Extel WEVA Notice

WEVA
Ed. 11-2011 V
Type : DB-9035E
Guide dinstallation et dutilisation

Manuale dinstallazione e uso
Instrucciones de uso e instalacin
Guia de instalao e de utilizao
Installation and user guide
Installatie en Gebruiksaanwijzing
Installation und Bedienungsanleitung
Fig. 5
Fig. 1
DEL
OK
ESC
Reset Pair
Fig. 6
P
10
2
Fig. 2
Fig. 7
C
K
F
E
B
Fig. 3
Fig. 4
A
1
2
Fig. 8
DEL
4
5
6
OK
ESC
Fig. 9
P
LOCK
F
+
-
CFI EXTEL WEVA - 11/2011
SOMMAIRE
1. CONSIGNES DE SCURIT
Important !
Veuillez lire le manuel dutilisation soigneusement avant dinstaller ou dutiliser ce produit.
Si vous installez ce produit pour dautres, pensez laisser le manuel ou une copie lutilisateur nal.
CONSIGNES DE SCURIT..................................................p.2
DESCRIPTIF. ......................................................................................p.2
NOMENCLATURE.........................................................................p.3
a. Moniteur
b. Platine de rue, camra extrieure
INSTALLATION ..............................................................................p.3
a. Installation du boitier lectronique
et de la platine de rue (camra)
b. Installation du moniteur
MODE DEMPLOI ...........................................................................p.5
PRSENTATION DES ICNES ...........................................p.6
MENUS ...................................................................................................p.6
APPLICATIONS ..............................................................................p.7
a. Rglages Camra
b. Rglages Enregistrement
c. Historique
d. Paramtres
CARACTRISTIQUES TECHNIQUES ...........................p.8

a. Spcicits techniques
b. Moniteur (MN WEVA)
c. Alimentation
d. Camra (PL WEVA)
Mesures de scurit :
Pour une exploitation en toute scurit de ce systme, il est essentiel que les installateurs, utilisateurs et techniciens suivent toutes les procdures de sret dcrites dans ce manuel.
Des avertissements spciques et des symboles dattention sont indiqus sur les lments si ncessaire.
Attention :
Lutilisateur de ce systme est responsable et se doit de vrier si la surveillance est conforme la loi en vigueur
dans le pays dutilisation.
Bien que digitales, les camras sont sujettes linterfrence des tlphones sans l, des micro-ondes et dautres
dispositifs sans l fonctionnant sur du 2,4 GHz (WIFI par exemple).
Maintenez le systme PLUS de 3 m des dispositifs pendant linstallation et lutilisation.
Note :
Tous les composants lectroniques actifs sont sensibles aux charges lectrostatiques humaines. En consquence,
avant toute intervention dans ces produits, il faut imprativement vacuer llectricit statique contenue par lutilisateur (par exemple : en maintenant un doigt sur lun des 2 contacts de piles du botier, l rouge ou l noir).
Tout dommage rsultant du non-respect de cette consigne ne pourra tre pris en charge dans le cadre de la
garantie.
2. DESCRIPTIF (g. 1)
1 Moniteur
2 Support mural
3 Adaptateur enchable
4 Platine de rue
5 Visire anti-pluie
6 Support Antenne
7 Cble de connexion pour gche ou serrure lectrique
8 Cble Antenne 2m environ
9 Botier lectronique
10 Antenne
10 OPTIONS .............................................................................................p.9
Gnralit
11 ASSISTANCE TECHNIQUE
Ce visiophone est compos dun poste intrieur avec cran couleur, interphone mains libres, et dune platine de
rue extrieure mettre en saillie permettant de voir et de communiquer avec le visiteur qui a sonn. Pour un usage
efcace, prendre le temps de lire attentivement ce manuel dinstructions sans oublier de le conserver.
12 MESURES
F1
Avertissement :
Les diffrents lments ne devront tre dmonts que par un technicien autoris.
- GARANTIE ...................p.9
DE SCURIT .......................................................p.10
Attention : Si vous effectuez un essai de votre visiophone avant de linstaller (essai courte distance) respecter un minimum de distance entre le moniteur et la platine de rue denviron 3 m (risque de saturation, effet
Larsen)
F2
Installation du botier lectronique (g.5)
3. NOMENCLATURE
a. Moniteur (g. 2)
1. Indicateur : Enregistrement en cours (clignote)
2. Indicateur denregistrement non lu
3. Prise de ligne audio // Mise en marche
4. Fonction DEL sur menu // Accs au moniteur
5. Commande gche / serrure et/ou automatisme de portail (valide que si lcran est allum) // validation OK
a. Une impulsion de 2 secondes pour la commande dun automatisme de portail.
b. Une impulsion courte (infrieure 1 seconde) pour la commande dune gche ou dune serrure lectrique
6. Accs Menu // EXIT
7. Curseur du bas // enregistrement manuel
8. Curseur de droite // Rglage du volume
9. Micro pour la conversation
10. Antenne
11. Lecteur carte SD (32 Go Max. - 1 Go Mini)
12. Prise pour la fiche 5 V de ladaptateur (adaptateur raccorder sur une installation conforme aux normes en
vigueur: NFC 15 100 pour la France)
13. Support dplier
b. Platine de rue, camra extrieur (g. 3)

1. Led IR : vision de nuit (lumire invisible loeil nu).
2. Objectif de la camra C-MOS avec iris automatique orientable ( larrire de la camra).
3. Haut parleur : permet de se faire entendre lextrieur.
4. Bouton dappel : lorsquon appuie sur ce bouton la sonnerie se fait entendre lintrieur et lextrieur.
5. Porte-nom et voyant lumineux :
- si le botier lectronique est aliment par des piles le voyant ne sallume quaprs un appel si la pnombre est
trop importante.
- si le botier lectronique est aliment en basse tension (12 ou 24 V / ), le voyant sallume que lorsque la
pnombre est trop importante
- soulever dlicatement laide dun petit tournevis la protection en plastique et glisser ltiquette du porte-nom.
6. Micro : permet au visiteur de communiquer vers lintrieur.
4. INSTALLATION
Important : Ce visiophone a une porte de 300 m champ libre. Cependant celle-ci peut tre rduite en
fonction de la nature et du nombre dobstacles entre ou ct des appareils.
Il est donc impratif de tester lensemble des lments du visiophone sans les fixer pour dterminer les meilleurs
emplacements de la platine de rue et du moniteur.
a. Installation (partie extrieure) de votre visiophone sans l.

Composition :
une platine de rue

un botier lectronique contenant lemetteur-rcepteur radio et les piles (non fournies).
une visire anti-pluie
une antenne
Important : Ne pas exposer la camra directement face au soleil, ou face une surface rchissante.
Conseil : il est recommand de faire passer les cbles dans une gaine de protection, an de les protger des chocs
et des intempries.
F3
Utiliser le cble 6 conducteurs pour la liaison botier/platine de rue en respectant les couleurs (fig 8). Insrer 4
piles type LR20 dans le botier lectronique afin de procder aux essais de porte radio. Lantenne devra tre
dgage le plus possible de toute partie mtallique, de source de parasites ou obstacles entre votre botier et votre
maison, notamment aucun contact entre lantenne et des feuilles ou des branches darbre. Elle devra galement
tre place suffisamment haut (environ 1,60 m du sol) et en position verticale, afin dobtenir les meilleures performances.
Note : si la transmission est de qualit insuffisante, utiliser le cble de 2 m fourni pour trouver une meilleure
position pour lantenne.
Une fois lemplacement idal dtermin procder au montage dfinitif.
1 Dmonter le capot suprieur du botier en dvissant les 6 vis cruciformes (H).
Attention : ne pas toucher directement le circuit lectronique (voir remarque chapitre consigne de scurit : Important - p 2)
2 A laide de 2 vis fixer le botier grce aux 2 trous (J) situs en haut et en bas, lantenne se trouvant en haut et
droite.
3 Ne pas oublier de faire passer au pralable le cble de raccordement la platine de rue par le trou du pilier et
2 fils (F) (non fournis) pour la liaison vers louvre-porte (il faut donc percer le pilier ou le mur en consquence). Le
raccord (F) doit par la suite tre raccord la serrure ou la gche lectrique et sur le bornier LOCK du botier lectronique.
Note : Ne pas installer dantenne autre que celle dorigine
Attention : En aucun cas, vous ne devez mettre les piles avant davoir compltement termin linstallation.
Installation de la platine de rue (g.6 / 7 / 8)

Conseil : il est recommand de faire passer les cbles (celui de la platine de rue et celui de la gche lectrique)
dans une gaine de protection, afin de les protger des chocs et des intempries. Ne pas couper le surplus du cble
6 conducteurs, afin dviter des problmes doxydation ou de mauvais contacts. Mieux vaut enrouler celui-ci sur
lui-mme entre le pilier et le botier lectronique.
1 Dvisser la vis cruciforme (A)
2 Basculer la platine (B) vers lavant et la dgager par le bas.
3 Fixer, laide des 3 vis (K), la visire (C) au ras du mur, de faon ce que le trou (D) se trouve en face du cble (E).
4 Afin dviter les infiltrations qui ruissellent le long du mur, mettre un joint silicone larrire de la visire (C).
5 Passer le cble de liaison.
6 Raccorder les 6 fils (E) larrire de la platine:
VIDEO (jaune) GND (noir) SPK (marron) MIC (blanc) KEY (vert) VCC (rouge)
7 Vrifier lorientation de la camra (G) (Fig.8)
8 Remonter la platine, revisser la vis (A)
Pour terminer linstallation de la partie extrieure, insrer 4 piles 1,5 V - type LR 20, alcaline, dans le compartiment
piles du botier lectronique, aprs avoir bascul la trappe, veillez respecter la polarit. Refermer la trappe et
remonter le capot suprieur du botier lectronique laide des 6 vis cruciformes (H), en veillant ne pas dformer
le joint dtanchit. Vous pouvez utiliser une source dalimentation basse tension, provenant dun transformateur
type WETR 14602 SER.R1 ou dun automatisme de portail (12 ou 24 V / ). Elle sera relier sur les bornes
et + du botier lectronique. Dans le cas dune tension continue V , faire trs attention la polarit (- +).
Attention : Si vous nutilisez pas les piles mais une source 12/24 V / (automatisme de portail) brancher
comme indiqu Fig. 9.
Si vous utilisez une source 12/24 V / il est impratif de retirer les piles.
Ne pas utiliser de piles rechargeables.
F4
6. PRESENTATION DES ICONES
b. Installation du moniteur (g.4)

Installez le moniteur au minimum 1,60 m au-dessus du sol (pour des conditions de rception optimales).
Pour linstallation du moniteur, choisissez un emplacement loign des murs en bton arm, miroirs, tagres en
mtal, etc...
loignez le moniteur de tous les appareils crant des interfrences lectriques fortes.
Nimporte quel environnement lectrique fort peut causer des interfrences et perturber lutilisation (WIFI en
particulier).
Pour une installation sur table, dplier le pied (A) et poser le moniteur sur une surface stable.
Connexion du moniteur :
1. Reliez le cordon de ladaptateur 5 V dans la che alimentation du moniteur. (B)
2. Branchez ladaptateur dans une prise 230 V
Attention : Placer uniquement le moniteur sur des surfaces dures et stables.
5. MODE DEMPLOI
Attention : Si vous effectuez un essai de votre visiophone avant de linstaller (essai courte distance) respecter un minimum de distance entre le moniteur et la platine de rue denviron 3 m (risque de saturation)
Le moniteur doit tre en mode veille, le voyant
allum en bleu. (ce mode sactive avec la touche
)
Lorsquun visiteur appelle, votre moniteur sonne pendant 8 secondes environ. Simultanment la platine de rue
met une tonalit confirmant que lappel a t transmis. Vous avez environ 30 secondes pour rpondre lappel.
Passer ce dlai, le botier lectronique se remet en veille. Si votre botier lectronique est aliment par une source
12 ou 24 V / , vous pouvez forcer la communication avec la platine en appuyant sur la touche
. Si le botier
lectronique est aliment par pile, lappel est perdu.
La conversation stablit pendant un appel en appuyant sur la touche
et
.Vous pouvez augmenter le volume
en appuyant sur la touche
La dure initiale de la communication est fixe 30 secondes. Elle peut tre augmente de 30 secondes supplmentaires en appuyant sur les touches
ou
durant la communication). Vous pouvez mettre fin la commuou
pendant 3 secondes.
nication en appuyant sur
a. tat du signal
b. Mode Enregistrement
c. tat des piles de la platine de rue
- Batterie pleine (jaune)
- Batterie faible (rouge/clignotant)
d. Enregistrement manuel
e. : pas de carte SD
F : carte SD complte
Err. : erreur carte SD
: carte SD verrouill
: rengistrement autoris
f. Indicateur de la carte SD
g. Capacit de la carte SD
h. Perte de signal
i. Prise de la ligne
j. Heure de lenregistrement
k. Date et heure
D
F
E
6' *
5(&
G H I
J
126,*1$/
K
N
M

L
7. MENUS
Appuyer sur ESC pendant 2 secondes pour faire apparatre les crans suivants (
valider).
et
pour dfiler, OK pour
1 Cas dun enregistrement partir du moniteur : (prsence carte SD obligatoire)

-Si loption visiting record (voir b. p.7) nest pas active, il est possible de dmarrer/arrter un enregistrement
en appuyant sur
.
-Si loption visiting record est active, lenregistrement dmarre automatiquement lors dun appel depuis la
platine de rue.
2 Cas dune installation avec gche lectrique (ou serrure lectrique) :
Louverture de la gche lectrique nest possible que pendant une communication (en permanence si le botier
lectronique est aliment en basse tension), en appuyant brivement sur la touche
, puis brivement sur la
touche (1 sec.).
a. Rglages Camra
b. Rglages Enregistrement
Attention : Une seule commande douverture est possible par appel en fonctionnement sur piles.
Note : Afin dassurer louverture, la gche ou la serrure doit tre imprativement quipe dune mmoire mcanique.
3 Cas dune installation avec automatisme de portail :
Attention : Louverture daccs nest possible que si le botier lectronique est aliment en basse tension.
- Appuyer sur la touche
pendant 3 secondes lors dune communication.
- Hors communication appuyer sur
puis
pendant 3 secondes.
Rappel : La rception dun appel sur le moniteur nest possible que sil est en mode veille et appair avec la platine de
rue (voir chapitre Appairage).
Important : Cet appareil est donn pour une porte jusqu 300 m environ, en champ libre. Cependant, celle-ci peut
tre considrablement rduite suivant lenvironnement (proximit de perturbations radio, ).
F5
c. Historique
d. Paramtres
F6
8. APPLICATION
a. Rglages Camra
1 Luminosit de la camra :
Appuyer sur OK pour entrer dans la barre dajustement de la luminosit.
Appuyer sur pour ajuster la luminosit, appuyer sur OK pour confirmer et sortir du menu.
2 Appairage :
Appuyer sur
, puis appuyer sur OK pour entrer dans le menu, le systme se mettra en fonction pendant 60
secondes. Lancer un appel depuis la platine de rue, puis appuyer sur le bouton dappairage (fig.5-1) dans le botier
lectronique sous 60 secondes. Une fois lappairage ralis, apparatra limage de la platine de rue.
Note : Il est fortement conseill dappairer le botier lectronique avec la platine de rue avant linstallation.
Appuyer sur ESC pour sortir.
3 Mode suppression :
3
Appuyer sur DEL pour entrer dans le mode.
Utiliser pour supprimer le fichier slectionn ou pour tout supprimer.
Appuyer sur OK et slectionner licne puis appuyer sur OK pour le
supprimer.
d. Paramtres
1 Rglages date/heure :
Appuyer sur pour slectionner la date ou heure souhait.
Appuyer sur pour modifier lhorloge du systme.
Appuyer sur OK pour confirmer les rglages.
2 Version de logiciel : Affiche la version du systme pour la platine de rue et le moniteur.
3 Format TV : Utiliser
pour slectionner le systme TV entre NTSC et PAL (recommand).
4 Rglages par dfaut : Appuyer sur OK pour entrer dans le menu, slectionner
, puis appuyer sur OK.
5;9HU
7;9HU
b. Rglages Enregistrement (les squences enregistres sont en format .avi)

