Structure and Function of the Nuclear Pore Complex Cytoplasmic mRNA Export Platform

Solving the structure of the endogenous Nup82 holo-complex

We solved the structure of the endogenous native Nup82 holo-complex (Figure 1) by an integrative modeling approach that has previously allowed us and others to successfully determine the molecular architecture of numerous other large native assemblies (Sali et al., 2015). Such integrative strategies have proven to be suited for the structural analysis of large endogenous complexes such as the Nup82 holo-complex that are by nature flexible, contain unstructured regions, and are conformationally heterogeneous (Shi et al., 2015).

We measured the native stoichiometry of the purified Nup82 holo-complex by a combination of QConCAT-MS (Pratt et al., 2006) and classical Siegel and Monte biophysical measurements (Figure S1 and STAR Methods). The consensus of our analyses results in a stoichiometry of 2:2:2:2 (Nup159:Nup82:Nsp1:Dyn2), consistent with that previously measured (Gaik et al., 2015) for a truncated over-expressed version of the complex, with the exception of the Dyn2 dimer, a labile component that, unless over-expressed (Figure S1D), we found present as a single dimer in the average native complex. The morphology and dimensions of the complex were determined by negative stain electron microscopy (EM), where 4,266 particles were classified into 23 class averages (Figure S2C); a majority of these (21) showed what appears to be a single dimer of Dyn2, in agreement with a previous study (Gaik et al., 2015) and with our stoichiometry (see above), and were thus included in the calculation. Interestingly, two of the class averages seemingly presented two consecutive dimers of Dyn2 (Figure S2C, arrowheads), underscoring the previously observed heterogeneity of the complex in vivo (Gaik et al., 2015). Instead of using a highly uncertain 3D map computed via single particle reconstruction based on a heterogenous set of images, we relied on much more robustly computed 2D class averages, following a previously demonstrated procedure (Shi et al., 2014). Only the structured portions of the complex were constrained by the EM data, because we showed that the unstructured FG repeats are not revealed by negative stain EM (Figure S2D).

All components of the complex were used in the final calculation, including FG repeats to account for their excluded volume and emanating points. Protein representations were derived either from the atomic structures in the Protein Data Bank where available, or comparative models were built with MODELLER 9.13 (Sali and Blundell, 1993) based on the closest homolog with a known structure detected by HHPred (Soding, 2005) (Figure S3 and Table S1); disordered FG repeat containing regions were modeled as flexible strings of beads, guided by our recent NMR data (Hough et al., 2015). Finally, the residue-specific spatial proximity and orientation of the different subunits were determined by a comprehensive chemical cross-linking with mass spectrometry readout (CX-MS) method, using two complementary cross-linkers (Figure 2A and S2A) (Shi et al., 2014). To reduce the intrinsic ambiguity of cross-link data arising from the presence of two copies of each protein, we also analyzed a strain expressing an exogenous homolog of Nup82 (skNup82) from the yeast Saccharomyces kudriavzevii (Borneman et al., 2012) (Figure S2A and STAR Methods), whose distinct protein sequence allows crosslinks to it to be distinguished from the endogenous Nup82. We identified a total of 1,131 cross-links (Table S2) that include 662 unique DSS and 126 unique EDC cross-links from the wild type yeast strain and 343 unique DSS cross-links from the skNup82-containing complex (Figure S2A). The majority of the identified inter-molecular cross-links mapped to the coiled-coil, C-terminal regions of Nup159 and Nsp1, and the whole Nup82 and Dyn2 proteins. Few inter-molecular cross-links were found to connect to the FG regions of Nup159 or Nsp1, and none to the β-propeller domain of Nup159, strongly indicating that those domains are dynamic, peripheral and not located in proximity to the core of the complex (Gaik et al., 2015).

We computed the structure of the Nup82 complex (Figure 1) through our integrative modeling approach as implemented in the IMP program (Russel et al., 2012), using the data described above. A detailed assessment of the input data and the resulting model are shown in Table 1 and the STAR Methods. In summary, the 463 best-scoring solutions satisfy within stringent tolerances the data used to compute them. The clustering analysis of the best-scoring solutions identified a single dominant cluster of 370 similar structures. The corresponding localization probability density map represents the probability of any volume element being occupied by a given protein (Figure 1A). The 9.0 Å precision of the core structured region is sufficiently high to pinpoint the locations and orientations of the constituent proteins and domains, demonstrating the quality of the input data, including the cross-links and EM 2D class averages (Figure S4 and Table 1).

Our structure is validated by seven considerations as follows. First, the EDC and DSS cross-links are highly consistent with each other, despite different chemistries, and there is significant highly non-random clustering of both EDC and DSS cross-links into equivalent “cliques” (Figure 2A). These represent immediately adjacent regions in the complex, as validated by those cliques that coincide with known crystallographic interface regions, such as Nup159:Dyn2 (PDB: 4DS1) (Romes et al., 2012) and Nup159:Nup82 (PDB: 3PBP) (Yoshida et al., 2011) (Figure 2B); indeed, in our final calculated structure these cliques represent immediately adjacent regions in the complex. Second, those few cross-links in violation of strict distance limits in our structure are nevertheless right next to one of the cliques; they are thus consistent with the structure when locally limited flexibility is taken into account (Figures 2A and S4D). Third, mass tagging of our structure is consistent with the localization of GFP tags on both the Nup82 and Nup159 C-termini (Figure 2C). Fourth, our structure is consistent with the previously published data, including an independent negative stain 3D density map (Figure S5A) (Gaik et al., 2015). Fifth, the trimeric coiled-coil structure is recapitulated even when computed using the chemical cross-linking data alone (Figure S5C). Sixth, our structure is in agreement with SAXS profiles and ab initio shapes of Nup82 constructs spanning residues 4-220, 4-452, and 572-690 (Figures 2D and S5D-F and Table S4). Notably, the Nup82 coiled-coil (572-690) forms a kinked structure and the corresponding SAXS profile shows a monotonous increase in the Kratky plot (Figures 2D and S5F), indicating a high degree of flexibility between coiled-coil segments in solution, as would be expected for coiled-coils that form two different conformers seen in the final structure. Finally, our structure is also validated by the non-random and clustered distribution of cross-links connecting the Nup82 holo-complex to other parts of the NPC, revealing interaction sites, as described below.

