosed by a doctor y Diagnose CURRENT ALLERGIC RHINITIS If yes to any of the following: a. sneezing in the last 12 months b. runny nose in the last 12 months c. blocked nose in the last 12 months y If yes to the above three, and yes to nose problem accompanied by itchy-watery eyes in the last 12 months, this constitutes allergic conjunctivitis rhinitis. 2. Final Diagnosis This is based on Spirometry Testing or documentation of Peak Expiratory Flow Measurement (PEF) Asthma (current asthma) COPD (confirmed with spirometry) Allergic Rhnitis (current allergic rhinitis) Other diseases (respiratory and nonrespiratory) y None Spirometry: done to determine the degree of obstruction and client can be categorized as having restrictive, obstructive or mixed pattern of ventilatory defect. Spirometric values though vary with age, height, sex and race. Airway obstruction is evident if the FEV 1 is reduced to < 80 % of predicted values. Peak Expiratory Flow (PEF) Meters: allow repeated measurements at home and useful in documenting the variability of airflow obstruction, particularly when daytime values are normal. y y y y
a. Fit disposable mouthpiece to peak flow meter b. Ensure patient stands up and holds peak flow meter horizontally without restricting movement of the marker. Ensure that the marker is at the bottom of the scale. c. Ask patient to breathe in deeply, seal lips around mouthpiece and breathe out as quickly as possible. d. Record the result. Repeat Steps 2-4 twice more. Choose the highest of the three readings and compare with predicted values e. Remind children to blow out through the meter rather like blowing out candles on a birthday cake Diagnosis of CRD in Children 6 7 years old 1. Diagnose ASTHMA if yes to any of the following: Ever asthma: if yes to a Current Asthma: if yes to any from b to e Current severe asthma: if yes to d Current exercise induced asthma: if yes to e Diagnosed Asthma: If yes to f a. wheezing or whistling in the chest at any time in the past b. wheezing or whistling in the chest in the last 12 months c. with frequent wheezing in the last 12 months d. severe wheezing limiting childs speech to only one or two words at a time between breaths in the last 12 months e. . sounded wheezy during or after exercise in the last 12 months f. asthma ever diagnosed by a doctor in the last 12 months 2. Diagnose ALLERGIC Current RHINITIS if yes to any of the following: a. sneezing in the last 12 months b. runny nose in the last 12 months
c. blocked nose in the last 12 months Note that if the above three are yes, and has nose problem accompanied by itchy-watery eyes in the last 12 months, this constitutes allergic conjunctivitis rhinitis Drugs The CONTROLLER medications include the following group of drugs with examples that are available in the country: y Corticosteroids oral formulations: Prednisone, Prednisolone inhaled formulations: Beclomethasone, Budesonide, Fluticasone y Non-steroidal anti-inflammatory agents sodium cromoglycate nedocrimil sodium y anti-allergic agents ketotifen y long-acting and sustained release bronchodilators oral formulations: Bambuterol, sustained release formulation of short acting beta 2-agonist (salbutamol, terbutaline) and theophyllines The RELIEVER medications include the following sub-classifications with examples that are available in the country y Short-acting bronchodilators beta-2 agonists: Fenoterol, Clenbuterol, procaterol, Metaproterenol, Sulbatumol, Terbutaline, Pirbutero Non selective beta-agonist: Isoprenaline, Epinephrine (with alpha stimulation effect as well) Anti-cholinergic drugs: Ipatropium bromide (inhaled only) Atropine y Systemic corticosteroids (used in high doses as