1 Mode Enregistrement : Utiliser
pour choisir ON/OFF
Note : Lors dun appel, si vous ne rpondez pas, le moniteur enregistrera durant 30 secondes votre visiteur.
Le tmoin
notifiera un enregistrement non lu
2 Formatage de la carte SD :
Appuyer sur OK pour entrer dans la fonction formatage
Slectionner et appuyer sur OK pour formater.
Note : Vrifier que la carte SD est dverrouille (indication p 6-e). Pour une premire utilisation il est recommand de formater la carte SD avant utilisation.
3 craser un fichier : Dans le cas o la carte est pleine, ce mode permet de choisir dcraser dfinitivement
les premiers enregistrements par les plus rcents.
Utiliser pour slectionner ON/OFF, appuyer sur OK pour sauvegarder.
9. CARACTERISTIQUES TECHNIQUES
a. Spcicits techniques :
RF spcication
- Frquence radio 2,402-2,454 GHz
- Modulation numrique GFSK (Frequency Hopping Spread Spectrum)
- Anti-interfrence.
- Largeur de bande de chane : 2MHz
b. Moniteur (MN WEVA)
1 Mode visualisation :
Appuyer sur OK pour entrer dans les fichiers enregistrs.
Continuer dappuyer sur OK pour lire et arrter le fichier.
2 Mode lecture :
Appuyer sur pour rgler le volume
Appuyer sur pour revenir en arrire en 2x, 4x, 8x et 16x
Appuyer sur ESC pour arrter et sortir
F7
- Rfrence : 810268
- cran : 18 cm en diagonale
- Alimentation du moniteur : 5V
- Consommation : 900 mA
- Dimensions : 220 x 143 x 35 (mm)
- Temprature dutilisation : -10C + 40 C environ.
DEL
OK
ESC
c. Historique
F8
c. Alimentation
CONDITION DE GARANTIE : Cet appareil est garanti, pices et main duvre dans nos ateliers.
- Adaptateur 230 V /5 V 1A
En cas de coupure du cordon dalimentation veiller respecter la polarit
La garantie ne couvre pas : les consommables (piles, batteries, etc.) et les dgts occasionns par : mauvaise utilisation, mauvaise installation, intervention extrieure, dtrioration par choc physique ou lectrique, chute ou
phnomne atmosphrique.
Ne pas ouvrir lappareil afin de ne pas perdre le couvert de la garantie.
Lors dun ventuel retour en SAV, protger lcran afin dviter les rayures.
Entretien avec un chiffon doux seulement, pas de solvants. Avant le nettoyage, dbranchez ou mettez lappareil
hors tension.
d. Camra (PL WEVA)

- Rfrence : 820659
- Dimensions : 150 x 115 x 42 mm
- T de fonctionnement : -10C 45 C environ
- Camra : C-MOS
- Lentille : H : 62 V : 42
- Sensibilit < 8 lux
- Indice de protection : IP 44
Attention : Nemployez aucun produit ou essence dpuration carboxylique, alcool ou similaire. En plus
de risquer dendommager votre appareil, les vapeurs sont galement dangereuses pour votre sant et explosives.
Nemployez aucun outil pouvant tre conducteur de tension (brosse en mtal, outil pointu...ou autre) pour le
nettoyage.
10. OPTIONS
Le ticket de caisse ou la facture fait preuve de la date dachat.
Toutes les gches lectriques Extel

Toutes les serrures lectriques Extel
Toutes les motorisations Extel
WE 8111 BIS
12. MESURES DE SCURIT
11. ASSISTANCE TECHNIQUE - GARANTIE

Panne
Cause
Solution
Aucune fonction
Pas dalimentation
Vrifier le branchement de ladaptateur

Vrifier que le moniteur est allum correctment (led bleu
)
Vrifier la tension des piles dans le botier
lectronique
La platine de rue sonne

mais pas le moniteur
Problme dappairage
Appairer le botier lectronique avec le moniteur

Rapprocher le moniteur du botier lectronique.
Problme de porte
Pas de son lextrieur
et lintrieur
Trou du micro bouch par

un insecte
Dboucher et nettoyer le trou dlicatement

(attention de ne pas abmer la cellule micro)
Vrifier le branchement du fil blanc ou marron sur la platine de rue
Mauvaise Image
Problme de configuration
Aller dans le menu et vrifier le format vido

(p 8)
Impossible denregistrer
sur carte SD
Problme de protection
Vrifier que la carte ne soit pas verrouille ou

pleine (voir indications cran p 6-e)
Les dommages provoqus par le manque de conformit au manuel mnent lexpiration de la garantie. Nous nassumerons aucune responsabilit pour les dommages en rsultant !
Nous nassumerons aucune responsabilit concernant tout dommage, sur les biens ou les personnes, caus par une
mauvaise manipulation ou par manque de conformit aux consignes de scurit.
Ce produit a t fabriqu dans le respect total des consignes de scurit. An de maintenir ce statut et dassurer
la meilleure exploitation du produit, lutilisateur doit observer les consignes et avertissements de sret contenus
dans ce manuel.
Lutilisateur de ce systme en est responsable et se doit de vrier si la vidosurveillance est conforme la loi en
vigueur dans le pays dutilisation.
: Ce symbole indique un risque de choc lectrique ou un risque de court-circuit.
- Vous ne devez utiliser ce produit qu une tension comprise entre : 100-240 Volts et 50-60 hertz. Nessayez jamais
dutiliser cet appareil avec une tension diffrente.
- Veillez ce que tous les raccordements lectriques du systme soient conformes aux consignes dutilisation.
- Dans les tablissements commerciaux, assurez-vous dobserver les rgles de prvention des accidents pour les
installations lectriques.
- Dans les coles, les quipements de formation, les ateliers la prsence dun personnel quali est ncessaire
pour contrler le fonctionnement des appareils lectroniques.
- Observez les consignes dutilisation des autres appareils relis au systme.
- Veuillez contacter une personne exprimente au cas o vous auriez des doutes au sujet du mode de
fonctionnement ou de la sret des appareils.
- Ne jamais brancher ou dbrancher les appareils lectriques avec les mains mouilles.
- Lors de linstallation de ce produit, vriez bien que les cbles dalimentation ne risquent pas dtre endommags.
- Ne remplacez jamais les cbles lectriques endommags vous-mme ! Dans ce cas, enlevez-les et faites appel
une personne exprimente.
ATTENTION
En cas de besoin, note site technique est votre disposition : www.c-extel.com
HOTLINE : 0892-35-00-69 WWFPLQ
Dernire version de la notice tlchargeable en couleur sur : www.c-extel.com
F9
Avertit lutilisateur de la prsence dinstructions importantes concernant lutilisation et lentretien (la rparation) dans la documentation accompagnant lappareil.
$YHUWLWOXWLOLVDWHXUGHODSUpVHQFHGHWHQVLRQVGDQJHUHXVHVQRQLVROpHVjOLQWpULHXUHGX
ERvWLHU GX SURGXLW GXQH LPSRUWDQFH VXIVDQWH SRXU UHSUpVHQWHU XQ ULVTXH GpOHFWURFXWLRQ
SRXUOHVSHUVRQQHV
F10
INDICE
1. DISPOSIZIONI DI SICUREZZA
DISPOSIZIONI DI SICUREZZA..........................................p.2
DESCRIZIONE..................................................................................p.2
DESIGNAZIONE ELEMENTI ................................................p.3

a. Monitor
b. Pulsantiera esterna, telecamera esterna
INSTALLAZIONE ...........................................................................p.3
a. Installazione della scatola elettronica e
della pulsantiera esterna (telecamera)
b. Installazione del monitor
MODALIT DUSO .....................................................................p.5
PRESENTAZIONE DELLE ICONE ....................................p.6
MENU ......................................................................................................p.6
APPLICAZIONI ...............................................................................p.7
a. Regolazioni Telecamera
b. Regolazioni Registrazione
c. Lista di evento
d. Parametri
CARATTERISTICHE TECNICHE .......................................p.8
Importante !
Leggere attentamente il manuale utente prima di installare o utilizzare questo prodotto.
Se il prodotto viene installato per conto terzi, lasciare il presente manuale o copia di esso allutente nale.
Avvertenza:
I diversi elementi devono essere smontati solo da un tecnico autorizzato.
Misure di sicurezza:
Per un utilizzo in assoluta sicurezza del presente sistema, fondamentale che gli installatori, gli utenti e i tecnici
seguano.
tutte le procedure di sicurezza descritte nel manuale.
Se necessario sono indicati sugli elementi avvertenze speciche e simboli per richiamare lattenzione.
Attenzione :
Lutente del presente sistema deve vericare sotto la sua responsabilit che la sorveglianza sia conforme alle leggi
vigenti nel paese di utilizzo.
Nonostante siano digitali, le telecamere sono soggette a interferenze di telefoni cordless, forni a microonde e altri
apparecchi senza lo che funzionino a 2,4 GHz (per esempio WIFI).
Tenere il sistema a pi di 3 m dagli apparecchi durante linstallazione e lutilizzo.
Note :
Tutti i componenti elettronici attivi sono sensibili alle cariche elettrostatiche umane. Di conseguenza, prima di
qualsiasi intervento bisogna imperativamente scaricare lelettricit statica contenuta dallutilizzatore (ad esempio:
mantenendo un dito su uno dei due contatti delle pile della scatola, lo rosso o lo nero).
Qualsiasi danno dovuto alla mancata osservazione di queste norme, non potr essere coperto dalla garanzia.
2. DESCRIZIONE (g.. 1)
1 Monitor
2 Supporto murale
3 Adattatore a spina
4 Pulsantiera esterna
5 Visiera Antipioggia
a. Specicit tecniche
b. Monitor (MN WEVA)
c. Alimentazione
d. Telecamera (PL WEVA)
6 Supporto Antenna
7 Cavo di connessione per incontro o serratura elettrica
8 Cavo Antenna 2 m circa
9 Centralina
10 Antenna
10 OPZIONI ...............................................................................................p.9
11 ASSISTENZA TECNICA
12 DISPOSIZIONI
/ GARANZIA ..........................p.9
DI SICUREZZA ........................................p.10
Informazioni Generali
Questo videocitofono si compone di un apparecchio interno con schermo a colori e di una pulsantiera esterna con
citofono e telecamera che permettono di vedere e di comunicare con il visitatore che ha suonato. Per unutilizzazione efcace, leggere con attenzione e conservare questo manuale di istruzioni.
Attenzione : Se viene eseguito un test del videocitofono prima dellinstallazione (test a breve distanza)
rispettare una distanza minima tra il monitor e la pulsantiera esterna di circa 3 m (rischio di saturazione, effetto
Larsen).
IT1
IT2
3. DESIGNAZIONE ELEMENTI
a. Monitor (g. 2)
1. Indicatore: Registrazione in corso (lampeggia)
2. Indicatore registrazioni non lette
3. Presa linea audio // Avviamento
4. Funzione DEL (CANC) in menu // Accesso al monitor
5. Comando incontro/serratura e/o automazione del cancello (valido solo se lo schermo acceso) // Conferma
OK
a. Premere per una durata di 2 secondi per azionare lautomazione del cancello.
b. Premere brevemente (meno di 1 secondo) per azionare lincontro o la serratura elettrica.
6. Accesso Menu // EXIT (USCITA)
7. Cursore inferiore // registrazione manuale
8. Cursore di destra // Regolazione volume
9. Microfono per la conversazione
10. Antenna
11. Lettore scheda SD (32 Go Max. - 1 Go Mini)
12. Presa per la spina 5 V delladattatore (adattatore da collegare a un impianto conforme alle normative vigenti:
NFC 15 100 per la Francia)
13. Supporto da dispiegare
Installazione della scatola elettronica (g.5)

Utilizzare il cavo a 6 conduttori per effettuare il collegamento scatola elettronica/pulsantiera, facendo attenzione
a rispettare i colori (fig. 8). Inserire 4 pile tipo LR20 nella scatola elettronica per procedere alla verifica della portata del segnale radio. Lantenna dovr essere il pi possibile libera da parti metalliche, da disturbi parassiti o da
ostacoli tra la vostra scatola e labitazione, in particolare nessun contatto tra lantenna e foglie o rami di albero.
Essa dovr ugualmente essere posta sufficientemente in alto (circa 1,60 m da terra) ed in posizione verticale, per
ottenere le migliori performances.
Note : Se la trasmissione di qualit insufficiente, utilizzare il cavo da 2 m fornito per trovare una posizione
migliore por antenna.
Dopo aver scelto un luogo adatto per linstallazione, procedere al montaggio definitivo:
1 Smontare il coperchio superiore della scatola svitando le 6 viti a croce (H).
Attenzione : non toccare direttamente il circuito elettrico (vedere nota capitolo : Importante a pagina 2)
2 Con laiuto di 2 viti fissare la scatola utilizzando i 2 fori (J) situati sulla partesuperiore e inferiore, lantenna si
trova in alto a destra.
3 Non dimenticare di far passare il cavo di raccordo alla scatola da esterno attraverso il foro del pilastroe 2 fili
(F) per il collegamento scatola /incontro elettrico (bisogna quindi bucare il pilastro o il muro). Il raccordo (F) devono
essere collegati alla serratura o allapriporta o LOCK della scatola elettronica.
Note : Non installare altre antenne, se non quella.
Attenzione : in nessun caso mettere le pile prim di aver completamente terminato linstallazione.
b. Pulsantiera esterna, telecamera esterna (g. 3)

1. Led IR: visione notturna (luce invisibile a occhio nudo).
2.Obiettivo della telecamera C-MOS con diaframma automatico orientabile (sul retro della telecamera).
3. Altoparlante: consente di farsi sentire allesterno.
4. Pulsante di chiamata: premendo questo pulsante la suoneria si sente allinterno e allesterno
5. Etichetta portanome e Indicatore luminoso:
- se la scatola elettronica alimentata a pile la spia si illumina solo dopo una chiamata.
- se la scatola elettronica alimentata a bassa tensione (12 o 24 V / ) la spia si illumina solo quando la penombra
troppo intensa
6. Microfono: consente al visitatore di comunicare con linterno.
4. INSTALLAZIONE
Importante : Questo videocitofono ha una portata di 300 m in campo libero. Questo videocitofono ha una
portata di 300 m in campo libero.
pertanto imperativo testare linsieme dei componenti del videocitofono prima di ssarli, in modo da determinare
il posizionamento ottimale di modulo esterno e monitor.
a. Installazione (parte esterna) videocitfono senza lli.