Features of the Nup82 holo-complex

The C-termini of Nup82, Nup159 and Nsp1 share a common domain arrangement, formed by consecutive helical coiled-coil regions of different length, connected by flexible linkers. They assemble (together with Dyn2) to form the Nup82 holo-complex, a roughly “D”-shaped particle, which is formed by the asymmetric assembly of two compositionally identical subunits (termed subunit 1(s1) and subunit 2 (s2) in Figure 1). Each subunit consists mainly of parallel, three-stranded, hetero-trimeric coiled-coils connected by flexible linkers, consisting of a single copy of the C-termini of Nup82, Nup159 and Nsp1. However, the two subunits adopt different configurations, mainly due to the different degree of flexion of the hinges between hetero-trimeric coiled-coil segments (termed CCSs) and the relative position of the Nup82 β-propellers. Subunit 1 mainly forms the “rod” while subunit 2 forms the “loop” of the holo-complex, with both subunits contributing to the spurs (Figure 1). The CCS1^s2 and CCS2^s2 trimers constitutes the extended loop that can be observed in certain orientations of the particle (Figure 1A, left and center). The denser region of the complex is formed by trimeric parallel CCS domains that form the slightly bent, elongated central rod. Both Nup82 β-propellers are located side by side on top of the rod formed by subunit s1, with Nup82 β-propeller^s2 located in trans in a distal position from the CCS1-2^s2 loop. The two ends of the central rod are each formed by the C-terminal (spur-1) and the N-terminal (spur-2) bundles of the CCS domains. Two copies of Dyn2 form a dimer that is perpendicular with spur-2 and seems to help lock the two subunits into their asymmetric arrangement. Dyn2 also helps to orient the two Nup159 copies, so that their FG regions emanate in parallel from that end of the complex. Interestingly, the FG regions of Nsp1 also project from spur-2, forming, together with the Nup159 FGs, an intrinsically disordered plume. In agreement with prior work, the hump formed by the Nup82 β-propellers helps to lock down the C-termini of Nup159, as well as forming the attachment site for two Nup116 copies (Yoshida et al., 2011) (see below).

Structure of the Nup82-Nup84 complex assembly and the cytoplasmic mRNA export platform

To understand how the Nup82 holo-complex is associated with the whole NPC, we isolated it under conditions that preserved its interaction with other Nups (Fernandez-Martinez et al., 2012). CX-MS was used to analyze those proteins proximally associated with each of the Nup82 holo-complex's components (Table S3). Notably, most of the identified cross-links connected the spur-1 region of the Nup82 holo-complex to components of the Nup84 complex hub (Figure 3 and Table S3) (Shi et al., 2014); indeed, a direct physical connection between the Nup82 and Nup84 complexes was recently demonstrated in Chaetomium thermophilum (Kellner et al., 2016). Our data, together with our prior map of the Nup84 complex (Shi et al., 2014), crystallographic data on the Nup84 complex (Kelley et al., 2015; Stuwe et al., 2015b), and the previous map of the entire NPC (Alber et al., 2007b), were sufficient to allow us to dock the two complexes together to generate a map of the entire ~1.3 MDa, 15 protein, Nup82-Nup84 complex assembly (Figure 3A). All our solutions were similar, differing only in the degree of rotation along the Nup82 complex long axis relative to the Nup84 complex (Figure S7). The Nup82 holo-complex body associates through its spur-1 region with the Nup85/Seh1 arm on the Y-complex hub and the N-terminal side of Nup145C (Figure 3A), with the two complexes oriented orthogonally with respect to their long axis (Figure 3A). Our arrangement is supported by the tight clustering of cross-links between the Nup82 and Nup84 complexes mainly to two discrete locations, one on spur-1 and the other on a single region of the Nup85-Seh1 arm, respectively.

It has been previously shown that the Nup84 complex long axis orientation is approximately parallel to the plane of the NE in the NPC's outer ring (Alber et al.; Bui et al., 2013). Consequently, our structure reveals that the Nup82 holo-complex long axis is orthogonal to that of the Nup84 complex, forming a potential linker between the outer and inner ring. The coiled-coil bundles of the Nup82 holo-complex body form a scaffold, and their downward orientation makes it so that the FG plume in spur-2 projects from the bottom of the complex. The FG regions of Nsp1 and Nup159 would thus face the central transport channel and be adjacent to the Nsp1 FG regions emanating from the inner ring Nic96 complex (Figure 3).

Our CX-MS analysis of the higher order assembly also identified cross-links connecting other known components of the mRNA export machinery - Gle1, Nup42 and Nup116 - to the Nup82 holo-complex (Figure 3 and Table S3). The identified cross-links are fully consistent with previous work showing physical connections between some of these components, such as the C-termini of Gle1 and Nup42 (Strahm et al., 1999) and the C-terminus of Nup116 to Nup82 (Yoshida et al., 2011), indicating that our CX-MS analysis is targeting bona fide physical connections within the mRNA export machinery. In combination with published crystal structures of labile components of this machinery (Montpetit et al., 2011; Ren et al., 2010), our data allowed us to assemble a physical map of the whole cytoplasmic mRNA export platform, made of 16 different proteins (some in multiple copies, so comprising 24 subunits) and summing to ~1.8 MDa of mass (Figure 3B). The organization of the assembly reveals that the components actively involved in the mRNP remodeling process (Dbp5, Gle1, Nup159 N-terminus) and associated FG regions (Nup42, Nup116, Nup159, Nsp1) are localized around the Nup82 holo-complex and the short arms of the Nup84 complex. Remarkably, we identified 10 cross-links connecting Gle1 to the Nup82 holo-complex, delineating for the first time the position and orientation of Gle1 in the NPC, adjacent to the Nup82 holo-complex and oriented with its N-terminus towards the holo-complex hump, its middle region running parallel to spur 2, and its C-terminal and the Dbp5-interacting domain facing downwards towards the NPC central channel (Figure 3). Through its interaction with Gle1, Nup42 is also seemingly localized towards the central channel, in agreement with a recent report that showed how the FG region of Nup42 is fully functional if fused to the Gle1 C-terminus (Adams et al., 2014). Thus, in our map, both the core of the Nup82 holo-complex and the Nup84 complex form a flexible scaffold, which organizes and properly orients the two functional ends (FG regions and enzymatic activities) of the cytoplasmic mRNA export machinery.