107
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
pulse therapy lasting for a few days) oral formulations: Prednisone, Prednisolone parenteral formulations: Hydrocortisone y Management of Exacerbations. The overall objective in managing asthma exacerbations is rapid relief of symptoms and prevention of asthma death. Pay particular attention to subgroup of patients who are particularly prone to life threatening asthma. These patients should be watched carefully since their conditions can quickly deteriorate. The following are their characteristics: current use of or recent withdrawal from systemic corticosteroids hospitalization for asthma in the past year emergency room visit for asthma in the past year prior intubation for asthma psychiatric disease or psychosocial problems non-compliance with anti-asthma medication plan
All patients should have a written action
defined
prolonged symptoms prior to emergency
COPD
yy onsetyinymidlife yy symptomsyslowlyy progressive yy longysmokingyhistory yy dyspneayduringyexercise yy largelyyirreversibleyairflowy limitation
Asthma
yy onsetyearlyyinylifey(ofteny childhood) yy symptomsyvaryyfromydayytoyday yy symptomsyatynight/earlyy morning yy Allergyyrhinitisyand/oryeczemay alsoypresent yy Familyyhistoryyofyasthma yy Largelyyreversibleyairflowy limitation
room consultation
inadequate access at home to medical care
pharmacologic classes may improve efficacy and decrease the risk of side effects compared to increasing the dose of a single bronchodilator y Glucocorticosteroids Regular treatment with inhaled glucocorticosteroids does not modify the long term decline in FEV1 but has been shown to reduce the frequency of exacerbations and thus improve health status for symptomatic patients with an FEV1 < 50% predicted and repeated exacerbations Long term treatment with oral glucocorticosteroids is not recommended y Vaccines - Influenza vaccines reduce serious illness and death in COPD patients by 50% y Antibiotics - Not recommended except for treatment of infectious exacerbations and other bacterial infections y Mucolytic agents - Patients with viscous sputum may benefit from mucolytics but overall benefits are very small. Use is not recommended. y Antitussives - Regular use contraindicated in stable COPD
and medications
difficult home conditions difficulty in obtaining transport to hospital
in the event of further deterioration ICU admission is recommended if in addition to the criteria of admission is that the response to the initial therapy is poor, the patients sensorium has deteriorated, and there is evidence of impending respiratory arrest; Upon discharge, the patients action plan must be re-explained and maintenance therapy must be well understood. Trigger avoidance must be re-emphasized.
COPD