Composizione: - una pulsantiera esterna (D)
- una scatola elettrica ( E ) contenente il trasmettitore-ricevitore radio e le pile (non fornite).
- una visiera Antipioggia
- una antenna
Importante : Non esporre la telecamera ai raggi diretti del sole o su di una superficie riflettente.
Consiglio: si raccomanda di far passare i cavi dentro una guaina protettiva al fine di proteggerli dagli urti e dalle
intemperie.
IT3
Installazione della pulsantiera esterna (telecamera) (g.6 / 7 / 8)

Consiglio : si raccomanda di far passare i cavi (quello della pulsantiera e quello dellapriporta) in una guaina di
protezione, per proteggere da choc e intemperie. Non tagliare il cavo a sei conduttori in eccesso, per evitare
problemi di ossidazione o di contatto. Meglio avvolgerlo e lasciarlo tra il pilastro e la scatola elettrica.
1 Svitare le viti a croce (A)
2 Estrarre la pulsantiera (B) liberandola dalla parte inferiore
3 Fissare con laiuto di 3 viti (K), la visiera antipioggia (C) al muro, in modo che il foro (D) si trovi davanti al cavo (E).
4 Per evitare le infiltrazioni che scorrono lungo il muro, si consiglia di utilizzare una guarnizione in silicone sulla
parte posteriore della visiera antipioggia (C)
5 Passare il cavo di collegamento
6 Raccordare i 6 fili (E) sul retro della scatola
(VIDEO: lo giallo - GND : lo nero - SPK : lo marrone - MIC : lo bianco - KEY : lo verde - VCC : lo rosso)
7 Verificare lorientamento della telecamera (G) (fig.8)
8 Rimontare la pulsantiera, avvitare la vite (A)
Per terminare linstallazione della parte esterna, , inserire 4 pile da 1,5 V tipo LR 20, alcaline nel vano delle pile
della scatola elettrica, alzando lo sportello e facendo, attenzione a rispettare la polarit. Facendo attenzione a non
deformare il giunto stagno. Non tappare i due fori di aerazione (H), situati nella parte inferiore della scatola elettrica. Si pu utilizzare una sorgente di alimentazione a bassa tensione proveniente da un trasformatore del tipo
WETR 14602 SER.R1 o da unautomazione per cancello (12 ou 24 V / ). Essa sar da collegare ai morsetti
o + della scatola elettronica. Nel caso di tensione continua V
rispettare tassativamente la polarit +/-.
Attenzione : Se non si usano pile ma corrente 12/24 V / (automazione cancello) collegare come di indicato (fig. 9)
Se si utilizza una fonte di energia 12/24 V / necessario rimuovere le pile.
Non utilizzare pile ricaricabili.
IT4
b. Installazione del monitor (g.4)

Installare il monitor a 1,60 m circa dal suolo (per condizioni di ricezione ottimali).
Per linstallazione del monitor, scegliere unubicazione che sia lontana da muri in cemento armato, specchi, scaffalature in metallo ecc.
Allontanare il monitor da qualunque apparecchiatura che crei interferenze elettriche forti.
Qualunque ambiente elettrico forte pu causare interferenze e perturbare lutilizzo (in particolare il WIFI).
Per installazione su piano orizzontale, dispiegare il piede (A) e posare il monitor su una superficie stabile.
Connessione del monitor:
1. Collegare il cordone delladattatore 5 V nella spina Alimentazione del monitor (B).
2. Collegare ladattatore a una presa 230 V .
Attenzione : Sistemare il monitor solo su superfici rigide e stabili.
5. MODALIT DUSO
Il monitor deve essere in modalit stand by, la spia
deve essere blu. (questa modalit si attiva con il tasto )
deve essere poggiato su una superficie stabile, con lantenna dispiegata. Quando lospite suona, il monitor suona
per circa 8 secondi circa. Contemporaneamente la pulsantiera emette un suono che conferma la trasmissione della
chiamata Sono disponibili circa 30 secondi per rispondere alla chiamata. Trascorso questo termine, la scatola elettrica si posiziona in attesa.Se la scatola elettronica alimentata da una sorgente elettrica 12 o 24 V / , possibile
forzare la comunicazione con la pulsantiera esterna premendo il tasto
. Se la scatola elettronica alimentata a
pile la chiamata persa.
La conversazione si stabilisce durante la chiamata premendo il tasto
e
. possibile aumentare il volume
premendo il tasto
.
La durata iniziale della comunicazione stabilita in 30 secondi. Ma pu essere aumentata di ulteriori 30 secondi
premendo il tasto
o
(in fase di comunicazione).
possibile mettere fine alla comunicazione premendo
o
per3 secondi.
6. PRESENTAZIONE DELLE ICONE

a. Stato del segnale
b. Modalit Registrazione
c. Stato della pila della pulsantiera esterna
- Batteria piena (giallo)
- Batteria debole (rosso/lampeggiante)
d. Registrazione manuale
e. : nessuna scheda SD
F : scheda SD completa
Err. : errore scheda SD
: scheda SD bloccata
:riregistrazione autorizzata
f. Indicatore della scheda SD
g. Capacit della scheda SD
h. Perdita del segnale
i. Presa della linea
j. Ora di registrazione
k. Data e ora
D
6' *
5(&
G H I
J
F
E
126,*1$/
K
N
M

L
7. MENU
Premere Men per ESC per 2 secondi far apparire le seguenti schermate (
convalidare).
per far scorrere, OK per
1 Registrazione a partire dal monitor: ( necessaria una scheda SD)

- Se lopzione visiting record (Modalit registrazione) (v. fine p. 7) disattivata, non possibile avviare/fermare la
registrazione premendo
.
- Se lopzione visiting record (Modalit registrazione) attivata, la registrazione si avvia automaticamente quando
viene emessa una chiamata tramite la pulsantiera esterna.
2 In caso di installazione con apertura elettrica :
Lapertura della serratura elettrica possibile solo durante una comunicazione (in permanenzase la scatola elettronica alimentata a bassa tensione), premere leggermente il pulsante
dopo premere leggermente il bottone
(1 sec.).
b. Regolazioni Registrazione
Attenzione : possibile un solo comando di apertura per chiamatain funzionamento su batteria

Note : per poter assicurare lapertura, la serratura deve essere dotata di una memoria meccanica.
3 In caso di installazione con sistema di apertura automatica comandata dalla chiusura di un contatto:
Attenzione : Lapertura della serratura elettrica possibile se la scatola elettronica alimentata a bassa
tensione. In fase di comunicazione, tenere premuto il tasto
per 3 secondi.
- Quando non si in fase di comunicazione, tenere premuto per 3 secondi prima su
, quindi su
.
Da ricordare : Il ricevimento di una chiamata sul monitor possibile solo se in modalit stand by e appaiato
con la pulsantiera esterna (vedere capitolo Appaiamento).
Importante : Questo videocitofono ha una portata di 300 m in campo libero. Questo videocitofono ha una
portata di 300 m in campo libero.
c. Lista di evento
IT5
d. Parametri
IT6
8. APPLICAZIONI
1 Luminosit della telecamera :
Premere OK per entrare nella barra di regolazione della luminosit
Premere per regolare la luminosit, premere OK per confermare e uscire dal men
2 Appaiamento :
Premere poi premere, OK per entrare nel Men, lil sistema si mette in funzione per 60 secondi. Inviare una
chiamata dalla pulsantiera, poi premere sulla chiave di appaiamento (fig 2, p 6) nella scatola elettronica per 60
secondi. Una volta realizzato lappaiamento, comparir limmagine della pulsantiera esterna
Note : fortemente consigliato di appaiare la scatola elettronica con la pulsantiera prima dellinstallazione.
Premere ESC per uscire.
3 Modalit cancella :
Premere DEL per entrare nella modalit
Utilizzare per cancellare il file selezionato o per cancellare tutto.
Premere OK e selezionare licona poi premere OKper cancellare
Premere ESC per uscire
d. Parametri
1 Regolazione data/ora :
Premere per selezionare la data o lora desiderate.
Premere per modificare lorologio del sistema.
Premere OK per confermare le regolazioni.
2 Versione del software: Viene visualizzata la versione del sistema per la pulsantiera esterna e il
monitor
3 Formato TV: Utilizzare
per selezionare il sistema TV tra NTSC e PAL (raccomandato).
4 Regolazioni predefinite :
Premere OK per entrare nel men, selezionare , poi premere OK.
5;9HU
7;9HU
b. Regolazioni Registrazione (le sequenze registrate sono in formato .avi)

1 Modalit Registrazione: Utilizzare
per scegliere ON/OFF
La spia
indicher la presenza di registrazioni non lette
Nota: Se durante una chiamata non si risponde, il monitor registrer il visitatore per 30 secondi.
2 Formattazione della scheda SD:
Premere OKper entrare nella funzione di formattazione
Selezionare e premere OK per formattare.
Note : Verificare che la scheda SD sia sbloccata (indicazioni p6-e). Per un primo utilizzo si raccomanda di formattare la scheda SD prima dellutilizzo.
3 Sostituire un file: Nel caso in cui la scheda sia piena, questa modalit consente di scegliere di cancellare
definitivamente le registrazioni pi vecchie, sovrascrivendole con quelle pi recenti.
Utilizzare
per selezionare ON/OFF, premere OK per salvare
3
9. CARATTERISTICHE TECNICHE
a. Specicit tecniche :
1 Modalit visualizzazione :
Premere OK per entrare nei file registrati.
Continuare a premere OK per leggere e fermare il file.
2 Modalit lettura :
Premere per regolare il volume
Premere per tornare indietro accelerato 2x, 4x, 8x e 16x
Premere ESC per terminare loperazione e uscire
IT7

- Articolo : 810268
- Schermo: 18 cm in diagonale.
- Alimentazione del monitor: 5V
- Consumo: 900 mA.
- Dimensioni : 220 x 143 x 35 (mm)
- Temperatura di utilizzo: -10 C a + 40 C circa.
DEL
OK
ESC
c. Lista di evento
RF specica
- Frequenza radio 2,402-2,454 GHz
- Modulazione digitale GFSK (Frequency Hopping Spread Spectrum)
- Anti-interferenza.
- Larghezza di banda: 2MHz
IT8
c. Alimentazione
CONDIZIONI DI GARANZIA :
- Adattatore 230 V / 5 V 1A
In caso di taglio del cordone dalimentazione ricordarsi di rispettare la polarit.
Questo apparecchio garantito, pezzi di ricambio e manodopera, presso la fabbrica. La garanzia non copre: i consumabili (pile, batterie ecc.) e i danni occasionati da: errato utilizzo, errata installazione, intervento esterno, deterioramento a causa di urto, scarica elettrica, caduta o fenomeno atmosferico.
Non aprire lapparecchio al fine di non perdere la copertura della garanzia.
Per uneventuale restituzione al Servizio di Assistenza, proteggere lo schermo per evitare danneggiamenti.
Pulire solo con un panno morbido, senza solventi. Prima di pulire, scollegare o togliere la corrente ODSSDUHFFKLR
c. Pulsantiera esterna, telecamera esterna (PL WEVA)

- Articolo : 820659
- Dimensioni : 150 x 115 x 42 mm
- Temperatura di funzionamento: -10 C a 45 C circa.
- Telecamera : C-MOS
- Lente : H : 62 V : 42
- Sensibilit < 8 lux
- IP 44
Attenzione : Non impiegare nessuna soluzione pulente a base carbonilica, alcool o simili. Oltre al rischio di
danneggiare lapparecchio, i vapori emanati sono pericolosi per la salute ed esplosivi.
Non impiegare utensili conduttori di tensione (spazzole in metallo, utensili appuntiti o altro) per la pulizia.
Lo scontrino o la fattura costituiscono prova della data di acquisto.
12. DISPOSIZIONI DI SICUREZZA
10. OPZIONI
Tutti gli incontri elettrici Extel
Tutte le serrature elettriche Extel
Tutte le motorizzazioni Extel
WE 8111 BIS
11. ASSISTENZA TECNICA / GARANZIA

*XDVWR
&DXVD
I danni provocati dalla mancanza di conformit al manuale conducono alla decadenza della garanzia. Non ci
assumiamo alcuna responsabilit per i danni che ne potrebbero derivare!
Non ci assumiamo altres responsabilit alcuna per qualsivoglia danno, a persone o beni, causato da una scorretta
manipolazione o dalla mancanza di conformit alle disposizioni di sicurezza.
Questo prodotto stato fabbricato nel totale rispetto delle disposizioni di sicurezza. Al ne di mantenere tale
condizione e di garantire la migliore utilizzazione del prodotto, lutente deve osservare disposizioni e avvertenze
contenute nel presente manuale.
Lutente del presente sistema deve vericare sotto la sua responsabilit che la sorveglianza sia conforme alle leggi
vigenti nel paese di utilizzo.
6ROX]LRQH
Nessuna funzione
Assenza di alimentazione
Verificare il collegamento delladattatore

Verificare che la batteria del monitor sia carica
(led blu
)
Verificare la tensione delle pile nella scatola
elettronica
La pulsantiera esterna
suona ma il monitor no
Problema di appaiamento
Problema di portata
Appaiare la scatola elettronica con il monitor

Avvicinare il monitor alla scatola elettronica e
verificare quando lapparecchio...
Assenza di suono all'esterno e all'interno
Foro del microostruito da

un insetto
Liberare e pulire il foro delicatamente (attenzione a non rovinare la cellula micro)

Verificare il collegamento del filo bianco o
marrone sulla pulsantiera esterna
Immagine non buona
Problema di configurazione
Andare nel men e verificare il formato video

(p8)
Impossibile registrare
sulla scheda SD
Problema di protezione
Verificare che la scheda non sia bloccata o

piena (vedere indicazioni schermo p6-e)
: Questo simbolo indica un rischio di shock elettrico o un rischio di corto circuito.