Functional relationship between the Nup82 holo-complex and the Nup84 complex

To functionally annotate our Nup82-Nup84 complex assembly structure, we sought to investigate its relationship to mRNA export. Mutations affecting both Nup84 and Nup82 complex components have previously been shown to display characteristic mRNA export defects (Fabre and Hurt, 1997). Although the direct involvement of components of the Nup82 holo-complex in mRNA export has been long established (Fabre and Hurt, 1997), until now the association of mRNA defects with the Nup84 complex has remained unclear. Thus, to identify regions of the Nup84 complex that are most relevant for mRNA export, we analyzed a collection of truncation mutants (Fernandez-Martinez et al., 2012). The mRNA export defect of each mutant was quantified and heat-mapped into the Nup84 complex structure (Figure 4). We detected a clear hot spot mapping to the Nup85/Seh1 arm (Figure 4), different from those determined for other Nup84 complex phenotypes (Fernandez-Martinez et al., 2012). Notably, this hot spot maps to where the Nup85-Seh1 arm connects to the Nup82 holo-complex (Figure 3). This significant structure/function correlation supports the idea that the mRNA export phenotype, focused to this part of the Nup84 complex, is largely associated with a defective incorporation of the Nup82 complex into the NPC. To test this idea, we analyzed the in vivo localization of Nup82-GFP in several Nup84 complex truncation mutants affecting different parts of the Y-shaped complex. As shown in Figure 4, the Nup82-GFP construct is indeed significantly mislocalized to the cytoplasm only in mutations affecting the Nup85/Seh1 arm, while a control Nup49-GFP reporter did not show a similar behavior (Fernandez-Martinez et al., 2012). Thus, we conclude that the mRNA export phenotype found in Nup84 complex mutants is mainly the consequence of a defective or weakened incorporation of the Nup82 holo-complex into the NPC.

Conservation of the Cytoplasmic mRNA Export Platform in Opisthokonts

We tested whether or not our current structure was consistent with previous maps of the whole NPC. When the Nup82-Nup84 complex assembly is docked into our yeast NPC map (Alber et al., 2007b), the arrangement of their common components is fully consistent, as shown in Figure 5A. The Nup82 holo-complex overlaps with the localization density of Nup82, facing down into the central channel, and is in close proximity to the Nup85 arm of the Nup84 complex.

Previous attempts to align a single EM envelope for the yeast Nup82 complex to a human cryo-EM NPC map (Bui et al., 2013) led to divergent and ambiguous results (Gaik et al., 2015). However, we were able to unambiguously dock the yeast Nup82-Nup84 complex assembly into the available human cryo-EM maps (Bui et al., 2013; von Appen et al., 2015). When the Nup84 complex was aligned to the corresponding inner copy of its homolog (the Nup107-160 complex), the Nup82 holo-complex aligned with a density projecting only from the cytoplasmic ring, pointing towards the central channel (Figures 5B and 5C). It has been suggested that this protrusion might indeed represent some aspect of the Nup88-Nup214 complex, the vertebrate counterpart to the Nup82 holo-complex (Bui et al., 2013). The yeast and human alignments both support an overall conservation for certain major features of NPC architecture between fungi and metazoa, and provides further independent validation of our Nup82-Nup84 complex assembly structure. Importantly, the position of the Nup82 holo-complex FG repeat regions with respect to the whole NPC is suggestive of an organized arrangement of transport factor docking sites (see Discussion).

Structure and evolution of the Nup82 holo-complex

We present the structure of the Nup82 holo-complex and show how it assembles with the Nup84 complex and other proteins to form the 24 subunit, ~1.8 MDa cytoplasmic mRNA export platform in the NPC. Our structural analysis therefore covers close to one-third of the yeast NPC mass (Alber et al., 2007b), which is now mapped in molecular detail. Unexpectedly, the Nup82 holo-complex and its associated machinery do not form any kind of cytoplasmic filament, in contrast to how it has been pictured in the literature. On the contrary, it forms a strut that faces the central channel. The Nup82 holo-complex exhibits an unusual architecture, with two compositionally identical trimers forming an asymmetric structure. Hinges in coiled coils allow flexibility to convert two otherwise identically arranged subunits into two similar, but morphologically distinct subunits. This structural arrangement, with flexibility in the subunits permitting alternate assemblies, is reminiscent of how vesicle coating proteins form variable architectures within the same coat complex, such as the hexagonal versus pentagonal architectures observed in clathrin coated vesicles (Cheng et al., 2007). Perhaps this variability is another echo of the evolutionary origin of the NPC in an ancient coating complex (Devos et al., 2004), and may also contribute to the observed flexibility of the NPC as a whole.

Another feature shared by the NPC and its related coating complexes is the presence of compositionally distinct but structurally and evolutionarily related modules within the entire assembly that arose from ancient duplication events (Alber et al., 2007b; Devos et al., 2004; Fernandez-Martinez et al., 2012). Indeed, there is another NPC subcomplex that also uses a trimeric bundle, and appears to be homologous and evolutionarily related to the Nup82 holo-complex. We discovered this relationship through a homolog detection search using HHPred (Soding, 2005), aiming to find structures comparable to the coiled-coil regions of the three core Nup82 complex components. Remarkably, the top and highly significant hit (HHpred P-value of 4.5E-60, 3.3E-9, and 0.0053 for Nup82, Nsp1, and Nup159, respectively) was another complex from the NPC, also containing a heterotrimer of coiled-coils: the Xenopus laevis Nup93:Nup62:Nup58:Nup54 complex (Chug et al., 2015) and its Chaetomium thermophilum Nic96:Nsp1:Nup57:Nup49 complex homolog (Stuwe et al., 2015a) (Figure S3). This similarity aided in generating high confidence comparative models for our calculations (STAR Methods). The C-termini of both complexes share a common domain arrangement, formed by three consecutive helical coiled-coil regions of different lengths, connected by flexible linkers (Figure 1), and both complexes even share a common component, Nsp1. Collectively, these observations further support the idea that both complexes evolved from a single common precursor structure, providing yet another example of an ancient duplication generating now diverse modules within the NPC, as postulated by our original protocoatomer hypothesis (Devos et al., 2004).

Spatial organization of the FG repeats

A common architecture and evolutionary origin might also imply a degree of shared functionality. In the case of the Nup82 holo-complex, the coiled-coil region serves as a strut to position various transport factor docking sites out from the core scaffold and towards the central channel of the NPC, where nucleocytoplasmic exchange is mediated (Figure 6). We therefore suggest that the coiled-coil trimeric region of the homologous Nic96:Nsp1:Nup57:Nup49 complex and that of the Nup82 holo-complex perform analogous functions, namely to serve as struts for the correct positioning of transport factor docking sites along the nucleocytoplasmic axis of the central transport channel (Figure 6). Being intrinsically disordered, the FG repeat regions themselves cannot form ordered structures to span the central channel. But, by providing a semi-rigid support, the coiled-coil regions of the two complexes may act as flexible struts, placing the FG nup docking sites so that they efficiently occupy the central channel to form an effective selective barrier, perhaps such that the struts plus FG repeats together comprise the observed “central transporter” (Yang et al., 1998). Indeed, space-filling models based on size data for FG repeats (Yamada et al., 2010) (Figure 6) show that the FG regions would project from the Nup82 holo-complex in such a manner as to essentially span the NPC's central channel and essentially form the top, cytoplasmic part of the central transporter.