y Stages of COPD Stage I: Mild COPD - Mild airflow limitation (FEV/FVC < 70%; FEV1 >/= 80% predicted) and sometimes, but not always, chronic cough and sputum production. Stage II: Moderate COPD - Worsening airflow limitation (FEV1/FVC < 70%; 50% </= FEV1 < 80% predicted) with shortness of breath typically developing on exertion Stage III: Severe COPD - Further worsening of airflow limitation (FEV1/FVC < 70%; 30% </= FEV1 < 50% predicted), greater shortness of breath, reduced exercise capacity, and repeated exacerbations which have an impact on patients quality of life. Stage IV: Very severe COPD - Severe airflow limitation (FEV1/FVC < 70%; FEV1 < 30% predicted) or FEV1 < 50% predicted plus chronic respiratory failure. Patients may have Very Sever (Stage IV) COPD even if the FEV1 is > 30% predicted, whenever this complication is present. y Differential Diagnosis
plan on how to recognize and grade the severity of the exacerbations and what to do next. The intensity of the treatment will depend on the initial severity score, the degree of response to initial therapy, and the presence or absence of factors associated with asthma deaths. Emergency Room Treatment of Asthma Exacerbations. There is a need for the emergency room officer to make a rapid diagnosis and institute immediate treatment of asthma in the ER. A chest x-ray may be indicated in some instances to rule out pneumothorax. The intensity of treatment will depend on the severity score on arrival, the degree of response to initial therapy, and the presence or absence of factors associated with asthma deaths; With ward admissions, the following are the recommended criteria for admitting patients to the regular rooms or wards: inadequate response to therapy within 1-2 hours persistent PEF < 50 % after 1 hour of treatment
y Bronchodilators are central to symptom management in COPD Inhaled therapy is preferred Give as needed to relieve intermittent or worsening symptoms, and on a regular basis to prevent or reduce persistent symptoms The choice between beta2 agonists, anti-cholinergics, methylxanthines, and combination therapy depends on the availability of medications and each patients individual response in terms of both symptom relief and side effects Regular treatment with long-acting bronchodilators is more effective and convenient than treatment with shortacting bronchodilators
108
109
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Palliative Care
List of Drugs For Cancer Pain Relief Category Parent Drug Drug Formulation Alternatives Drug Formulation
YES
NO
NA
Non-opioids
Tablet,y325,y650ymg Tablet,y250,500ymg Tablet,y200,400,y600ymg Tablety(immediatey release):yy10,y20,y30,y50y mg. Tablet,y(sustainedy release):yy10,y20,y30,y60,y 100ymg Injection,y16ymg/ml
Strongyopioids
morphine
OpiodyAntagonist
Anti-depressants Anti-convulsants Cortico-steroids
Naloxone
Amytriptyline Carbamazephine Predisolone
Injection,y4ymg/ml
Tablet,y12.5ymg Tablet,y200ymg Injection,y40ymg/ml Prednisone Tablet,y5ymg. Imipramine Tablet,y25ymg
Dexamethasone
Tablet,y0.5,y0.75ymg
110
111
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Activity