Questo prodotto deve essere utilizzato a una tensione compresa tra: 100-240 Volt e 50-60 hertz. Non tentare di
utilizzare questo apparecchio con una tensione differente.
-Sincerarsi che tutti i collegamenti elettrici del sistema siano conformi alle disposizioni di utilizzo.
-Nelle strutture commerciali, sincerarsi di osservare le regole di prevenzione degli incidenti concernenti impianti
elettrici.
-Nelle scuole, nelle strutture formative, nei laboratori la presenza di personale qualicato necessaria per
controllare il funzionamento degli apparecchi elettronici.
-Osservare le disposizioni di utilizzo degli altri apparecchi collegati al sistema. (videoregistratore, TV, PC per
esempio)
-Contattare una persona esperta in caso di dubbi circa le modalit di funzionamento o la sicurezza degli apparecchi.
- Mai collegare o scollegare gli apparecchi elettrici con le mani bagnate.
-Al momento dellinstallazione di questi prodotti, vericare che i cavi di alimentazione non rischino di essere
danneggiati.
-Mai sostituire da soli dei cavi elettrici danneggiati ! Nel caso, toglierli e far ricorso a personale qualicato.
ATTENZIONE Avverte lutente della presenza di istruzioni importanti circa lutilizzo e la manutenAssistenza Tecnica : +39 02 96488273
DVVLVWHQ]D#FH[WHOFRP
8OWLPDYHUVLRQHGHOOHLVWUX]LRQLVFDULFDELOLDFRORULVX www.c-extel.com
IT9
zione (la riparazione) nella documentazione che accompagna lapparecchio.
Avverte lutente della presenza di tensioni pericolose, non isolate, allinterno della cassa del
prodotto, di una gravit sufciente a rappresentare un rischio di folgorazione per le persone.
IT10
NDICE
1. INSTRUCCIONES DE SEGURIDAD
INSTRUCCIONES DE SEGURIDAD. ...............................p.2
DESCRIPCIN. ................................................................................p.2
NOMENCLATURA ........................................................................p.3
a. Monitor
b. Pletina de calle, cmara exterior
INSTALACIN .................................................................................p.3
a Instalacin caja electrnica y de la pletina de calle (cmara)
b. Instalacin del monitor
MODO DE EMPLEO .....................................................................p.5
PRESENTACIN DE LOS ICONOS.................................p.6
MEN ......................................................................................................p.6
APLICACINS .................................................................................p.7
a. Ajustes Cmara
b. Ajustes Registro
c. Lista de los acontecimientos
d. Parmetros
CARACTERSTICAS TCNICAS .......................................p.8

a. Datos tcnicos
c. Alimentacin
d. Cmara (PL WEVA)
12
Advertencia :
Los diferentes elementos slo podrn ser desmontados por un tcnico autorizado.
Medidas de seguridad :
Para poder utilizar este sistema de manera totalmente segura es indispensable que instaladores, usuarios y tcnicos respeten todos los procedimientos de seguridad que se describen en este manual.
Cuando sea necesario, se introducirn avisos especcos y smbolos de atencin junto a los elementos.
Atencin :
El usuario de este sistema tendr que responsabilizarse de este ltimo y deber comprobar que la videovigilancia
est permitida por la ley vigente en el pas de utilizaci.
Aunque son digitales, las cmaras pueden sufrir interferencias procedentes de los telfonos mviles, microondas y
dems dispositivos inalmbricos que funcionan a una frecuencia de 2,4 GHz (Wi-Fi por ejemplo).
No instale ni utilice el sistema a menos de 3 m de distancia de dichos dispositivos.
Nota :
Todos los componentes electrnicos activos son sensibles a las cargas electrostticas humanas. Por lo tanto, antes de realizar
cualquier intervencin en estos productos, es obligatorio que el usuario descargue la electricidad esttica de su cuerpo (por
ejemplo: manteniendo un dedo sobre uno de los 2 contactos de las pilas de la caja, cable rojo o negro.
Todos los daos debidos al incumplimiento de esta advertencia no sern cubiertos por la garanta.
2. DESCRIPCIN (g. 1)
10 OPCIONES ..........................................................................................p.9
11 ASISTENCIA TCNICA/
Importante !
Lea detenidamente el manual de instrucciones antes de instalar o utilizar este producto.
Si instala este producto para terceras personas, no olvide entregar el manual de instrucciones o una copia del
mismo al usuario nal.
GARANTA.............................p.9
INSTRUCCIONES DE SEGURIDAD..............................p.10
1 Monitor
2 Soporte mural
3 Adaptador enchufable
4 Pletina de calle
5 Visera anti-lluvia
6 Soporte cerradero Antena

7 Cable de conexin para cerradero o cerradura elctrica
8 Cable Antena 2m aproximadamente
9 Caja electrnica
10 Antena
Generalidades
Este visifono est formado por un puesto de respuesta interior con pantalla de color y una placa exterior con
interfono y cmara que permite ver y comunicar con el visitante que llam.. Para un uso ecaz, lea por favor atentamente este manual de instrucciones.
Atencin : Si somete a prueba el videotelfono antes de instalarlo (prueba a corta distancia) respetar un
mnimo entre el monitor y la chapa de la calle de unos 3 m (riesgo de saturacin, efecto Larsen).
ES1
ES2
Instalacin de la caja electrnica (g.5)
3. NOMENCLATURA
a. Monitor (g. 2)
1. Indicador: Grabacin en curso (parpadea)
2. Indicador de grabacin no ledo
3. Toma de lnea audio //Puesta en marcha
4. Funcin DEL (SUPR) en el men // Acceso al monitor
5. Accionamiento cerradero/cerradura y/o automatismo de portal (solamente es vlido si la pantalla est encendida)//validacin OK
a. Un impulso de 2 segundos para el accionamiento de un automatismo de portal.
b. Un impulso corto (inferior a 1 segundo) para el accionamiento de un cerradero o de una cerradura elctrica.
6. Acceso al Men // EXIT (SALIR)
7. Cursor inferior // grabacin manual
8. Cursor de la derecha // Ajuste del volumen
9. Micro para la conversacin
10. Antena
11. Lector SD Card (32 Go Mx. - 1 Go Mn)
12. Toma por la cha 5 V del adaptador (el adaptador se conectar en una instalacin conforme a las normas
vigentes: NFC 15.100 para Francia)
13. Soporte que debe desplegarse
Utilice el cable de 6 conductores para la unin cuadro/placa exterior respetando los colores (fig.8) Inserte 4 pilas
de tipo LR20 en el cuadro electrnico para realizar las pruebas de alcance de radio. La antena deber alejarse lo
mximo posible de cualquier parte metlica, fuente de interferencias u obstculos entre la caja y la casa. Principalmente
habr que evitar cualquier tipo de contacto entre la antena y las hojas o ramas de los rboles. La antena deber colocarse suficientemente alta (aproximadamente a 1,60 m del suelo) y en posicin vertical para obtener los mejores
resultados posibles.
Nota : Si la transmisin no es de calidad suficiente, utilizar el cable de 2 m proporcionado para encontrar una
mejor posicin por la antena.
Una vez determinada la posicin ideal, realice el montaje definitivo:
1 Desmonte la tapa superior de la caja desatornillando los 6 tornillos cruciformes ( H ).
Atencin : no toque directamente el circuito electrnico (ver las observaciones del apartado : Importante p.2)
2 Fije la caja introduciendo 2 tornillos en los 2 agujeros (J) situados en la parte superior e inferior. La antena se
encuentra en la parte superior derecha.
3 No olvide pasar previamente el cable de conexin con la pletina de calle por el agujero de la columna y 2 hilos (F)
para la conexin caja/cerradero elctrico (por lo tanto, tendr que taladrar la columna o pared en consecuencia). La conexin
(F) se conectara posteriormente a la cerradura o al cerradero elctrico y una toma LOCK de la caja electrnica.
Nota : No instalar otra antena que no sea la original
Atencin : No ponga las pilas antes de haber terminad totalmente la instalacin.
b. Pletina de calle, cmara extrior (g. 3)

1. IR LED, visin nocturna. (Luz invisible a simple vista)
2. Objetivo de la cmara CMOS con iris automtico orientable (en la parte trasera de la cmara).
3. Altavoz: para que nos oigan del exterior.
4. Botn de llamada: cuando se apoya en este botn la chapa de identificacin se enciende y el timbre se oye desde
el interior y el exterior.
5. Indicador luminoso :
- Si la caja electrnica est alimentada por pilas el indicador luminoso se encender despus de una llamada.
- Si la caja electrnica est alimentada en baja tensin (12 o 24 V / ) , el indicador luminoso se enciende cuando
la penumbra es bastante intensa
- Con un cacciavite piccolo, sollevare delicatamente la protezione in plastica e sfilare letichetta del portanome.
6. Micro : permite que el visitante pueda comunicarse con el interior.
4. INSTALACIN
Importante ! Este videotelfono tiene un alcance de 300 m campo libre. Sin embargo, dicho alcance podr
verse considerablemente reducido en funcin del entorno (cerca de perturbaciones radio, etc.).Por lo tanto, es indispensable probar todos los elementos del videoportero sin fijarlos para determinar el mejor emplazamiento para la pletina de
calle y el monitor.
a. El conjunto jo (parte externa) del videoportero inalmbrico

Composicin: - una pletina de calle
- una caja electrnica que contiene el emisor-receptor radio y las pilas (no suministradas).
- una visera anti-lluvia
- una antena
Importante ! No exponer la cmara directamente al sol, o sobre una superficie reflectante.

Consejo: se recomienda hacer pasar los cables por una funda de proteccin, con el fin de protegerlos contra los
choques e inclemencias del tiempo.
ES3
Instalacin de la pletina de calle
(g.6 / 7 / 8)
Consejo : le recomendamos introducir los cables (el de la pletina de calle y el del cerradero elctrico) en una
envoltura de proteccin para protegerlos de los golpes y las intemperies. No corte la parte sobrante del cable de
6 conductores, para evitar problemas de oxidacin o de falsos contactos. Es mejor que lo enrosque entre la
columna y la caja electrnica (fig. 7)
1 Desatornille el tornillo cruciforme (A)
2 Levante la pletina (B) por la parte inferior y retrela hacia abajo
3 Con los 3 tornillos (K), fije la visera anti-lluvia (C) a ras de la pared, de manera que el agujero (D) quede enfrente
del cable (E)
4 Para evitar que se filtre el agua que cae por la pared, ponga una junta de silicona detrs de la visera anti-lluvia
de la pletina. (C)
5 Pase el cable de unin
6 Conecte los 6 conductores del cable (E) a la parte trasera de la pletina
(VIDEO : hilo amarillo - GND : hilo negro - SPK : hilo marrn - MIC : hilo blanco - KEY : hilo verde - VCC : hilo
rojo)
7 Comprobar la orientacin de la cmara (G) (fig.8)
8 Monte de nuevo la pletina y vuelva a atornillar el tornillo (A)
Para terminar la instalacin de la parte externa, , inserte 4 pilas alcalinas de 1,5 V de tipo LR 20 en el compartimento para pilas de la caja electrnica. Levante la tapa del compartimento e introduzca las pilas respetando la
polaridad . Cierre el compartimento y vuelva a montar la tapa superior de la caja electrnica utilizando 6 tornillos
cruciformes ( H ), procurando no deformar la junta de estanqueidad. Puede utilizar una fuente de alimentacin de
baja tensin, procedente de un transformador tipo WETR 14602 SER.R1 o de un automatismo de portal (12 o 24
V / ). Deber conectarse a los terminales
y + a la caja electrnica (fig.9). En el caso de una tensin continua
V , tener mucho cuidado con la polaridad (- +).
~ ~
Atencin : En caso de que no se utilicen las pilas sino ms bien una fuente 12/24 V /
portal) conectarlo como se indica a continuacin (Fig. 9).
Si utiliza una fuente 12/24 V / es obligatorio retirar las pilas.
No utilice pilas recargables.
(automatismo de
ES4
6. PRESENTACIN DE LOS ICONOS
b. Instalacin del monitor (g.4)

Instale el monitor a aproximadamente 1,60 m del suelo (para que las condiciones de recepcin sean ptimas).
Escoja un lugar donde no haya paredes de hormign armado, espejos, estanteras de metal, etc.
Aleje el monitor de todo aparato susceptible de producir interferencias elctricas fuertes.
Cualquier entorno elctrico fuerte (Wi-Fi sobre todo) puede provocar interferencias yperturbar la utilizacin del
sistema.
Para una instalacin sobre mesa, desplegar el pie (A) y colocar el monitor sobre una superficie estable.
Conexin del monitor :
1. Conecte el cable del adaptador 5 V a la entrada de alimentacin del monitor
2. Enchufe el adaptador a una toma de corrienter 230 V
Atencin : El monitor slo deber colocarse sobre supercies duras y estables.
5. MODO DE EMPLEO
El monitor debe estar en modo espera y el indicador
estar encendido en azul. (Este modo se activa con la
tecla
). Cuando un visitante llame, el telfono sonar durante 8 segundos. Simultneamente, la pletina de calle
emitir una seal sonora que confirma que la llamada ha sido transmitida. Usted dispone de unos 30 segundos
aproximadamente para responder a la llamada . Pasado este tiempo, la caja electrnica se vuelve a poner en
reposo. Si la caja electrnica est alimentada por una fuente 12 o 24 V / , usted puede forzar la comunicacin con
la placa de la calle pulsando la tecla
Si la caja electrnica est alimentada con pilas, se pierde la llamada.La
conversacin se establece durante una llamada pulsando la tecla
y
. Puede aumentar el volumen pulsando
la tecla
.
La duracin inicial de la comunicacin es de 30 segundos, pero se puede prolongar 30 segundos ms pulsando la
tecla
o
(durante una conversacin). Usted puede poner fin a la comunicacin pulsando
o
durante
3 segundos.
a. Estado de la seal
b. Modo Registro
c. Estado de la pila de la placa de la calle
- Batera llena (amarilla)
- Batera dbil (roja/parpadeante)
d. Grabacin manual
e. : sin tarjeta SD
F : tarjeta SD completa
Err. : error tarjeta SD
: tarjeta SD bloqueada
: Registro autorizado
f. Indicador de la tarjeta SD
g. Capacidad de la tarjeta SD
h. Prdida de seal
I. Toma de la lnea
j. Hora del registro
k. Fecha y hora
D
E
F
6' *
5(&
G H I
J
126,*1$/
K
N
M

L
7. MEN
Pulse men ESC durante 2 segundos para ver las siguientes pantallas (
para hacer desfilar, OK para validar)
1 Caso de una grabacin a partir del monitor: (presencia de tarjeta SD obligatoria) :

-Si la opcin visiting record (Registro de visitas; vase b. pg. 7) no est activada, puede iniciar/detener la graba.
cin pulsando
-Si la opcin visiting record (Registro de visitas) est activada, la grabacin se inicia automticamente en cuanto
se realiza una llamada en la placa exterior.
2 Caso de una instalacin con cerradero elctrico (o cerradura elctrica) :
La apertura del cerradero elctrico slo es posible durante una comunicacin (o permanentemente Si la caja electrnica est alimentada en baja tensin), pulsando brevemente el botn
, luego pulsando brevemente el botn (1
seg.).
Atencin : Solamente es posible un solo mando de abertura por llamada cuando funciona con pilas.
Nota : para garantizar la apertura, es indispensable que el cerradero o cerradura estn provistos de una memoria
mecnica.
a. Ajustes Cmara
b. Ajustes Registro
3 Caso de una instalacin con sistema de apertura automtico accionado mediante el cierre de un contacto:
Atencin : El portal automtico se puede abrir y cerrar que si la caja electrnica est alimentada en baja
tensin. Pulsando brevemente el botn
durante 3 segundos durante una conversacin.
- Cuando no hay conversacin, pulse
y despus
durante 3 segundos.
Recuerde : La recepcin de una llamada en el monitor nicamente es posible si est en modo espera y aparejada
con la placa de la calle (vase captulo Aparejamiento).
Importante : Este videotelfono tiene un alcance de 300 m campo libre. Sin embargo, dicho alcance podr verse
considerablemente reducido en funcin del entorno (cerca de perturbaciones radio, etc.).