The Nup82 complex projects into the NPC's central channel to coordinate efficient export and remodeling of mRNPs

The FG repeats associated with the Nup82 holo-complex project from the end of the complex adjacent to the Nic96 complex, towards the midplane of the central channel (Figure 6); there, they would neighbor the Nsp1, Nup57, and Nup49 FG repeats at the equator of the NPC (Kosinski et al., 2016; Lin et al., 2016; Stuwe et al., 2015a). It is known that the relative position of FG repeats in the Nup82 holo-complex are crucial (Adams et al., 2014), and that the Mex67/Mtr2 dimer mediating mRNA export directly engages the FG repeats associated with the Nup82 holo-complex (Strasser et al., 2000; Trahan and Oeffinger, 2016) (Figure 3). Collectively, these results suggest that the type and position of FG repeats in the Nup82 holo-complex is key for an efficient mRNA export mechanism.

Surprisingly, we show that the Nup82 holo-complex does not project outward from the cytoplasmic face of the NPC, as previously assumed. Instead, it projects inwards, both radially and vertically. This arrangement has several important functional consequences. First, based on the organization of the Nup82 holo-complex, this places the associated cytoplasmically-disposed FG repeat regions in intimate contact with the symmetrically positioned FG repeat regions in the central channel, forming a continuous conduit of transport factor docking sites from the nuclear to cytoplasmic sides of the NPC. Second, this arrangement also places the mRNP remodeling machineries at the immediate cytoplasmic end of this channel (Figures 5 and 6). We suggest that the Nup82 holo-complex and Nup84 complex position these cytoplasmic docking and remodeling sites right over the central channel to efficiently capture exporting mRNP particles immediately upon reaching the cytoplasmic end of the central channel; once captured, they can be directly processed by the proximally tethered Gle1/Dbp5/Nup159N remodeling machinery, rather than requiring a transfer mechanism to previously supposed distal processing sites on cytoplasmic filaments. Third, the transport factors released during remodeling are also potentially well positioned to be recycled back into the nucleus, while the now translationally-primed mRNP exits to the cytoplasm (Figure 6). Our molecular architecture is fully consistent with proposed mRNP remodeling models (Folkmann et al., 2011; Montpetit et al., 2011), as well as with the observation that cytoplasmic release - but not translocation - is a rate limiting step during mRNA export (Oeffinger and Zenklusen, 2012). When translated into the overall NPC architecture, the presence of eight remodeling hubs surrounding the central channel ensures a highly efficient system consistent with the fast mRNA export rates observed in vivo (Grunwald and Singer, 2010; Mor et al., 2010; Smith et al., 2015). Other types of ribonucleoproteins are also actively exported through the NPC, using pathways and components that largely overlap with those of mRNA export (Nerurkar et al., 2015). It is thus reasonable to expect that our structural analysis would also serve as a framework for revealing the mechanisms governing their transit and maturation through the NPC.

While the Nup82 holo-complex is a major nexus for RNA export and remodeling processes, its human homolog when altered is also a major nexus for numerous diseases, as underscored by the fact that the mammalian orthologues of Nup82 (Nup88), Nup159 (Nup214) and Nup116 (Nup98) represent the Nups most prevalent in cancer and developmental diseases (Simon and Rout, 2014). Hence, our structure may also help rationalize the modifications in this machinery that lead to severe human diseases. For example, mutations in the human homolog of Gle1 are associated with lethal congenital contracture syndrome-1, lethal arthrogryposis with anterior horn cell disease (Nousiainen et al., 2008) and amyotrophic lateral sclerosis (Kaneb et al., 2015). We have been able to localize and orient Gle1 at the hump and spur 2 region of the Nup82 holo-complex, facing the NPC central channel (Figure 3). Our data (Table S3) also indicates that the C-terminus of Nup42 is associated with the C-terminus of Gle1 (Strahm et al., 1999), where the Nup159 N-terminal β-propellers are dynamically associated, with the Nup159 FG regions oriented towards the arms of the Nup84 complex (Figure 6), and Dbp5 physically associated with its ATPase cycle modulators Gle1 and the Nup159 β-propeller (Montpetit et al., 2011; Noble et al., 2011). Strikingly, the residues equivalent to those causing disease states in human Gle1 (Folkmann et al., 2014) all map to sites that anchor the yeast protein to either the Nup82 holo-complex or to Nup42 and Dbp5-Nup159N (Figure 6). These results, taken together with our structural and functional analyses, underscore the importance of the Nup82 complex as a hub for anchoring both the mRNA transport and processing machineries into the heart of the NPC itself, and help explain why this complex is a focus for so many developmental, oncogenic and viral diseases.

Methods and Resources

Detailed methods are provided in the online version of this paper and include the following:

• KEY RESOURCES TABLE

• CONTACT FOR REAGENT AND RESOURCE SHARING

• EXPERIMENTAL MODEL AND SUBJECT DETAILS

  • ○ Yeast strains
• METHOD DETAILS

  • ○ Affinity purification of protein complexes
  • ○ Stoichiometry of the Nup82 holo-complex
  • ○ Chemical cross-linking and mass spectrometry
  • ○ CX-MS analysis of S. cerevisiae-S. kudriavzevii Nup82 holo-complex
  • ○ Negative stain electron microscopy
  • ○ Fluorescence in situ hybridization
  • ○ Fluorescence Microscopy
  • ○ Integrative Structure Determination
  • ○ GFP mass-tagging electron microscopy
  • ○ Docking of the Nup82 holo-complex and the Y-shape Nup84 complex

• QUANTIFICATION AND STATISTICAL ANALYSIS

• DATA AND SOFTWARE AVAILABILITY

  • ○ Software
  • ○ Data Resources

CONTACT FOR REAGENT AND RESOURCE SHARING

Further information and requests for reagents may be directed to and will be fulfilled by the Lead Contact author Michael P. Rout ([email protected]).