2. Non-modifiable Risk Factors yyyyyyyyyyyy a.y Doesytheyserviceyprovideryscreenyclientsyforynon-modifiableyriskyfactorsybyyobtainingytheyfollowingy questions:yyyyyyyyyyyyy (1)y ageyinyyearsyyyyyyyyyyyyyy (2)y sexy(maleyoryfemale)yyyyyyyyyyyyyy (3)y FamilyyHistoryyfor:yyyyyyyyyyyyyyy y hypertensionyyyyyyyyyyyyyyyyy y cardiovascularydiseasesyyyyyyyyyyyyyyyyyy y diabetesymellitusyyyyyyyyyyyyyyyy y asthmayyyyyyyyyyyyyyyyy y canceryyyyyyyyyyyyyy C. Service Provider Promotes/Reinforces Positive Health Practices 1. Diet and Nutrition yyyyyyyyyy a.y Doesytheyserviceyproviderypromoteytheyfollowingymessagesyonyproperynutritionyandydiet?yyyyyyyyyyyyy yy Eatingyaycompleteydietyaccordingytoyonesyage,yheight,yweight,ytypeyofyphysicalyactivityyandy physiologicalyconditionyisygoodyforyhealthyyyyyyyyyyyyy yy Completeydietymeansyeatingyayvarietyyofyfoodyfromyeachyfoodygroupyatytheyrightyamountyneededybyy theybodyytoymaintainyoptimumyhealthyandynutritionyyyyyyyyyyyyy yy Eatingytheyrecommendedydailyyrequirementsyforydietaryyfiberyy(3yservingsyofyvegetablesyandy2y servingsyofyfruits)yyyyyyyyyyyyy yy Toypreventylifestyleyrelatedydiseases,yityisyrecommendedythatydietyincludesyliberalyamountyofy vegetablesyandyfruitsy(>y5yservingsyperyday)yandyreduceytheyamountyofysalt,ysugaryandyanimal/ saturatedyfatyyyyyyyyyyyyy b.y Doesytheyserviceyproviderypromoteymessagesythatycorrelateyeatingyhabitsyandypreventionyofydiseases? yy Reducingysaltyandyanimal/saturatedyfaty(fatsythatysolidifyyatyroomytemperature)yintakeypreventsy hypertensionyyyyyyyyyyyyy yy Reducingysugaryandyanimal/saturatedyfaty(fatsythatysolidifyyatyroomytemperature)yintakeypreventsy obesityyandydiabetesyyyyyyyyyyyyy yy Increasingyconsumptionyofyfruitsyandyvegetablesypreventsycanceryandycardiovascularydiseasesyyyyyyyyyyyyy c.y Doesytheyserviceyproviderypromoteydietyinyrelationytoyphysicalyactivity?yyyyyyyyyy yy Amountyofyfoodyintakeyamongychildrenyandyelderlyyareylessycomparedytoyadolescentsyandyadultsyyyyyyy yy Toymaintainyidealybodyyweight,ytheyamountyofyfoodyconsumedyshouldybeyproportionateytoylevelyofy physicalyactivityyyyyyyyyyyyyy yy Sedentaryyindividualsyshouldyconsumeylesyamountyofyfoodythanythoseywhoyareyphysicallyyactiveyyyyyyy 2. Physical Activity yyyyyyyyy a.y Doesytheyserviceyproviderypromoteytheyff.ymessagesyonyphysicalyactivity?yyyyyyyyyyyyyyy yy Beyactiveyinyasymanyywaysyasyyouycanyyyyyyyyyyyyyy yy Putyatyleasty30yminutesyofymoderateyphysicalyactivityypreferablyyeveryday.yThisywillyprovideyyouy withymanyyhealthyandywellnessybenefits.yyyyyyyyyyyyy yy Moderateyphysicalyactivityyisyanyyactivityyequalyinyintensityytoyaybriskywalkyyyyyyyyyyyyyyyyyyyyyy yy Foryextrayhealthybenefityandyfitness,yengageyinymoreyvigorousyphysicalyactivitiesyforyatyleasty20y minutes,y3ytoy4ytimesyayweekyyyyyyyyyyyyy yy Vigorousyphysicalyactivitiesyareythoseythatymakeyyouyhuffyandypuffyyyyyyyyyyyyyy yy Forythoseywhoyhaveyhealthyproblemsyorypreviouslyysedentary,yconsultyyouryphysicianybeforeyyouy engageyinyvigorousyphysicalyactivitiesyyyyyyyyyyyyy yy Regulate/reduceyamountyofyTVyforychildrenyandyadultsyyyyyyyyyyyyyyyyy yy Encourageyactiveyplayyinychildrenyyyyyyyyyyyyyy
YES
NO
NA
Activity
3. Alcohol Use yyyyyyyyyyy Doesytheyserviceyproviderypromoteytheyff.yhealthymessagesyonyalcoholyuse?y yy alcoholyabuseyisybadyforyhealth yy seekyprofessionalyhelpyifyyouyhaveydifficultyycontrollingyyouryalcoholyconsumptionyyyyyyyyyyyyyy 4. Tobacco Use yyyyyyy Doesytheyserviceyproviderydiscourageysmokingywithytheyfollowingymessages?yyyyyyyyyyyyyyyyyyyyyy yy Dontysmoke.yIfyyouydo,yQuitynowyyyyyyyyyyyyy yy Smokingykills.yHalfyofylongytermysmokersydieyfromysmoking-relatedydiseasesyyyyyyyyyyyyyyyyyyyy yy Dontysmokeyespeciallyywhenythereyareychildrenyandyotherypeopleyaroundyyyyyyyyyyyyyy yy Everyycigaretteysmokedycutsyatyleasty5yminutesyofylifeyonyaverage.yyyyyyyyyyyyyy yy