ES5
d. Parmetros
ES6
8. APLICACIN
a. Ajustes Cmara
1 Luminosidad de la cmara :
Pulsar OK para entrar en la barra de ajuste de la luminosidad
Pulsar para ajustar la luminosidad, presionar OK para confirmar y salir del men
2 Aparejamiento :
Pulsar , luego pulsar OK para entrar en el men, lel sistema se pondr en funcin durante 60 segundos. Hacer
una llamada desde la placa, luego pulsar la llave de aparejamiento (fig.5-1) en la caja electrnica en 60 segundos.
Una vez realizado el aparejamiento, aparecer la imagen de la placa de la calle
.Nota : Se aconseja encarecidamente aparejar la caja electrnica con la placa de la calle antes de la instalacin.
Pulsar ESC para salir
3 Modo supresin :
3
Pulsar DEL para entrar en el modo
Utilizar para suprimir el fichero seleccionado o para suprimirlo todo.
Pulsar OK y seleccionar el icono luego presionar OK para suprimirlo.
d. Parmetros
1 Ajustes fecha y hora:
Pulsar para seleccionar la fecha u hora deseada
Pulsar para modificar el reloj del sistema.
Pulsar OK para confirmar los ajustes
2Versin de programa informtico : Se visualizar la versin del sistema para la placa de la calle y el monitor
3 Formato TV : Utilizar
para seleccionar el sistema TV entre NTSC y PAL (recomendado).
4 Ajustes por defecto : Pulsar OK para entrar en el men, seleccionar
, luego pulsar OK.
5;9HU
7;9HU
b. Ajustes Registro (las secuencias registradas estn en formato .avi)

1 Modo Registro : Utilizar
para elegir ON/OFF
Nota : Cuando llaman, si usted no responde, el monitor registrar durante 30 segundos a su visitante. El testigo
notificar una grabacin no leda
2 Formateado de la tarjeta SD:
Pulsar OK para entrar en la funcin formateado
Seleccionar y presionar OK para formatear.
Nota: Comprobar que la tarjeta SD est desbloqueada (indicacin p11). Para una primera utilizacin se recomienda formatear la tarjeta SD antes de la utilizacin.
3 Aplastar un fichero: Cuando la tarjeta est llena, este modo permite sustituir definitivamente las primeras
grabaciones por las ms recientes.
Utilizar
para seleccionar ON/OFF, , presionar OK para guardar
3
9. CARACTERSTICAS TCNICAS
a. Datos tcnicos :
- Especicaciones RF
- Frecuencia radio 2,402-2,454 GHz
- Modulacin digital GFSK (Frequency Hopping Spread Spectrum)
- Anti-interferencias.
- Ancho de banda: 2 MHz
ES7

- Pantalla: 18 cm de diagonal
- Alimentacin del monitor: 5V
- Consumo: 900 mA
- Dimensiones: 220 x 143 x 35 (mm)
- Temperatura de uso: -10C a +40C aproximadamente.
DEL
OK
ESC
1 Modo visualizacin :
Pulsar OK para entrar en los ficheros registrados.
Seguir presionando OK para leer y detener el fichero.
2 Modo lectura :
Pulsar para regular el volumen
Pulsar para volver hacia atrs en 2x, 4x, 8x y 16x
Pulsar ESC para parar y salir
ES8
c. Alimentacin
- Adaptador 230 V /5 V 1A
En caso de corte del cordn de alimentacin velar por respetar la polaridad
d. Cmara (PL WEVA)

- Referencia : 820659
- T de funcionamiento: -10C a 45C aproximadamente.
- Cmara : C-MOS
- Lente : H : 62 V : 42
- Sensibilidad < 8 lux
- IP 44
CONDICIONES DE GARANTA : Este aparato est garantizado, piezas y mano de obra en nuestros talleres. La garanta no cubre: los consumibles (pilas, bateras, etc) y los daos causados por: mala utilizacin, mala
instalacin, intervencin exterior, deterioro por choque fsico o elctrico, cada o fenmeno atmosfrico.
No abra el aparato para no perder la garanta.
Si tiene que enviarlo al servicio posventa, proteja la pantalla para evitar posibles rayaduras.
Lmpielo simplemente con un trapo suave, sin disolventes. Antes de proceder a la limpieza, desenchufe el aparato.
Atencin : No utilice ningn producto de limpieza a base de cido carboxlico, alcohol o similares. Adems
de poder deteriorar el aparato, los vapores que desprenden son explosivos y peligrosos para su salud.
No utilice ningn utensilio que pueda ser conductor de corriente (cepillo metlico, utensilio punzante, etc.) para
la limpieza.
El tique de caja o la factura dan prueba de la fecha de compra.
10. OPCIONES
12. INSTRUCCIONES DE SEGURIDAD
Todos los cerraderos elctricos Extel

Todos los cerrojos elctricos Extel
Todas las motorizaciones Extel
WE 8111 BIS
11. ASISTENCIA TCNICA/ GARANTA

Avera
causa
Solucin
Ninguna funcin
No hay alimentacin
Comprobar la conexin del adaptador

Comprobar que la batera del monitor est
cargada correctamente (led azul
)
Comprobar la tensin de las pilas en la caja
electrnica
La placa de la calle suena

pero no el monitor
Problema de acoplamiento
Problema de alcance
Acoplar la caja electrnica con el monitor

Acercar al monitor de la caja electrnica y
comprobar cuando el aparato
No hay sonido exterior

ni interior
Agujero del micro tapado

por un insecto
Desatascar y limpiar el agujero delicadamente

(atencin con no daar la clula micro)
Comprobar la conexin del hilo blanco o
marrn en la placa de la calle
Mala Imagen
Problema de configuracin
Ir al men y comprobar el formato vdeo

(p.8)
Imposible registrar en SD
card
Problema de proteccin
Comprobar que la tarjeta no est bloqueada

o llena (ver indicaciones en la pantalla p.6-e)
(QFDVRGHQHFHVLGDGQXHVWURVLWLRWpFQLFRwww.c-extel.com
VHHQFXHQWUDDVXGLVSRVLFLyQ
Asistencia tcnica : 902 109 819
[email protected]
/D~OWLPDYHUVLyQGHODVLQVWUXFFLRQHVVHSXHGHQEDMDUHQFRORUHQwww.c-extel.com
ES9
Los daos ocasionados por no respetar el manual de instrucciones conducirn a la anulacin de la garanta. EXTEL
no se responsabilizar de los daos que resulten de esta falta de conformidad.
Tampoco se responsabilizar de los daos que puedan sufrir los bienes o las personas por la incorrecta manipulacin
del sistema o el incumplimiento de las instrucciones de seguridad.
Este producto se ha fabricado en el ms absoluto respeto de las instrucciones de seguridad. Para garantizar
este estado y optimizar la utilizacin del producto, el usuario debe respetar las instrucciones y advertencias de
seguridad contenidas en este manual.
El usuario de este sistema tendr que responsabilizarse de este ltimo y deber comprobar que la videovigilancia
est permitida por la ley vigente en el pas de utilizacin.
: Este smbolo indica un riesgo de choque elctrico o un riesgo de cortocircuito.

Slo podr utilizar este producto con una tensin comprendida entre: 100 240 voltios y 50 60 hertzios. Nunca
intente utilizar este aparato con una tensin diferente.
- Compruebe que todas las conexiones elctricas del sistema sean conformes a las instrucciones de uso.
- Si este sistema se instala en establecimientos comerciales, habr que respetar las normas de prevencin de
accidentes para las instalaciones elctricas.
- Si se instala en establecimientos escolares, talleres, etc., ser necesaria la presencia de personal cualicado para
controlar el funcionamiento de los aparatos electrnicos.
- Respete las instrucciones de uso de los dems aparatos conectados al sistema (vdeo, TV, PC por ejemplo).
- En caso de tener dudas sobre el modo de funcionamiento o la seguridad de los aparatos, pngase en contacto
con una persona cualicada.
- Nunca enchufe o desenchufe los aparatos elctricos con las manos mojadas.
- Cuando instale este producto, compruebe que los cables de alimentacin no corren el riesgo de ser daados.
- Nunca cambie los cables elctricos daados usted mismo! En tal caso, squelos y recurra a una persona cualicada
para que los sustituya.
ATENCIN
Avisa al usuario de la presencia de instrucciones importantes relativas al

mantenimiento (la reparacin) en la documentacin que acompaa al aparato.
Avisa al usuario de la presencia detensiones peligrosas no aisladas dentro de la caja del producto y
sucientemente importantes como para representar un riesgo de electrocucin para las personas.
ES10
SUMRIO
1. INSTRUES DE SEGURANA
INSTRUES DE SEGURANA.. .....................................p.2
Importante !
Leia o manual de utilizao com cuidado antes de instalar ou utilizar este produto.
Se instalar este produto para outros, pense em deixar o manual ou uma cpia ao utilizador nal.
DESCRITIVO......................................................................................p.2
Advertncia :
Os diferentes elementos devero ser desmontados apenas por um tcnico autorizado.
NOMENCLATURA ........................................................................p.3
a. Monitor
b. Placa de rua, cmara exterior
INSTALAO ...................................................................................p.3
a. Instalao da caixa electrnica e da placa de rua (cmara)
b. Instalao do monitor
MODO DE UTILIZAO ........................................................p.5
APRESENTAO DOS CONES .......................................p.6
MENUS ...................................................................................................p.6
APLICAOES................................................................................p.7
a. Regulaes Cmara
b. Regulaes Gravao
c. Lista do evento
d. Parmetros
CARACTERSTICAS TCNICAS .......................................p.8

a. Especicidades tcnicas
c. Alimentao
d. Cmara(PL WEVA)
10 OPES ................................................................................................p.9
11 ASSISTNCIA TCNICA
12 INSTRUES
Medidas de segurana :
Para uma explorao em completa segurana deste sistema, essencial que os instaladores, utilizadores e tcnicos
sigam todos os procedimentos de segurana descritos neste manual.
Advertncias especcas e smbolos de ateno so indicados nos elementos se necessrio.
Ateno :
O utilizador deste sistema responsvel e deve ateno verificar se a vigilncia conforme com a lei em vigor
no pas de utilizao.
Embora digitais, as cmaras so sujeitas interferncia dos telefones sem os, dos microondas e outros dispositivos
sem os que funcionam em 2,4 GHz (WIFI por exemplo).
Mantenha o sistema a mais de 3 m dos dispositivos durante a instalao e a utilizao.
Nota :
Todos os compostos electrnicos activos so sensveis s cargas electrostticas humanas. Como consequncia, antes de
qualquer interveno nestes produtos, imperativo evacuar a electricidade esttica de que o utilizador portador (por
exemplo: mantendo um dedo sobre um dos 2 contactos de pilhas da caixa, o vermelho ou o preto).
Qualquer estrago resultante do no respeito por este conselho no ser abrangido pela garantia.
2. DESCRITIVO (g. 1)
1 Monitor
2 Suporte mural
3 Adaptador com cha
4 Placa de rua
5 Pala de proteco para a chuva
6 Suporte Antena
7 Cabo de conexo para chapa-testa ou fechadura elctrica
8 Cabo Antena 2 m aproximadamente
9 Caixa electrnica
10 Antena
/ GARANTIA ........................p.9
DE SEGURANA .....................................p.10
Generalidades
Este videofone composto de um posto de resposta interior com ecr a cores e de uma placa de rua com intercomunicador e cmara que permite ver e comunicar com o visitante que tocou na campainha. Para um uso eficaz,
leia atentamente este manual de instrues.
Ateno : Se efectuar um teste com o seu videofone antes de o instalar (teste curta distncia) respeite
um mnimo entre o monitor e a placa de rua de aproximadamente 3 m (risco de saturao, efeito larsen).
PT1
PT2
3. NOMENCLATURA
a. Monitor (g. 2)
1. Indicador: Gravao em curso (pisca)
2. Indicador de gravao no vista
3.Tomada de linha udio // Colocao em funcionamento
4. Funo DEL (ELIMINAR) no menu // Acesso ao monitor
5. Comando chapa-testa/fechadura e/ou automatismo de porto (vlido apenas se o ecr estiver aceso).
a. Um impulso de 2 segundos para o comando de um automatismo de porto.
b. Um impulso curto (inferior a 1 segundo) para o comando de uma chapa-testa ou de uma fechadura elctrica. //
Validao OK
6. Acesso ao menu // EXIT (SAIR)
7. Cursor para baixo // Gravao manual
8. Cursor para a direita // Controlo do volume
9. Micro para a coversa
10. Antena
11. Leitor SD Card (32 Go Mx. - 1 Go Mn.)
12. Tomada para a cha 5 V o adaptador (adaptador a ligar numa instalao conforme com as normas em vigor:
NFC 15 100 para a Frana)
13. Suporte de abrir
b. Placa de rua, cmara extrior (g. 3)
1. IR LED, viso de noite. (luz invisvel a olho nu)
2. Objectivo da cmara C-MOS com ris automtica orientvel (nas costas da cmara).
3. Altifalante: permite fazer-se ouvir no exterior.
4. Boto de chamada: quando carrega neste boto o porta nome acende-se e a campainha ouve-se no interior. e
no exterior.
5. Etiqueta para o nome e luzinha :
- se a caixa electrnica alimentada por pilhas o sinal luminoso s se acende aps uma chamada.
- se a caixa electrnica alimentada em baixa tenso (12 ou 24 V / ), o sinal luminoso acende-se quando a
penumbra demasiado importante,
- levantar delicadamente, com a ajuda de uma pequena chave de fendas, a proteco plstica e introduzir a etiqueta com o nome.
6. Microfone : permite ao visitante estabelecer comunicao com o interior.
4. INSTALAO
Importante : Este videofone tem um alcance de 300 m campo livre. No entanto, este pode ser consideravelmente reduzido conforme o ambiente (proximidade de perturbaes rdio, )
Torna-se portanto obrigatrio testar o conjunto dos elementos que constituem o intercomunicador antes de os
xar para determinar a melhor posio da placa de rua e do monitor.
a. A parte xa (parte exterior) do seu intercomunicador sem os

Composio : - uma placa de rua
- uma caixa electrnica que contm o emissor-receptor rdio e as pilhas (no fornecidas).
- uma pala de proteco para a chuva
- uma antena
Importante : No expor a cmara directamente ao sol, ou sobre uma superfcie reflexiva.
Conselho: Recomendamos fazer passar os cabos numa conduta de proteco, para os proteger dos choques e
das intempries.
Instalao da caixa electrnica (g.5)

Utilizar o cabo de 6 condutores para a ligao entre a caixa e o painel da rua, respeitando as cores (Fig. 8).
Introduzir 4 pilhas de tipo LR20 na caixa electrnica, de modo a proceder aos testes de alcance de rdio. A
antena dever ser o mais afastada possvel de qualquer superfcie metlica, fonte de parasitas ou obstculos que
possam haver entre a sua caixa e a sua casa ; no pode haver nenhum contacto entre a antena e folhas ou ramos
de rvore. Ela dever igualmente ser colocada suficientemente alta (a cerca de 1,60 m do solo) e na vertical, a fim
de obter as melhores performances.
Note : Se a transmisso de qualidade insuficiente, utilizar o cabo de 2 m fornecido para encontrar uma melhor
posio por antena.
Uma vez determinada a localizao ideal, proceder montagem definitiva:
1Desmontar a parte superior da caixa desaparafusando os 6 parafusos de estrela (H)
Ateno : no tocar directamente no circuito electrnico (ver nota captulo : Importante pgina 2)
2Com a ajuda de 2 parafusos fixar a caixa atravs dos 2 furos (J) situados em cima e em baixo, a antena encontrase em cima direita.
3No esquecer de comear por fazer passar o cabo de ligao placa de rua atravs do furo do pilar e 2 fios (F)
para a ligao caixa/chapa-testa elctrica ( portanto preciso perfurar o pilar ou a parede em questo). O conexo (F) deve
de seguida ser ligados fechadura ou chapa-testa elctrica e sobre o fixao LOCK da caixa electrnica.
Nota : No instalar outra antena que no
Ateno : Em caso nenhum, deve colocar as pilhas antes de ter terminado completamente a instalao
Instalao da placa de rua (cmara) (g.6 / 7 / 8)