Yeast strains

All Saccharomyces cerevisiae strains used in this study are listed in the Key Resources Table, with the exception of the Nup84 complex truncation mutants that were described in detail in (Fernandez-Martinez et al., 2012). The Nup82 complex tagged strains were constructed in a W303 (Mata/alpha ade2-1 ura3-1 his3-11,15 trp 1-1 leu2- 3,112 can1-100) background. Otherwise stated, strains were grown at 30°C in YPD media (1% yeast extract, 2% bactopeptone, and 2% glucose). The Saccharomyces kudriavzevii strain was obtained from the American Type Culture Collection (ATCC 2601) and grown in the same conditions as referred above for S. cerevisiae.

Affinity purification of protein complexes

To purify the native Nup82 complex, that we will call from now on Nup82 holo-complex (as it includes all its intact, full-length endogenous components), we constructed strains in which the NUP encoding gene was genomically tagged with a variant of the Staphylococcus aureus Protein-A, preceded by the human rhinovirus 3C protease (ppx) target sequence (GLEVLFQGPS). The sequence was introduced by PCR amplification of the transformation cassette from the plasmid pProtA/HIS5. Harvested yeast cells, grown in YPD at 30°C to mid-log phase were frozen i n liquid nitrogen and cryogenically lysed in a Retsch PM100 planetary ball mill (http://lab.rockefeller.edu/rout/protocols). A total of 10-20 g of frozen cell powder were resuspended in 9 volumes of IP buffer (20mM Hepes pH 7.4, 300mM NaCl, 2mM MgCl₂, 0.1% Tween 20, 1mM DTT). Cell lysate was clarified by centrifugation at 20,000 g for 10 minutes. IgG Ab conjugated magnetic beads (Invitrogen) at a concentration of 50 μl slurry/g of frozen powder were added to the clarified cell lysate and incubated for 30 minutes at 4°C. Beads were washed three times with 1 ml of IP buffer without protease inhibitors. The native complex was released from the affinity matrix by PreScission protease digestion in the same buffer. The recovered sample was then centrifuged at 20.000 g for 10 min. The supernatant (50-100 μl) was loaded on top of a 5-20% sucrose gradient made in IP buffer without Tween 20 plus 1/1000 of protease inhibitors. Gradients were ultracentrifuged on a SW55 Ti rotor (Beckman) at 42.000 rpm and 5°C for 17 hours. Gradients were manually unloaded from the top in 12 fractions of 410 μl. Fractions were analyzed by SDS-PAGE and R250 Coomassie or Sypro Ruby staining.

A higher order complex, containing the Nup84 complex plus several other nups, including the Nup82 holo-complex components, was identified previously (Fernandez-Martinez et al., 2012). The complex was affinity purified from a Nup84-ppx-PrA strain (Key Resources Table) as described above using as IP buffer 20mM Hepes pH 7.4, 20mM NaCl, 150mM potassium acetate, 2mM MgCl₂, 0.5% Triton-X100, 0.1% Tween 20, 1mM DTT, and processed for cross-linking and mass spectrometry analysis.

Stoichiometry of the Nup82 holo-complex

Diploid strains, carrying one wild-type and one Protein-A-tagged version of each of the major Nup82 holo-complex components were analyzed by affinity purification as described above and the identity of the bands verified by mass spectrometry (Figure S1). To determine the Stokes radius (R_s) of the Nup82 holo-complex, the natively eluted complex was run through a calibrated Superose 6 GL 30/100 column in 20mM Hepes pH 7.4, 150mM NaCl, 0.1% Tween 20 buffer, and the results plotted against reference protein standards (Ovalbumin, R_s: 3.05; Aldolase, R_s: 4.81; Ferritin, R_s: 6.1; Thyroglobulin, R_s: 8.5). The sedimentation coefficient (S_20,w) of the Nup82 holo-complex was estimated from the peak of the complex banded in sucrose gradients, run as described above, using the formula S_20,w = ΔI/(ω²*t), where ΔI is the time integral, ω the angular velocity (seconds⁻¹) and t is time (seconds) (see also (Griffith, 1994)). The mass of the holo-complex was then calculated using the Siegel-Monte equation (Figure S1A-B) (Erickson, 2009). Quantification of the relative amounts of each protein in the purified complex was performed using a synthetic concatamer of tryptic peptides or QconCAT (Pratt et al., 2006) based on the Nup82 complex components (Figure S1D). Quantotypic peptides for each of the four nucleoporins of the Nup82 complex were selected based on their mass spectrometric behavior (Nup82: 7-LSALPIFQASLSASQSPR-24, 636-NQILQFNSFVHSQK-649; Nup159: 301-TNAFDFGSSSFGSGFSK-717, 948-TSESAFDTTANEEIPK-963; Nsp1: 779-TTNIDINNEDENIQLIK-795, 806-SLDDNSTSLEK-816; Dyn2: 64-NFGSYVTHEK-73, 53-YGNTWHVIVGK-63). A synthetic gene (called Nup82 QconCAT) was designed by concatenation of the sequences encoding the referred peptides and addition of a 6xHis c-terminal tag: (MKEIRNQILQFNSFVHSQKTNAFDFGSSSFGSGFSKNFGSYVTHEKTTNIDINNEDENIQLIKLSALPIFQASLSASQSPRTSESAFDTTANEEIPKYGNTWHVIVGKSLDDNSTSLEKQINSIKHHHHHH).

The E. coli codon optimized sequence was cloned into plasmid pGEX6p-1, resulting in the expression of a protein with an n-terminal GST tag that was used both as a purification tag and sacrificial peptide (Ding et al., 2011). The Nup82-QconCAT protein was expressed by growing 300ml of BL21 E. coli cells at 37°C to OD ₆₀₀ = 0.6 in minimal M9 media (Pratt et al., 2006) supplemented with heavy arginine and lysine (L-arginine:HCl 13C6; L-lysine:2HCl 13C6, Cambridge Isotope Laboratories Inc.). IPTG (1mM) was used to induce expression of the construct for 3 hours at 37°C. Harvested cells were processed using BugBuster Extraction Reagent (Novagen) as indicated by the manufacturer. The full-length Nup82 QconCAT was then purified using a two-step method that ensures a final full-length product by consecutive purification from the n and c-terminal tags: i) Clarified soluble material was incubated with 500 μl of gluthatione sepharose 4b (GE Healthcare) at room temperature for 1 hour at 4°C, and the retained proteins eluted using 2x 1ml of elution buffer (20mM Hepes pH 7.4, 150mM NaCl, 45mM imidazole, 6M guanidinium hydrochloride, 1mM TCEP, 1/500 protease inhibitor cocktail (PIC) (Sigma)). ii) The elution volume was then passed through an equilibrated His-Trap HP (GE Healthcare) at room temperature. The retained Nup82 QconCAT was then eluted in 20mM Hepes pH 7.4, 500mM imidazole, 150mM NaCl, 6M guanidinium hychloride, 1mM TCEP, 1/500 PIC. The resulting elution was analyzed by SDS-PAGE to ensure the presence of a full-length, pure protein.