Smokingyisytheyprimeyfactoryinyheartydisease,ystrokeyandychronicylungydisease:yyycausesycanceryofytheylungs,y larynx,yesophagus,ymouth,yandybladder;ycontributesytoycanceryofytheycervix,ypancreasyandykidneysyyyyyyyyyyyyy yy Youycanyquitysmokingyyyyyyyyyyyyyy yy Seekyhelpyifyyouywantytoystopyyyyyyyyyyyyyy D. 1.y yy yy yy yy yy yy yy yy yy Service Provider Counsels the Client (on Risk Factors) Doesytheyserviceyproviderycounselytheyidentifiedyat-riskypatientsyinytheyfollowingymanner:yyyyyyyyyyyyyyyy Establishesygoalyofytheysessionywithyclientyyyyyyyyyyyyy Asksytheyquestionsytoyelicitymoreyinformationynecessaryyinytheyassessmentyofyriskyfactorsyrelativeylifestyle?yyyyy Sharesywithyclientyidentifiedyriskyfactorsyyyyyyyyyy Discussesywithyclientytheyneedytoydoysomeychangesyinylifestyleyrelativeytoyidentifiedyriskyfactors?yyyyyyyyyyyy Makesyaycontractywithyclientytoydoysomeychangesyinylifestyleyrelativeytoyidentifiedyriskyfactors?yyyyyyyyyyyy Reinforcesyclientsypositiveyhealthypracticesyyyyy Demandsycommitmentyfromytheyclientyyyyyyyyyyy Providesyfollow-upysupportyyyyyyyyyyyyy Statesycorrectlyyappropriateymessagesyforyspecificylifestyleyatyriskyyyyyyyyyyyyyy
YES
NO
NA
2.y Doesytheyserviceyproviderycounselytoyidentifiedyat-riskyclients?yyyyyyyyyyyyyy a.y Overweight/Obesityyy yy reduceyweightyyyyyyyyyyyyyy yy increaseyamountyofyphysicalyactivityyyyyyyyyyyyyy yy increaseyintakeyofyhighyfiberydiet:ywater,yfruits,ylegumes,yvegetables,ywholeygrainycereals,yleany meat,yfishyyyyyyyyyyyy yy limityintakeyofysugar,ysaltyandyfatyyyyyyyyyyyyyy yy avoidyhighycaloricylowynutrientyvalueyandypreservedyfoody(e.g.yjunkyfoods,yinstantynoodles,ysofty drinks,yetc.)yyyyyyyyyyyyy yy seekytheyhelpyofyaynutritionist-dietitianyforyaymoreypreciseydietyyyprescriptionyyyyyyyyyyyyyyyyyyy b.y PhysicalyActivityyyyyyyyyy yy increasesyphysicalyactivityyyyyyyyyyyyyyy yy evaluatesytypeyofyactivityybeingydoneyeverydayyandystartymodifyingythemytoyincludeymorey instancesyofyphysicalyactivitiesyyyyyyyyyyyyy yy startsywithyaywalkingyregimenyforyatyleasty30yminutesydailyyyyyyyyyyyyyyy yy moderateyphysicalyactivityyofyatyleasty30yminutesymostydaysyofyytheyweekyyyyyyyyyyyyyyyyyyyyy yy integratingyphysicalyactivityyandyexerciseyintoyregularydayytoydayyactivitiesyyyyyyyyyyyyyyyyyyy c.y Smokingyyyyyyyy yy advisesytoystopyimmediatelyyyy yy assistypatientyusingysmokingycessationytechniques.yyyyyyyyyyyyyy d.y AlcoholyAbuseyyyyyyyyyyyy yy assistypatientytoyseekyprofessionalyhelpytoystopyalcoholyabuse
112
113
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
Activity
E. Service provider refers clients in need for further evaluation/ management yyyyyyyyyyyyyy DoesytheyserviceyprovideryreferyclientsyinyneedyforyfurtheryevaluationyandymanagementytoyappropriateyHLy practitioner/specialist?yyyyyyyyyyyyy F. Service provider Schedules Follow-Up Visits yyyyyyyyyyyyyy Doesytheyserviceyproviderydiscussywithytheyclientytheyscheduleywhenyhe/sheywillybeyexpectedytoyreturnyfory follow-up?yyy
YES
NO
NA
MD
RN
MW
BHW
BNS
Others
2.y diabetesymellitus
y history y fastingybloodysugar y oralyglucoseytoleranceytest
3.y cancer
y self-breastyexamination y nineywarningysignsyofycancer
4.y COPDyandyasthma
y history y useyofypeakyflowymeter
D. Educate clients on health promotion and risk factor modification 1.y Stateybasicyinformationyneededybyyclientsyforyhealthypromotionyandyrisky factorymodification.