Conselho : recomenda-se fazer passar os cabos (o da placa de rua e o da chapa-testa elctrica) dentro de uma
conduta de proteco, a fim de os proteger dos choques e das intempries. No cortar as sobras do cabo 6
condutores, a fim de evitar problemas de oxidao ou de mau contacto. Mais vale enrol-lo sobre si mesmo entre
o pilar e a caixa electrnica.
1Desaparafusar o parafuso de estrela (A)
2Inclinar a placa (B) para a frente e solt-la por baixo
3Fixar, com a ajuda de 3 parafusos (K), a pala de proteco para a chuva (C) ao nvel da parede, de forma a que o furo
(D) fique de frente para o cabo (E)
4A fim de evitar infiltraes que escorrem pelo muro, pr silicone por trs da pala de proteco para a chuva (C)
5Passar o cabo de ligao.
6Ligar os 6 fios (E) por trs da placa.
VIDEO (amarelo) GND (preto) SPK (castanho) MIC (branco) KEY (verde) VCC (vermelho)
7 Verificar a orientao da cmara (G) (fig.8)
8Montar a placa, tornar a pr o parafuso (A)
Para terminar a instalao da parte exterior, inserir 4 pilhas de 1,5 V tipo LR 20, alcalina, no compartimento das
pilhas da caixa electrnica, depois de ter inclinado a patilha, certifique-se que est a respeitar a polaridade. Tornar
a fechar com a patilha e tornar a montar a parte de cima da caixa electrnica com a ajuda dos 6 parafusos de
estrela (H), tendo algum cuidado para no deformar a junta de impermeabilizao. Pode utilizar uma fonte de alimentao baixa tenso, proveniente de um transformador tipo WETR 14602 SER.R1 ou de um automatismo de
porto (12 ou 24 V / ). Ela dever ser ligada nos terminais
e + na caixa electrnica. No caso de uma tenso
contnua V , prestar muita ateno na polaridade (- +).
~ ~
Ateno : Se no utilizar as pilhas mas uma fonte 12/24 V /

cado Fig. 9
Se utilizar uma fonte de 12/24V /
No utilizar pilhas recarregveis.
PT3
(automatismo de porto) ligar como indi-
imperativo retirar as pilhas.
PT4
b. Instalao do monitor (g.4)

IInstale o monitor a aproximadamente 1,60 m acima do solo (para condies de recepo ptimas).
Para a instalao do monitor, escolha um lugar afastado dos muros de beto armado, espelhos, estantes de metal,
etc...
Afaste o monitor dos aparelhos que criam interferncias elctricas fortes.
Qualquer ambiente elctrico forte pode causar interferncias e perturbar a utilizao (WIFI em especial).
Para a instalao sobre uma mesa, abrir o p (A) e colocar o monitor sobre uma superfcie estvel.
Conexo do monitor:
1. Ligar o cordo do adaptador 5 V na cha de alimentao do monitor (B)
2. Ligue o adaptador numa tomada 230 V
3. Utilizao sem adaptador:
Ateno : Colocar unicamente o monitor sobre superfcies duras e estveis.
5. MODO DE UTILIZAO
O monitor deve estar em modo presena, o sinal luminoso
aceso em azul. (este modo activa-se com a tecla
) Deve ser colado sobre uma superfcie estvel, com a antena aberta. Quando um visitante chama, o seu combinado toca durante cerca de 8 segundos. Ao mesmo tempo, a placa de rua emite um som confirmando que a
chamada foi transmitida. Tem cerca de 30 segundos para responder chamada. Passado esse prazo, a caixa electrnica tornam ao modo de vigilncia. Si sua caixa electrnica alimentada por uma fonte 12 ou 24 V / , pode forar
a comunicao com a placa de rua apoiando a tecla
. Se a caixa electrnica alimentada por pilha a chamada
perdida.
A conversa estabelece-se durante uma chamada apoiando na tecla
e
.
Pode aumentar o volume ao premir a tecla
A durao inicial da comunicao fixada nos 30 segundos. Mas ela pode ser aumentada em mais 30 segundos
suplementares carregando na tecla
ou
durante a comunicao.
Pode cortar a comunicao apoiando em
ou
durante 3 segundos
6. APRESENTAO DOS CONES

a. Estado do sinal
b. Modo de Registo
c. Estado da pilhas da placa de rua
- Bateria carregada (amarelo)
- Bateria fraca (vermelho/pisca)
d. Gravao manual
e. : sem carta SD
F : carta SD completa
Err. : erro carta SD
: carta SD bloqueada
: rRegravao autorizada
f. Indicador da carta SD
g. Capacidade da carta SD
h. Perda de sinal
i. Tomada da linha
j. Hora do registo
k. Data e hora
D
6' *
5(&
G H I
J
F
E
126,*1$/
K
N
M

L
7. MENUS
Prima no menu durante 2 segundos. para fazer aparecer os ecrs seguintes (
validar).
para fazer desfilar, OK para
1 No caso de uma gravao a partir do monitor: (presena obrigatria de carto SD)

- Se a opo visiting record (ver b., pg. 7) (Registo de visitas) no estiver activada, possvel iniciar/interromper
.
uma gravao ao premir
- Se a opo visiting record (Registo de visitas) estiver activada, a gravao inicia automaticamente aquando de
uma ligao a partir do painel da rua.
2 No caso de uma instalao com chapa-testa elctrica (ou fechadura elctrica) :
A abertura da chapa-testa elctrica apenas possvel no perodo em que dura uma comunicao (em permanncia
se a caixa electrnica alimentada em baixa tenso), apoiar resumidamente sobre boto
, seguidamente apoiar
resumidamente sobre boto (1 sec.).
a. Regulaes Cmara
b. Regulaes Gravao
Ateno : Pode cortar a comunicao apoiando em funcionamento com pilhas.

Nota : a fim de assegurar a abertura, a chapa-testa ou a fechadura devem ser imperativamente equipadas com uma
memria mecnica.
3 No caso de uma instalao com sistema de abertura automtica comandada pelo fecho de um contacto :
Ateno : possvel abrir e fechar o porto automtico se a caixa electrnica alimentada em baixa tenso.
Earregando ligeiramente no boto
durante 3 segundos aquando de uma comunicao.
- Fora de comunicao premir
e depois
durante 3 segundos.
Nota : A recepo de uma chamada no monitor s possvel se ele est em modo presena e aparelhado com
a placa de rua (ver captulo Aparelhagem).
Importante : Este videofone tem um alcance de 300 m campo livre. No entanto, este pode ser consideravelmente
reduzido conforme o ambiente (proximidade de perturbaes rdio, )
PT5
c. Lista do evento
d. Parmetros
PT6
8. APLICAO
a. Regulaes Cmara
1 Luminosidade da cmara :
Premir em OK para entrar na barra de ajustamento da luminosidade
Premir em para ajustar a luminosidade OK carregar para confirmar e sair do menu
2 Aparelhagem :
Premir em , e em seguida em OK para entrar no menu, lo sistema colocar-se- em funo durante 60 segundos. Lanar uma chamada a partir da placa, em seguida premir na chave de aparelhagem (fig.5-1) na caixa electrnica durante 60 segundos. Quando a aparelhagem estiver realizada, aparecer a imagem da placa de rua.
Nota : fortemente aconselhado aparelhar a caixa electrnica com a placa de rua antes da instalao.
Premir em ESC para sair
3 Modo supresso :
3
Premir em DEL para entrar no modo
Utilizar para suprimir o ficheiro seleccionado ou para suprimir tudo.imer.
Premir em OK e seleccionar , em seguida premir em OK para o suprimir
d. Parmetros
1 Regulaes data/hora :
Premir em para seleccionar a data ou a hora desejada.
Premir em para modificar o relgio do sistema.
Premir em OK para confirmar as regulaes.
2 Verso do software : Visualiza-se a verso do sistema para a placa de rua e o monitor
3 Formato TV : Utilizar
para seleccionar o sistema TV entre NTSC e PAL (recomendado).
4 Regulaes por defeito : Premir em OK para entrar no menu, seleccionar
, em seguida premir em OK
Premir em ESC para sair.
5;9HU
7;9HU
b. Regulaes Gravao (as sequncias registadas esto formato .avi)

1 Modo Gravao: Utilizar
para escolher ON/OFF
Nota : Numa chamada, se no responder, o monitor gravar durante 30 segundos o seu visitor.
O indicador luminoso
indicar uma gravao no vista
2 Formatao da carta SD:
Premir em OK para entrar na funo formatao
Seleccionar e Premir em OK para formatar
Nota : Verificar se a carta SD est desbloqueada (indicao p 6-e). Para uma primeira utilizao recomendamos
formatar a carta SD antes da utilizao.
3 Suprimir um ficheiro : No caso em que a carta est cheia, este modo permite escolher a substituio definitiva das primeiras gravaes pelas mais recentes.
Utilizar
para seleccionar ON/OFF, premir em OK carregar para salvaguardar
9. CARACTERSTICAS TCNICAS
a. Especicidades tcnicas :
PT7
c. Lista do evento
1 Modo visualizao :
Premir em OK para entrar nos ficheiros registados.
Continuar a carregar OK para ler e parar o ficheiro
2 Modo leitura :
Premir em para regular o volume
Premir em para voltar para trs em 2x, 4x, 8x et 16x
Premir ESC para parar e sair
- Referncia : 810268
- Ecr : 18 cm em diagonal
- Alimentao do monitor: 5V
- Consumo : 900 mA
- Dimenses : 220 x 143 x 35 (mm)
- Temperatura de utilizao: - 10C+ a 40 C aproximadamente
DEL
OK
ESC
RF especicao
- Frequncia radio 2,402-2,454 GHz
- Modulao numrica GFSK (Frequency Hopping Spread Spectrum)
- Anti-interferncia.
- Amplitude de banda de cadeia: 2MHz
PT8
c. Alimentao
Adaptador 230 V /5 V 1A
Em caso de corte do cordo de alimentao respeite a polaridade.
d. Cmara (PL WEVA)

- Referncia : 820659
- Dimenses : 150 x 115 x 42 mm
- T de funcionamento: - 10C a 45 C aproximadamente.
- Cmara : C-MOS
- Lentilha : H : 62 V : 42
- Sensibilidade < 8 lux
- IP 44
Ateno :No empregar nenhum produto ou gasolina de depurao carboxlico, lcool ou similar. Alm
de correr o risco de danicar o seu aparelho, os vapores so igualmente perigosos para a sua sade e explosivos.
No empregar nenhum instrumento que pode ser condutor de tenso (escova de metal, instrumento pontiagudo
ou outro) para a limpeza.
10. OPES
O talo de caixa ou a factura comprova a data de compra.
Todas as chapa-testas elctricas Extel

Todas as fechaduras elctricas Extel
Todas as motorizaes Extel
WE 8111 bis
12. INSTRUES DE SEGURANA
11 ASSISTNCIA TECHNICA - GARANTIA

Avaria
Causa
Soluo
Nenhuma funo
Sem alimentao
Verificar a ligao do adaptador

Verificar se a bateria do monitor est correctamente carregada (led azul
)
Verificar a tenso das pilhas na caixa electrnica
A placa de rua toca mas o

monitor no
Problema de emparelhamento
Problema de alcance
Emparelhar a caixa electrnica com o monitor

Aproximar o monitor da caixa electrnica e
verificar quando o aparelho ...
Sem som no exterior e

no interior
Orifcio do micro entupido

por um insecto
Desentupir e limpar o orifcio delicadamente

(ateno para no estragar a clula micro)
Verificar a ligao do fio branco ou castanho
na placa de rua
M Imagem
Problema de configurao
Ir para o menu e verificar o formato vdeo

(p. 8)
Impossvel gravar na SD
card
Problema de proteco
Verificar se a carta no est bloqueada ou

completa (ver indicaes ecr p. 6-e)
6HQHFHVViULRRQRVVRVtWLRWpFQLFRHVWijVXDGLVSRVLomRwww.c-extel.com
Servio de apoio ao cliente : 707 201 138
OWLPDYHUVmRGRPDQXDOGRZQORDGDFRUHVHP
www.c-extel.com
PT9
CONDIES DE GARANTIA : Este aparelho garantido, peas e mo-de-obra nas ocinas.

A garantia no cobre: os consumveis (pilhas, baterias, etc.) e os danos ocasionados por: uma m utilizao, m
instalao, interveno exterior, deteriorao por choque fsico ou elctrico, queda ou fenmeno atmosfrico.
No abrir o aparelho para no perder a cobertura da garantia.
Aquando de uma eventual devoluo ao SAV, proteger o ecr a fim de evitar os riscos.
Limpeza apenas com um pano macio, sem solventes.
Antes da limpeza, desligar ou colocar fora de tenso o aparelho.
Os danos provocados pela falta de conformidade com o manual conduzem expirao da garantia. No assumiremos
nenhuma responsabilidade pelos danos que resultarem disso!
No assumiremos nenhuma responsabilidade relativa a qualquer dano, sobre os bens ou pessoas, causado por uma
m manipulao ou falta de conformidade com as instrues de segurana.
Este produto foi fabricado no respeito total das instrues de segurana. A m de manter este estatuto e de
assegurar a melhor explorao do produto, o utilizador deve observar as instrues e advertncias de segurana
contidas neste manual.
O utilizador deste sistema responsvel e deve vericar se o videovigilncia est conforme com a lei em vigor no
pas de utilizao.
: Este smbolo indica um risco de choque elctrico ou um risco de curto-circuito.
- Deve utilizar este produto apenas com uma tenso compreendida entre: 100-240 Volts e 50-60 hertz. Nunca tente
utilizar este aparelho com uma tenso diferente.
- Preste ateno para que todas as conexes elctricas do sistema estejam conformes com as instrues de
utilizao.
- Nos estabelecimentos comerciais, assegure-se de respeitar as regras de preveno dos acidentes para as
instalaes elctricas.
- Nas escolas, os equipamentos de formao, as ocinas a presena de um pessoal qualicado necessria para
controlar o funcionamento dos aparelhos electrnicos.
- Respeitar as instrues de utilizao dos outros aparelhos ligados ao sistema. (videogravador,TV, PC por exemplo)
- Contacte uma pessoa experiente se tiver dvidas acerca do modo de funcionamento ou da segurana dos
aparelhos.
- Nunca ligar ou desligar os aparelhos elctricos com as mos molhadas.
- Na instalao deste produto, vericar os cabos de alimentaes mesmo se estes no podem ser danicados
- No substitua nunca os cabos elctricos danicados voc prprio! Neste caso, retire-os e contacte uma pessoa
experiente.
ATENO
Adverte o utilizador da presena de instrues importantes relativas utilizao e