For the MS analysis, the Nup82 holo-complex was purified as described above. The gradient fractions containing the complex were collected and concentrated by centrifugation at 355,000 g for 6 hours in a TLA 120.1 rotor at 4°C. The concentrated complex was then resuspended in a final 1x Nupage LDS Sample buffer (Thermo Fisher Scientific), 10mM TCEP (Thermo Fisher Scientific). The Nup82-QconCAT was ethanol precipitated and washed to eliminate the guanidinium chloride and resuspended in 1x Nupage LDS Sample buffer, 10mM TCEP. Approximately equimolar amounts of complex and Nup82-Qconcat were combined to give a final protein amount of 1 μg. The combined sample was heated at 72°C for 10 minutes a nd then alkylated using a final concentration of 30mM iodoacetamide (Sigma). The sample was then loaded into a 4% (37.5:1) in-house prepared stacking acrylamide SDS-PAGE gel. The resulting band, containing a mixture of Nup82 complex and stable-isotopically labeled Nup82 QconCAT proteins, was excised and sequentially digested by endoproteinase LysC (Roche) and trypsin (Roche) inside gel matrix, followed by LC-MS analyses to determine L/H ratio of standard peptides. LC-MS analyses were performed on an Orbitrap Fusion Mass Spectrometer (Thermo Scientific), with an Easy-nLC 1000 HPLC (Thermo Scientific) and an Easy-Spray electrospray source (Thermo Scientific). L/H ratios of standard peptides were determined using the MaxQuant software (version 1.2.2.5) (Cox and Mann, 2008).

Overexpression of Dyn2 was performed mimicking the conditions described in (Gaik et al., 2015): the S. cerevisiae Dyn2 coding sequence was cloned into the 2-micron plasmid p424-Gal1, under the control of the Gal-1 promoter. Overexpression was achieved by growing the transformed yeast cells in yeast synthetic minimal media supplemented with 2% glucose, 1% raffinose, harvesting the cells in mid-log phase, washing them with with ddH₂O and then transferring them to yeast synthetic minimal media supplemented with 2% galactose, 1% raffinose for 3 hours at 30°C. Cells were then harvested and cryo-milled and the endogenous Nup82 holo-complex was purified as described above using Nup82-PrA as the handle. Purified complexes were run in SDS-PAGE gels, stained with Sypro-Ruby (Thermo Fisher Scientific) and the relative intensity of the different bands were quantified using ImageJ (www.imagej.net).

Chemical cross-linking and mass spectrometry

The natively eluted complex (250 μl, in buffer 1- 20mM Hepes pH 7.4, 300mM NaCl, 0.1% Tween, 2mM MgCl₂, 1mM DTT) was cross-linked via the addition of DSS-H12/D12 (DiSuccinimidylSuberate) cross-linker (Creative Molecules) to yield a final concentration of 0.25 mM and incubated for 45 min at 25°C with gentle agitation in a shaker (900 rpm). The reaction was then quenched by 50 mM ammonium bicarbonate. In the case of cross-linking using EDC reagent (Pierce), the sample was equilibrated and natively eluted in EDC cross-linking buffer (10mM BisTris pH 6.5, 100mM Nacl, 2mM MgCl₂, 0.1% Tween, 1mM DTT). EDC (20 mM) and N-hydroxysulfosuccinimide (0.4 mM) (i.e. 2% molar ratio with respect to EDC) were then added to cross-link the sample. The sample was incubated for 45 min at 25°C with gentle agitation. After cross-linking, Tris-HCl pH 8.0 (50 mM) and β-mercaptoethanol (20 mM) were added to the cross-linked sample to quench the reaction. After Cysteine reduction and alkylation, cross-linked samples were separated in a 4-12% NuPage SDS-PAGE (Invitrogen). Gels were briefly stained by GelCode Blue Stain Reagent (Thermo Fisher Scientific) to enable the visualization of the cross-linked protein complexes. The cross-linked complexes were then digested in-gel with trypsin or chymotrypsin to generate cross-linked peptides as previously described (Shi et al., 2014). After in-gel digestion, the cross-linked peptide mixtures were fractionated by peptide SEC (Superdex Peptide PC 3.2/30, GE Healthcare) by an off-line HPLC (Agilent Technologies). Two or three SEC fractions covering the molecular mass range of ~2.5 kD to ~10 kD were subsequently collected and analyzed by LC/MS. For cross-link identifications, the purified peptides were dissolved in the sample loading buffer (5% MeOH, 0.2% FA) and analyzed by a LTQ Velos Orbitrap Pro mass spectrometer or an Orbitrap Q Exactive (QE) Plus mass spectrometer (Thermo Fisher). For the analysis by the Velos Orbitrap mass spectrometer, briefly, the dissolved peptides were pressure loaded onto a self-packed PicoFrit^® column with integrated electrospray ionization emitter tip (360 O.D, 75 I.D with 15 μm tip, New Objective). The column was packed with 10 cm reverse-phase C18 material (3 μm porous silica, 200 Å pore size, Dr. Maisch GmbH). Mobile phase A consisted of 0.5% acetic acid and mobile phase B of 70% ACN with 0.5% acetic acid. The peptides were eluted in a 120 or a 140 minute LC gradient (8% B to 50% B, 0-93 minutes, followed by 50% B to 100% B, 93-110 minutes and equilibrated with 100% A until 120 or 140 minutes) using a HPLC system (Agilent), and analyzed with a LTQ Velos Orbitrap Pro mass spectrometer. The flow rate was ~200-250 nL/min. The spray voltage was set at 1.9-2.3 kV. The instrument was operated in the data-dependent mode, where the top eight-most abundant ions were fragmented by higher energy collisional dissociation (HCD) (normalized collisional energy 27-29) and analyzed in the Orbitrap mass analyzer. The target resolution for MS1 was 60,000 and 7,500 for MS2. The QE instrument was directly coupled to an EASY-nLC™ 1200 System (Thermo Fisher) and experimental parameters were similar to those of the Velos Orbitrap. The cross-linked peptides were loaded onto an Easy-Spray column heated at 35°C (C18, 3mm particle size, 200 Å pore size, and 50 micrometer X 15cm, Thermo fisher). The top 8 or 10 most abundant ions (with charge stage of 3-7) were selected for fragmentation by HCD. The raw data were searched by pLink (Yang et al., 2012a) using a FASTA database containing protein sequences of the complexes. An initial MS1 search window of 5 Da was allowed to cover all isotopic peaks of the cross-linked peptides. The data were automatically filtered using a mass accuracy of MS1 ≤ 10 ppm (parts per million) and MS2 ≤ 20 ppm of the theoretical monoisotopic (A0) and other isotopic masses (A+1, A+2, A+3, and A+4) as specified in the software. Other search parameters include cysteine carbamidomethyl as a fixed modification, and methionine oxidation as a variable modification. A maximum of two trypsin missed-cleavage sites was allowed. The initial search results were obtained using a default 5% false discovery rate (FDR) – expected by target-decoy search strategy. All spectra were manually verified. ~ 94% of the cross-link identifications have a MS1 mass accuracy within 6 ppm. The cross-link data was visualized and analyzed by the CX-Circos software (manuscript in preparation).