y sevenywaysytoyayhealthyyheart
114
115
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
References
COMPETENCIES
y proper/rationalynutrition y benefitsyofyphysicalyactivity y harmfulyeffectsyofysmokingyandyalcohol
MD
RN
MW
BHW
BNS
Others
References
Baltazar, J. (2005) Final report: An assessment of the pilot project on integrated community-based noncommunicable disease prevention and control program in Pateros and Guimaras. Department of Health, Manila. Burton, R.C. (2003). Mission Report. Regional Office for the Western Pacific, World Health Organization, Manila. Department of Health (2007). National objectives for health, Philippines 2005-2010. National policy on the implementation of an integrated noncommunicable disease prevention and control in the Philippines, Administrative Order, No. 2007, Department of Health, Manila. Department of Health (2007). The health promotion handbook. Manila. Diagnosis of chronic respiratory diseases (2007) Guimaras Provincial Health Office. Lin, Bagley and Koops (2003). Acting on Noncommunicable diseases: an advocacy guide for the Western Pacific. Regional Office for the Western Pacific, World Health Organization and School of Public Health, La Trobe University, Australia. Mbewu, A.D. (1999). Comprehensive noncommunicable disease surveillance systems in developing Countries, WHO Consultation on Future Strategies for the Prevention and Control of Noncommunicable Diseases, Geneva, 27-30 September, 1999. National Cardiovascular Disease Prevention and Control Program (1994). Manual of operations of the community-based strategy. Department of Health. National Cardiovascular Disease Prevention and Control Program (1994). Manual of operations of the hospital-based strategy. Department of Health, Manila. National Cardiovascular Disease Prevention and Control Program (1994) Manual of operations of the industry-based strategy. Department of Health, Manila. Philippine Cancer Control Program (1992) Manual of operations on lung cancer control program. Noncommunicable Disease Control Services, Department of Health, Manila. Philippine Cancer Control Program (1992). Guidelines for chemotherapy and radiotherapy: cancer care in the hospitals. Noncommunicable Disease Control Service, Department of Health, Manila. Philippine Cancer Control Program (1992), Manual of operations on breast cancer control program. Noncommunicable Disease Control Service, Department of Health, Manila. Philippine College of Chest Physicians, Council of Bronchial Asthma (1996). Philippine consensus
2.y ProvideyinformationyforyearlyydetectionyofyNCD
y breastyself-examination y cervicalyscreening y rectalyexamination y nineywarningysignsyofycancery
3.y Demonstrateybasicyskillsyin:
y interpersonalycommunicationy y basicynutritionalycounseling y formulatingyphysicalyactivityyoryexercise y techniquesyforysmokingycessation
E. Mobilize communities in the non-communicable disease prevention and control using the integrated approach 1.y Organizingysupportygroups/clubsyforyspecificygroupyofypatients 2.y UtilizingyIECymaterials 3.y Conductingyhealthyeducation/healthypromotionyprograms 4.y Modifyingyhealthyprogramsyaccordingytoycommunityyneedsyandyresources. 5.y Disseminatingyinformationyaboutyhealthyprograms 6.y Solicitingyparticipationytoyhealthyprograms 7.y Networking/linkage-buildingywithyotheryagencies/groups
116
117
3/5/10 6:32 AM
Manual of Operations: Prevention and Control of Chronic Lifestyle-Related Noncommunicable Diseases in the Philippines
report on the diagnosis and management of asthma. Philippine Journal of Chest Diseases, 4 (1), January-April, 1996. Philippine Consensus Report on Management of Asthma in Children (1999). Philippine Society of Medical Oncologists (2006). Algorithm for the management of common medical oncology problems, 2nd edition, Manila. Policy development in support of an integrated noncommunicable disease prevention and control program in the Philippines (2005). Final report. Institute of Health Policy and Development Studies, National Institute of Health, University of the Philippines, Manila. Risk assessment form and guide (2004). Pateros Municipal Health Office, Pateros, Manila. Seventh report of the Joint National Committee on prevention, detection, evaluation, and treatment of high blood pressure (JNC 7) (2003). National Institute of Health, US Department of Health and Human Services. Tuazon, J.A., Dones, L.B. and Bonito, S.R. (2003). Training manual for health workers on promoting healthy lifestyles. World Health Organization, Manila. World Health Organization (1998). Manual on the prevention and control of common cancers. Regional Office for the Western Pacific, World Health Organization, Manila. World Health Organization (2003). Social mobilization for health promotion. Regional Office for the Western Pacific, World Health Organization, Manila. World Health Organization (2005). Preventing chronic disease: a vital investment. Geneva.
118
3/5/10 6:32 AM
3/5/10 6:32 AM