manuteno (a reparao) na documentao que acompanha o aparelho.
Adverte o utilizador da presena de tenses perigosas , no isoladas no interno da caixa do

produto, de uma importncia suciente para representar um risco de electrocusso para as
pessoas.
PT10
1. SAFETY INSTRUCTIONS
SUMMARY
SAFETY INSTRUCTIONS. ......................................................p.2
DESCRIPTION..................................................................................p.2
COMPONENTS ...............................................................................p.3
a. Monitor
b. Outdoor station, exterior camera
INSTALLING ......................................................................................p.3
a. Installing of outdoor station (camera) & control box board
b. Installing of monitor
DIRECTIONS FOR USE ............................................................p.5
SCREEN ICON ................................................................................p.6
MENU ......................................................................................................p.6
APPLICATIONS ..............................................................................p.7
a. Camera Setup
b. Recorder Setup
c. Event List
d. System Setup
TECHNICAL SPECIFICATIONS ............................................p.8

a. Technical specications
c. Power supply
d. Camera (PL WEVA)
10 OPTIONS .............................................................................................p.9
11 TECHNICAL ASSISTANCE
12 SAFETY
- GUARANTEE ..............p.9
INSTRUCTIONS .....................................................p.10
Important !
Please read the user manual thoroughly before installing or using this product.
If you install this product for other people, please give the manual or a copy to the end user.
Warning :
The different elements can only be dismantled by an authorised technician.
Safety instructions :
To safely use this system, it is essential the tters, users and technicians follow the safety procedures described
in this manual.
Specic warnings and caution symbols are indicated on the elements if necessary.
Warning :
The user of this system is responsible for checking whether the surveillance is compliant with the law in force in
the country of use.
Even if they are digital, the cameras are subject to interference of wireless phones, microwave ovens and other
wireless appliances operating on 2.4 GHz (WIFI for example).
Keep the system at more than 3 m of the appliances during installation and use.
N.B. :
All the active electronic components are sensitive to human body electrostatic discharges. Always drain the static electricity from your body (such as by touching a nger to one of the battery contacts red wire or black wire in the box)
before servicing them.
The warranty does not cover any damage resulting from failure to comply with these instructions.
2. DESCRIPTION(g. 1)
1 Monitor
2 Wall mounting
3 Mains adapter
4 Outdoor station
5 Rain Shield
6 Antenna bracket
7 Connection cable for electrical strike or lock
8 Antenna cable 2m approx.
9 Control Box Board
10 Antenna
Generality
This videophone consists of an interior unit with a colour, liquid crystal display screen, a free hand interphone, and
a surface-mount exterior outdoor station which makes it possible to see and speak to the visitor who as rung. To
make the most of the videophone, please take the time to read this instruction manual thoroughly, and do not
lose it.
Warning : If you try your video door phone before installing it (short distance trial) respect a minimum of
3 m distance between the monitor and the roadside panel (risk of saturation, Larsen effect).
GB1
GB2
Installing the control box board (g.5)
3. COMPONENTS
a. Monitor (g. 2)
1. Indicator: Recording in progress (ashes)
2. Unread recording indicator
3. Plug for audio line // Start-up
4. DEL function on menu // Monitor access
5. Control of a strike/lock and/or of an automatic gate opener (valid only if the screen is switched on) // validation
OK
a. A 2-second pulse for the control of an automatic gate opener.
b. A short press (less than 1 second) for the control of a strike or an electric lock.
6. Menu Access // EXIT
7. Lower cursor // manual recording
8. Right cursor // Volume adjustment
9. Microphone for the conversation
10. Antenna
11. SD card slot (32 Go Max. - 1 Go Min)
12. Connector by the 5 V plug of the adapter (adapter to connect to an installation compliant with standards in
force : NFC 15 100 in France)
13. Bracket to unfold
b. Outdoor station, exterior camera (g. 3)

1. IR LED, night vision (light invisible to the naked eye).
2. Lens of C-MOS video camera with automatic iris (adjustable from back of video camera).
3. Loudspeaker: for communicating from outside building.
4. Call button: when this button is pressed the name-plate lights up and the chime is heard inside and outside the
building.
5. Nameplate and LED lights :
- if the electronic cabinet is battery-powered the indicator only turns on after a call if the low-light vision is too
important
- if the electronic cabinet is powered external (12 ou 24 V / ), the indicator only turns on when the low-light
vision is too important
- gently lift up the protective plastic cover with a small screwdriver and slide the card in the slot.
6. Microphone : for communicating with the person inside.
Use the 6-conductor cable to connect the box and the intercom panel, ensuring the colours match (fig.8) Insert
4 LR20 batteries into the electronic box to test the radio range. The antenna as far away as possible from all metal
surfaces, sources of interference and obstacles between the box and your home, (in particular, no leaves or
branches should touch it). For best results, it should also be placed high enough (approx. 1.6 m above ground level)
and be vertical.
N.B. : If the transmission is of insufficient quality, use the 2 m cable supplied to find a better position for the
antenna.
Once the ideal location has been found, permanently mount the equipment:
Once you have found the ideal location :
1 Remove the cover from the box by unscrewing the 6 cross-head screws (H) (fig. 5).
Warning : do not directly touch the electronic circuitry (see comment chapiter safety instruction : Important p3)
2 Fasten the box with two screws (J) at the top and bottom (fig. 6), The antenna is at the top right.
3 Remember to route the connecting cable for the roadside panel through the hole in the post first and 2 wires
(F) for the cabinet/electric strike link (it is thus necessary to bore the pillar or the wall consequently). The connection
(F) must to connect the other two wires to the lock or electric strike plate and on the connection LOCK of control
box.
N.B. : Do not install an antenna other than the original one supplied
Warning : Never insert the batteries before installation is completely finished.
Installing the roadside panel (g.6 / 7 / 8)

Tip : we recommend running the cables (for the roadside panel and the electric strike plate) through a conduit to
protect them from impacts and the elements. To avoid oxidation and poor contacts, , do not trim the excess from
the 6-conductor cable. Instead, wind it around itself between the post and the electronic box.
1 Remove the cross-head screw (A)
2 Tip the roadside panel (B) toward the front and dislodge it from the bottom.
3 Using the 3 screws (K), mount the box (C) flush with the wall so that the slot (D) is facing the cable (E)
4 Fit a silicone seal behind the Rain shield (C) to protect it from water running down the wall.
5 Pass the connecting cable
6 Connect the 6 wires (E) to the back of the roadside panel
7 Check the orientation of the camera (G) (fig. 8).
VIDEO ( yellow ) GND ( black ) SPK (brown) MIC (white) KEY (green) VCC ( red )
8 Put the roadside panel back in place and fasten with the screw (A).
4. INSTALLING
Important : This video door phone has a range of 300 m in free field. The actual ranges may be shorter
depending on the quantity and type of obstacles between or beside the units. It is therefore essential to test all
system components before installing them in order to determine the best locations for the roadside panel and the
monitor.
To complete installation of the roadside panel, open the battery compartment on the electronic box , box and
insert four 1.5 V alkaline LR20 batteries. , Be sure to follow the polarity markings. Close the battery compartment
and put the electronic box cover back in place with the 6 cross-head screws (H), Take care not to pinch or damage
the seal. You can use a low voltage supply power source, coming from a type WETR 14602 SER.R1 transformer or
from an automatic gate opener (12 ou 24 V / ). It should be connected on the terminals
and + of the electronic cabinet. In the case of direct voltage (V ) pay attention to the polarity +/-.
a. Installing of cordless indoor unit

Composition: - a roadside panel
- an electronic box housing the radio transceiver and the batteries (not supplied).
- a rain shield
- an antenna
Important : Do not point the video camera directly at the sun or at reflecting surfaces.
Tip: we recommend passing the cables through a protective sleeve to shield them from impacts and the weather.
GB3
Warning : If you do not use the batterie but by 12/24 V /

indicated Fig. 9
source (automatic opener) to connect as
If you are using a 12/24 V / power source, the batteries must be removed.
Do not use rechargeable batteries.
GB4
b. Installing of monitor (g.4)

Install the monitor at approximately 1,60 m above the ground (for optimum reception conditions).
For installing the monitor, choose a location away from reinforced concrete walls, mirrors, metallic shelves, etc
Keep the monitor away from all appliances creating strong electrical interference.
Any strong electrical environment may cause disturbances and interferes with the use (WIFI in particular).
For table-mounting, unfold the foot (A) and install the monitor on a stable surface.
Connecting the monitor:
1. Connect the cord of the 5 V adaptor to the power supply plug of the monitor. (B)
2. Plug the adaptor into a 230 V mains socket.
Warning : Only place the monitor on stable and hard surfaces.
5. DIRECTIONS FOR USE

The monitor must be in standby mode, the indicator
turned blue. (this mode is activated with
). When the
Call button is pressed on the roadside panel the monitor will ring for approximately 8 seconds. At the same time,
a tone will sound on the roadside panel to confirm that the call has been sent. You have approximately 30 seconds
to answer the call. At this time, the electronic box enters standby mode. If the electronic cabinet is powered by a
12 or 24 V / source, you can force the communication with the roadside panel pressing the
key. If the electronic cabinet is battery-powered the call is lost.
The conversation is established during a call pressing the
and
key. You can increase the volume by pressing
the key
The system will time out after 30 seconds. To extend this time for an additional 30 seconds, press the Answer
buttons
or
during a call. You can end the communication pressing
or
for 3 seconds.
6. SCREEN ICON
a. Signal indicator
b. Visiting record indicator (On)
c. Outdoor unit battery indicator
- Full Battery (yellow)
- Low Battery (red/twinkling)
d. Manual recording
e. : no SD card
F : Full SD card
Err. : SD card error
: SD card locked
: SD card overwrite
f. SD card indicator
g. SD card storage room indicator
h. No signal indicator
i. Answering indicator
j. Record time
k. System time
D
F
E
6' *
5(&
G H I
J
126,*1$/
K
N
M

L
7. MENU
Press ESC key for 2 seconds to display the following screens (
and
to scroll, OK to validate).
1 Recording from the monitor: (SD card required) :

- If the visiting record option (see b.p.7) is not activated, recording can be started/stopped by pressing on
.
- If the visiting record option is activated, recording starts automatically when a call is made from the intercom
panel.
2 If used with an electric strike plate (or electric lock) :
The electric strike plate can be opened only when communicating with a caller(all the time if the electronic cabikey , then press briefly the (1 sec.).
net is powered by external AC/DC supply), To open it, press briefly the
Caution : One single opening control is possible per call under operation on battery.
N.B.: The strike plate or lock must be one pulse type in order for the door/gate to be opened.
3 If used with an automatic opener :
Caution : An automatic gate opener may be operated via remote control If the electronic cabinet is powered by
external AC/DC supply. To open it, press the key
for 3 seconds during a call.
- If no call is in progress, press on
then on
for 3 seconds.
a. Camera Setup
b. Recorder Setup
c. Event List
d. System Setup
Reminder :The reception of a call on the monitor is only possible if it is in standby mode and paired with the
roadside panel (see chapter Pairing).
Important : The handset has a free-field range of up to approximately 300 metres. This range may be considerably
reduced by certain environmental factors (nearby radio interference, etc.)
GB5
GB6
8. APPLICATIONS
a. Camera Setup
1 Camera Brightness :
Press OK to enter Camera Brightness ajustement bar.
Press to adjust brightness, press OK to confirm and exit.
2 Pairing :
Press
, then press OK to enter Pairing menu, system will count down 60 seconds (fig.5-1) in the control box
wihin 60 seconds. Once pairing completed, it will display image of door unit.
N.B. : It strongly recommeded to pair with door unit before installation.
Press ESC to exit.
3 In delecting mode :
Press DEL to enter deletion mode
Use to delete the selected file or delete all
Press OK and select then press OK to delete
Press ESC to exit.
d. System setup
1 Time setting :
Press to select the item desired : Year/Month/Day/Hours/Minutes.
Press to change the system clock.
Press OK to confirm the settings.
2 Software version : it displays system version of answering unit & door unit.
3 TV format : Use
to select TV systeme between NTSC & PAL (recommended).
4 Factory default : Press OK to enter in the menu, select
, then press OK
Press ESC to exit.
5;9HU
7;9HU
b. Recorder Setup (the recorded sequences are in file .avi)

1 Visiting record : Use
to set ON/OFF
N.B. : If no answering, answering unit will record 30 seconds and then screen will be turned off automatically.
The
indicator will signal an unread recording
2 SD card format :
Press OK to enter SD card format
Select & press OK to format
N.B. : Make sure SD card is unlocked (Comments p11). For first time use, itis recommended to format SD card
3 SD card overwrite : If the card is full, this mode is used to select permanent overwriting of the first recordings
by the most recent ones.
Use to select ON/OFF, press OK to save
Press ESC to exit.
9. TECHNICAL SPECIFICATIONS
a. Technicals specications :
GB7
c. Event List
1 In view mode :
Press OK to enter record folder.
Continue to press OK to play/pause file.
2 Inplaying mode :
Press to adjust the volume
Press to fast backward 2x, 4x, 8x &16x
Press ESC to stop and exit
- Reference : 810268
- Screen: 18 cm in diagonal
- Monitor power supply: 5V
- Power consumption: 900 mA
- Dimensions : 220 x 143 x 35 (mm)
- Operating temperature: -10C to + 40 approx.
DEL
OK
ESC
RF specication
- Frequency radio 2,402-2,454 GHz
- GFSK (Frequency Hopping Spread Spectrum) numerical modulation
- Anti-interference
- Chain bandwidth: 2MHz
GB8
c. Power supply
Adaptor 230 V /5 V 1A
If the power supply cable has to be cut, ensure that the colour coding
of the wires is maintained whenreconnecting.
d. Camera (PL WEVA)

- Reference : 820659
- Operating temperature: -10C to + 45 approx.
- Camera : C-MOS
- Lens : H : 62 V : 42
- Light Sensibility < 8 lux
- Protection of the cameras : IP 44
GUARANTEE CONDITIONS : This device is guaranteed for labour and parts in our premises.
The guarantee does not cover: the consumables (batteries, etc.) and the damages caused by: misuse, improper
installation, external intervention, deterioration by mechanical or electrical shock, fall or atmospheric phenomenon.
Never open the apparatus or the guarantee will be invalidated.
For return in SAV, protect the screen to prevent scratching.
Only ever clean with a soft cloth; never use solvents. Before cleaning, disconnect and switch off the system.
Caution : Do not use any acid or alcohol based or other similar cleaning product or solvent. You may damage
the appliance and the vapours are explosive and dangerous for your health.
Do not use any tool which can be voltage conductor (metallic brush, sharp toolor other) for cleaning.
The sales slip or the invoice is required as proof of purchase date.
12. SAFETY INSTRUCTIONS

10. OPTIONS
All Extel electric catches
All Extel electric locks
All Extel mechanisms
WE 8111 BIS
11. TECHNICAL ASSISTANCE - GUARANTEE

Problems
Possible Causes
Remedies
No function
No power supply
Check the connection of the adaptor

Check the battery of the monitor is properly
charged (blue led
)
Check the voltage of the batteries in the electronic cabinet
The roadside panel rings

but not the monitor
Pairing problem
Range problem
Pair the electronic cabinet with the monitor