Chemical cross-linking and mass spectrometry analysis of S. cerevisiae-S. kudriavzevii Nup82 holo-complex

To define the relative orientation of the two copies of Nup82 present in the Nup82 holo-complex we expressed an exogenous copy of Nup82 from the yeast Saccharomyces kudriavzevii (called from now on skNup82). We selected S. kudriavzevii because it is a closely related species that forms natural hybrids with S. cerevisiae, some of them used for wine fabrication (Borneman et al., 2012), and the level of conservation at the amino acid level between both species is particularly high, ensuring functionality of the skNup82 version and enough sequence variation to identify the specific peptides from each species protein version. S. kudriavzevii strain was obtained from ATCC (ATCC 2601) and genomic DNA was prepared using standard methods. The 3’ UTR and open reading frame for skNup82 was amplified and sequenced to account for potential mutations detected in the sequence available in the public database (GenBank: EHN01740.1). The wild type verified skNup82 sequence was found to encode a 716 amino acid protein with 75% identity to the scNup82 primary sequence (alignment available upon request). The upstream 190 nucleotides (promoter) region and the gene sequence were amplified using primers skN82Prom-F(5’-CACCGAAAGTTTATAGATTCAT-3’) and skN82GTW_R2 (5’-GCTGGGCCCCTGGAACAGAACTTCCAGGCCGTTTTTTGGCTGAGTATTAGTG-3’) that introduces an in-frame prescission protease cleavage site at the end of the skNup82 coding sequence. The PCR product was cloned using the pENTR™/D-TOPO^® Cloning Kit (ThermoFisher Scientific) and then transferred to a modified pAG305GPD-ccdb-EGFP plasmid (Addgene), where the GPD promoter had been eliminated through a SacI-XbaI (New England Biolabs) cleavage and refill. The resulting integrative plasmid, pAG305-skNup82ppx-EGFP, was linearized using ClaI (New England Biolabs) and transformed into a diploid w303 S. cerevisiae strain. Successful integrations were assessed by PCR; correct expression and localization of the skNup82-EGFP construct were confirmed by western-blot and fluorescence microscopy, that showed the characteristic nuclear rim staining of a properly localized nucleoporin. Affinity purification of the Nup82 complex using skNup82-EGFP as a handle showed all the components of the native Nup82 complex, including a substoichiometric amount of scNup82, showing correct incorporation of the construct into the native Nup82 complex. The isolated, purified complex (see above for details on purification) was analyzed by CX-MS (see above).

Negative stain electron microscopy

Purified endogenous Nup82 holo-complex samples were applied to glow-discharged carbon-coated copper grids and stained with 1% uranyl formate. Images were collected on a Tecnai F20 (FEI Inc., USA) transmission electron microscope operating at an acceleration voltage of 80 kV at 50,000x magnification and underfocus ~1.5 μm. Images were recorded on a Tietz F224 4096×4096 CCD camera (15 μm pixels) at 2x binning. The pixel size at the specimen level was 3.23 Å. Particles were selected using Boxer from EMAN (Ludtke et al., 1999). The contrast transfer function (CTF) of the normalized images was determined using ctfit from EMAN and the phases were flipped accordingly. After that, the particles were subjected to Iterative Stable Alignment and Clustering (ISAC; (Yang et al., 2012b)) technique. A pixel error of 2√3 was used for the stability threshold. For comparison, the Nup82 holo-complex class averages were aligned and paired with Nsp1-FGΔ class averages or with GFP-tagged Nup82 complex class averages using the modified Spider ‘AP SH’ operation. Then the Nsp1-FGΔ class averages were subtracted from the Nup82 holo-complex class averages and the Nup82 holo-complex class averages were subtracted from the GFP-tagged Nup82 complex class averages and difference maps generated.

Fluorescence in situ hybridization

FISH on wild type and Nup84 complex truncation mutant strains was performed in 96-well plates. A 35 nucleotide long oligo dT probe (synthetized by Exiqon) and labeled post-synthesis with cy5 was used to detect poly A+ RNA [TT+TTT+TTTT+TTT+TTT+TT TT+TTT+TTT+TTT+TTT+TTTT, T+ represents locked nucleic acids (LNA). Cells were grown in SD complete at 25°C to OD 600=0.5-0.6 and fixed by the addition of para-formaldehyde at a final concentration of 4% for 45min at room temperature. Cells were washed 3x with buffer B (1.2M Sorbitol, 100mM KHPO4 pH7.5), suspended in spheroplast buffer [1.2M Sorbitol, 100mM KHPO4 pH7.5, 20mM Ribonucleoside-vanadyl complex (NEB #S1402S), 20mM β-mercaptoethanol, 25U lyticase / 1OD600 of cells (Sigma cat # L2524)] and incubated at 37°C un til cell walls were digested. Digested cells were washed 2x with cold buffer B, attached to polyA lysine (0.01%) treated 96 glass bottom MicroWell plate (MGB096-1-2-LG-L #0325289L2L) and stored in 70% ethanol at −20°C. For hybridization cells we re washed twice with 2× saline sodium citrate (SSC) and 1x 35% formamide/2× SSC. 20ng of labeled dT LNA probe was resuspended in 35% (v/v) formamide, 2× SSC, 1 mg ml⁻¹ BSA, 10 mM ribonucleoside vanadyl complex (NEB #S1402S), 5 mM NaHPO4, pH 7.5, 0.5 mg ml⁻¹ Escherichia coli tRNA and 0.5 mg ml⁻¹ single-stranded DNA and denatured at 95°C for 3 min and cells hybridized overnight in the dark at 37°C. Cells were then washed in 35% formamide/2× SSC at 37°C 2x 30 min, followed by a 1 min wash in 1× PBS at room temperature followed by the addition of DAPI containing mounting medium to each well (Prolong Gold - Invitrogen #P36935). Images were acquired using a Zeiss Z1 inverted microscope, a 100x 1.43 NA oil objective and a AxioCam mRm CCD camera and the following filter sets: Zeiss 488050-9901-000 (Cy5), Zeiss 488049-9901-000 (DAPI). Three-dimensional datasets were generated by acquiring multiple 200 nm z-stacks spanning the entire volume of cells, 3D datasets reduced to 2D datasets by applying a maximum projection function in FiJi. The polyA accumulation phenotype was quantified by determining the fraction of cells showing strong nuclear polyA accumulation. For each strain, at least 200 cells from at least 3 different fields were quantified.

Fluorescence Microscopy

Nup82 was genomically tagged with GFP on selected Nup84 complex truncation yeast mutant strains using standard techniques. Cells were grown in YPD media at 30°C and visualized with a 63x 1.4 numerical aperture plan-apochromat objective using a Carl Zeiss Axioplan 2 microscope equipped with a Hamamatsu Orca ER-cooled CCD camera. The system was controlled with Openlab imaging software (Perkin Elmer). Images were treated with ImageJ (www.imagej.net/Welcome) and Adobe Photoshop (Adobe) softwares.

Integrative Structure Determination

Our integrative structure determination of the Nup82 holo-complex proceeded through four stages (Figure S3D) (Alber et al., 2007a; Alber et al., 2007b): (1) gathering of data, (2) representation of subunits and translation of the data into spatial restraints, (3) configurational sampling to produce an ensemble of structures that satisfies the restraints, and (4) analysis and validation of the ensemble structures. The modeling protocol (i.e., stages 2, 3, and 4) was scripted using the Python Modeling Interface (PMI), version c7411c3, a library for modeling macromolecular complexes based on our open-source Integrative Modeling Platform (IMP) package, version 2.5 (http://integrativemodeling.org) (Russel et al., 2012). Further details of the integrative modeling procedures are provided in Table 1, as well as previous publications (Shi et al., 2014). Files containing the input data, scripts, and output structures are available online (http://salilab.org/nup82; https://github.com/salilab/nup82).

GFP mass-tagging electron microscopy

Two different types of GFP-tagged structures of the Nup82 holo-complex were generated by attaching a rigid-body GFP structure (PDB 1GFL) to either the Nup82 or Nup159 C-termini via the 14 linker residues of DPLALPVATPGIPM. For the Nup82 complex, the best-scoring structure was used. The configuration of the GFP tags was optimized using the replica exchange Gibbs sampling as described above using IMP. In summary, 10 independent sampling runs were performed, each run starting with a random initial configuration of the GFP tags. 4 replicas were used for each run, with temperatures ranging between 1.0 and 2.5. We produced a total of 50,000 structures each for the Nup82 and Nup159 GFP tags, using the EM 2D restraint of the corresponding immuno-EM class average. As a result, the best-scoring model structures are consistent with the localization of the GFP tags on both the Nup82 (ccc=0.953) and Nup159 (ccc=0.932) C-termini (Figure 2C).

Docking of the Nup82 holo-complex and the Y-shape Nup84 complex

A structure of the Nup82 holo-complex interacting with the Y-shape Nup84 complex was obtained by rigid-body docking restrained by 9 chemical cross-links identified at the interface (Table S3), using the replica exchange Gibbs sampling using IMP, as described above. For the Nup82 complex, the best-scoring structure was used. For the Nup84 complex, our previous structure (Shi et al., 2014) was refined by using new crystallographic structures of the complex subunits (PDB 4XMM and 4YCZ) (Kelley et al., 2015; Stuwe et al., 2015b). Next, 20 independent sampling runs were performed, each run starting with a random initial configuration. 6 replicas were used for each run, with temperatures ranging between 1.0 and 2.5. We produced a total of 100,000 structures using the cross-link restraints spanning the interface between the Nup82 holo-complex and the Nup84 complex. Subsequently, 200 top-scoring structures were subjected to the clustering analysis, identifying 3 clusters (clusters A, B, and C; 86, 70, and 44 structures, respectively) of solution structures (Figure S7A). At least 7 out of the 9 chemical cross-links were satisfied by the 200 top-scoring structures, within the distance threshold of 35 Å. All our solutions were similar, differing only in the degree of the Nup82 complex rotation along its long axis, relative to the Nup84 complex (Figure S7B). Precisions of the Nup82 holo-complex in the 3 clusters were 30.2, 11.0, and 39.0 Å, respectively.

Among the three clusters, only cluster C satisfied the cross-links used to compute them (Table S3) and the S. cerevisiae NPC localization probability density map (fit score by overlapping volume = 0.46, Figures 5A and S7C) (Alber et al., 2007b). Notably, this cluster of solutions is also the only one that aligns with the wild-type human NPC tomographic cryo-EM map (Figures 5B and S7D, EMDB 2444) (Bui et al., 2013) and the mutant one lacking an outer cytoplasmic Y-complex ring (Figure 5C, EMDB 3104) (von Appen et al., 2015). The cross-correlation coefficients between the Nup82 holo-complex structure and the human NPC tomographic cryo-EM maps are 0.72 (wild-type, Figures 5B and S7D) and 0.81 (mutant, Figure 5C) in cluster C (Table 1). The cross-correlation coefficients were calculated using the measure correlation command in the UCSF Chimera software (https://www.cgl.ucsf.edu/chimera/).

Software

The modeling protocol (i.e., stages 2, 3, and 4) was scripted using the Python Modeling Interface (PMI), version c7411c3, a library for modeling macromolecular complexes based on our open-source Integrative Modeling Platform (IMP) package, version 2.5 (http://integrativemodeling.org) (Russel et al., 2012).

To display the CX-MS data we used the software CX-Circos (http://cx-circos.net).

Data Resources

The chemical cross-linking with mass spectrometric readout data used in this study was deposited in the Chorus database (https://chorusproject.org/pages/index.html).

Files containing the input data, modeling scripts, and output structures are available online (http://salilab.org/nup82; https://github.com/salilab/nup82).