Bring the monitor closer to the electronic
cabinet and check when the device ...
No sound outside and

inside
Hole of the microhone

blocked by an insect
Clear and gently clean the hole (be sure not

to damage the microphone cell)
Check the connection of the white or brown
wire on the roadside panel
Poor Image
Configuration problem
Go to the menu and check the video format

(p 8)
Impossible to record on
SD card
Protection problem
Check the card is not locked or full (see

screen indications p 6-e)
If necessary, our technical website is at your disposal www.c-extel.com

HOTLINE : 0892-35-00-69 WWFPLQ
Last version of the dowloadable manual in color on : www.c-extel.com
GB9
The damages caused by the non-compliance to the manual lead to the expiration of the warranty. We will not
assume any responsibility for the resulting damage!
We will not assume any responsibility concerning any damage, to the goods or people, caused by improper handling
or by non compliance with the safety instructions.
This product has been manufactured in compliance with safety instructions. In order to keep this status and
ensuring the best operation of the product, the user must respect the safety instructions and warnings contained
in this manual.
The user of this system is responsible for checking whether the video surveillance is compliant with the law in force
in the country of use.
: This symbol indicates a risk of electric shock or a risk of short circuit

- You should only use this product within a voltage range between: 100-240 Volts and 50-60 hertz. Never intend to
use this product with a different voltage.
- Make sure all electrical connections of the system are compliant with instructions of use.
- In commercial establishments, make sure to respect the rules for preventing accidents with the electrical
installations.
- In schools, training institutions and workshops the presence of a qualied personnel is necessary to control the
operation of electronic appliances.
- Respect the instructions of use of other appliances connected to the system. (video recorder,TV, PC for example)
- Please contact an experienced person in case of doubt concerning the mode of operation or the safety of the
appliances.
- Never connect or disconnect the electrical appliances with wet hands.
- When installing this product, check the power supply cables are not liable to be damaged.
- Never replace the damaged electrical cables by yourself! In this case, remove them and contact an experienced
person.
WARNING
Informs the user about the presence of important instructions concerning the use
and the maintenance (repair) in the documentation supplied with the appliance.
Informs the user about the presence of hazardous voltages non-isolated inside the housing of
the product, being sufciently high to represent a risk of electrocution for people.
GB10
INHOUD
1. VEILIGHEIDSINSTRUCTIES
VEILIGHEIDSINSTRUCTIES. ................................................p.2
BESCHRIJVING................................................................................p.2
ONDERDELEN .................................................................................p.3
a. Monitor
b. Intercom aan de straatkant, met buitencamera
INSTALLATIE ....................................................................................p.3
a. Installatie van de elektronikteil kastje en
van de intercom aan de straatkant (met camera)
b. Installatie van de monitor
GEBRUIKSAANWIJZING ..........................................................p.5
PRESENTATIE VAN DE IKONEN ......................................p.6
MENUS ...................................................................................................p.6
TOEPASSINGEN .............................................................................p.7
a. Instellingen camera
b. Instellingen voor de opname
c. Gebeurtenis lijst
d. Parameters
9 TECHNISCHE
EIGENSCHAPPEN ......................................p.8
a. Technische gegevens
c.Voeding
d. Camera (PL WEVA)
10
OPTIES ...................................................................................................p.9
11 TECHNISCHE HULPVERLENING / GARANTIE ..............p.9

12
NL1
VEILIGHEIDSINSTRUCTIES ...............................................p.10
Belangrijk !
Lees de gebruiksaanwijzing zorgvuldig door voordat u dit product installeert of gebruikt.
Als u dit product installeert voor derden, denk er dan aan om de handleiding of een kopie achter te laten voor
de eindgebruiker.
Waarschuwing :
De verschillende onderdelen mogen alleen worden gedemonteerd door een erkende reparateur.
Veiligheidsmaatregelen :
Voor een geheel veilig gebruik van dit systeem, is het noodzakelijk dat de installateurs, gebruikers en technici alle
in deze handleiding beschreven veiligheidsprocedures volgen.
Er worden zonodig specieke waarschuwingen en aandachtssymbolen aangegeven op de onderdelen.
Opgelet :
De gebruiker van dit systeem is verantwoordelijk en is verplicht om te controleren of de videobewaking in
overeenstemming is met de wetgeving in het land waarin het wordt gebruikt.
Hoewel ze digitaal zijn, zijn de cameras gevoelig voor interferentie van draadloze telefoons, magnetrons en andere
draadloze apparatuur die werken op 2.4 GHz (WIFI bijvoorbeeld).
Houd het systeem tijdens de installatie en het gebruik op minstens 3 meter afstand van dergelijke apparatuur.
N.B. :
Alle actieve elektronische componenten zijn gevoelig voor elektrostatische ontladingen van het menselijk lichaam.Verwijder altijd
de statische elektriciteit van uw lichaam (door bijvoorbeeld met een vinger n van de batterijcontacten rode draad of zwarte
draad )
De garantie dekt geen enkele schade die voortkomt wanneer deze instructies niet zijn opgevolgd.
2. BESCHRIJVING (g. 1)
1 Monitor
2 Muursteun
3 Aansluitbare adapter
4 Intercom aan de straatkant, met buitencamera
5 Regenkap
6 Antennehouder
7 Verbindingskabel voor slotpen of elektrisch slot.
8 Antennekabel (ongeveer 2 m)
9 Elektronikteil
10 Antenne
Algemeenheid
Deze videofoon bestaat uit een antwoordpost voor binnen met kleurenscherm en een straatunit met intercom en
camera voor buiten die de communicatie mogelijk maakt met de bezoeker die heeft aangebeld. Voor een goede
toepassing en werking moet deze handleiding aandachtig worden gelezen.
Opgelet : Als u een test uitvoert op uw videofoon voor de installatie (test op korte afstand) dient u een
minimale afstand tussen de monitor en de intercom aan de straatkant van ongeveer 3 meter (Larsen effect).
NL2
Installatie van de elektronikteil kadtje (g.5)
3. ONDERDELEN
a. Monitor (g. 2)
1. Indicator: Opname in uitvoer (knippert)
2. Indicator van niet afgelezen opname
3. Stekker geluidsverbinding // Inschakeling
4. DEL (WIS) functie in het menu // Toegang tot de monitor
5. Bediening schootplaat/slot en/of poortautomatisme (van toepassing wanneer het beeldscherm aan staat) //
bevestiging OK
a. Een druk van 2 seconden op de bediening van een poortautomatisme.
b. Een korte druk (korter dan 1 seconde) voor de bediening van een schootplaat of een elektrisch slot.
6. Toegang tot het menu // EXIT (VERLATEN)
7. Cursor onderzijde // handmatige opname
8. Rechter cursor // Instelling van het volume
9. Microfoon voor het gesprek.
10. Antenne
11. Speler SD-kaart (32 Go Max. - 1 Go Min)
12. Stekker via de plug 5 V (adaptor die moeten worden aangesloten op een installatie die in overeenstemming
is met de geldende normen: NFC 15 100 voor Frankrijk).
13. Open te vouwen houder
Gebruik een zesaderige kabel voor de verbinding kastje/ straatunit en neem hierbij de kleuren in acht (afb. 8). Breng
4 batterijen van het type LR20 in het elektronische kastje aan om de draagwijdte van de radiofrequentie te testen.
Dient de antenne zo ver mogelijk van alle metalen oppervlakten, storingsbronnen en obstakels tussen het kastje
en uw huis gehouden te worden (het mag vooral geen bladeren of takken aanraken).Voor het beste resultaat moet
het hoog genoeg genstalleerd worden (ongeveer 1,60 meter boven de grond) en in een verticale positie.
N.B. : Als de transmissie van slechte kwaliteit is, kunt u de kabel van 2 meter gebruiken om een betere positie te
vinden.
Voer, na het bepalen van de ideale plaats, de definitieve montage uit:
1Haal het deksel van het kastje door de 6 kruisvormige schroeven los te draaien(H)
Opgelet : Aak het elektronische circuit niet direct aan (zie opmerking in hoofdstuk 2 : Belangrijk p 2)
2Bevestig het kastje met twee schroeven (J) aan de boven- en onderkant. De antenne bevindt zich rechts bovenaan.
3Vergeet niet om van te voren de kabel voor de straatplaat door het gat in de pilaar te halen.
en 2 draden (F) voor de verbinding kastje /elektrische slotpen (boor het gat in de pilaar of in de muur). De overgang (F) (een rode en een zwarte) aan het slot of elektrische slotplaat en op bornier LOCK van de elektronische
doos
N.B. : Installeer geen andere antenne dan de oorspronkelijke antenne die meegeleverd is.
Opgelet : Steek de batterijen er nooit in voordat de installatie volledig voltooid
b. Intercom aan de straatkant, met buitencamera (g. 3)

1. IR LED, nachtvisie. (licht niet zichtbaar met het blote oog)
2. Objectief van de C-MOS camera met richtbaar automatisch irisdiafragma (aan de achterkant van de camera)
3. Luidspreker om de bewoner met de bezoeker te laten communiceren.
4. Belknop : de beltoon wordt binnen en buiten gehoord en het scherm en de camera worden ingeschakeld zodra
deze knop wordt ingedrukt.
5. Naamkaartje en indicatielamp :
- Als het elektronisch kastje met batterijen wordt gevoed gaat het lampje pas branden na een oproep.
- Als het elektronisch kastje wordt gevoed met laagspanning (12 of 24 V / ), gaat het lampje branden als het te
donker wordt.
- Plastic bescherming die voorzichtig met een kleine schroevendraaier moet worden opgelicht om het etiket met
de naam te kunnen plaatsen.
6. Microfoon : om de bezoeker met de bewoner te laten communiceren.
4. INSTALLATIE
Belangrijk : Deze videofoon heeft een bereik van 300 m in open terrein. Dit bereik kan behoorlijk worden
verminderd door bepaalde factoren uit de omgeving (nabije radiostoringen, enz.).
Het is dan ook noodzakelijk alle onderdelen van de videofoon voor de uiteindelijke bevestiging te testen om de
beste plaats voor de straatunit en de monitor te bepalen.
a. Het draadloze apparaat voor binnen bestaat uit :

Samenstelling : - een straatplaat
- een elektronisch kastje dat de radio zendontvanger en de batterijen onderbrengt (niet meegeleverd).
- regenkap
- antenne
Opgelet : De camera niet rechtstreeks blootstellen aan de zon op of een weerspiegelende oppervlakte.
Raadgeving : het is aanbevolen de kabels door een beschermkoker te voeren, teneinde ze te beschermen tegen
schokken en slechte weersomstandigheden.
NL3
Installatie van de intercom aan de straatkant (met camera) (g.6 / 7 / 8)

Tip : wij raden aan om de kabels (voor de straatplaat en de elektrische slotplaat) door een koker te halen om
deze tegen stoten en slechte weersomstandigheden te beschermen. Om oxidatie en slechte contacten te voorkomen, moeten de extra lengtes van de 6 geleidekabels niet worden afgeknipt. Het is beter om deze rond zichzelf te
winden tussen de pilaar en het elektronische kastje (fig. 7).
1Verwijder de kruisvormige schroef (A)
2Kantel de straatplaat (B) naar voren en maak het van onderen los
3Met gebruik van de 3 schroeven (K), bevestigt u het regenkap (C) aan de muur, zodat het gat (D) zich tegenover
de kabel bevindt (E).
4Plaats een siliconenstrip achter het regenkap (C) om deze tegen het water te beschermen dat langs de muur
loopt.
5Haal de verbindingskabel door het gat.
6Sluit de 6 draden (E) aan de achterkant van de straatplaat aan :
VIDEO (gele) GND (zwarte) SPK (bruin) MIC (witte) KEY (groene ) VCC ( rode)
7 Verifieer de orintatie van de camera (fig. 8).
8Breng de straatplaat op zijn plaats terug en bevestig het met de schroef (A).
Voor het voltooien van de installatie van de straatplaat , opent u het batterijvakje van het elektronische kastje en
steekt u er vier 1,5V alkaline LR20 batterijen in. Verzeker u ervan dat u de polariteiten aanhoudt. Sluit het batterijenvakje en zet het deksel van het elektronische kastje weer op zijn plaats met de 6 kruisvormige schroeven (H).
Verzeker u ervan de afdichting niet te beschadigen. U kunt een voedingsbron met laagspanning gebruiken, uit een
transformator van het type WETR 14602 SER.R1 of een poortautomatisme (12 ou 24 V / ). Deze wordt bevestigd
op
en + de contactpunten van het elektronische kastje. In het geval dat er constante spanning V wordt
gebruikt, dient u zeer goed op de polariteit +/- te letten.
~ ~
Opgelet : Als u geen batterijen gebruikt maar een voedingsbron 12/24 V / (poortmechanisme) verbindt
deze dan op wijze. Fig. 9
Bij gebruik van een 12/24 V / stroombron / is het noodzakelijk de batterijen te verwijderen.
Gebruik geen oplaadbare batterijen.
NL4
b. Installatie monitor (g.4)

Installeer de monitor op ongeveer 1,60 m afstand van de grond (voor optimale ontvangstcondities).
Kies voor de plaats van de monitor een plek die niet in de buurt is van muren van gewapend beton, spiegels, metalen
rekken etc.
Houd de monitor uit de buurt van alle apparaten die voor sterke elektrische interferenties zorgen.
Om het even welke omgeving met sterke elektrische ladingen kan voor interferenties zorgen en het gebruik verstoren (in het bijzonder WIFI).
Klap, voor een installatie op een tafel, de poot (A) uit en plaats de monitor op een stabiele ondergrond.
Aansluiting van de monitor:
1.Verbind het snoer van de 5 V -adapter met de Voedingsplug van de monitor. (B)
2. Sluit de adapter aan op een stopcontact 230 V
Opgelet : Plaats de monitor alleen op harde en stabiele oppervlakken.
5. GEBRUIKSAANWIJZING
De monitor moet in de modus slaapstand staan, het lampje
moet blauw branden. (deze modus wordt actief
met de toets
) Hij moet op een stabiel oppervlakte worden gezet, met de ontvouwde antenne. Wanneer er op
de Call knop (Gespreksknop) wordt gedrukt op de straatplaat, zal de handset gedurende ongeveer 8 seconden
overgaan. Op hetzelfde moment zal er op de straatplaat een beltoon overgaan om te bevestigen dat het gesprek
door wordt gezonden U hebt ongeveer 30 seconden de tijd om de oproep te beantwoorden. Na deze periode, de
elektronische kastje overhandigt zich in vorige dag. als uw elektronische kastje wordt gevoed met een bron 12 of
12 ou 24 V / , kunt u de communicatie met de intercom forceren door op de toets te drukken
. Als het
elektronische kastje met batterijen is gevoed, gaat de oproep verloren.
U kunt een gesprek beginnen door tijdens de oproep gedurende op de toets te drukken
en
. U kunt het
volume verhogen door op de knop te drukken
.
De gespreksduur is geprogrammeerd op 30 seconden. Om deze tijd te verlengen met 30 seconden, drukt u
opnieuw op de knopb
of
tijdens een communicatie).
Als het elektronische kastje met laagspanning is gevoed
of
ant (3 seconden).
6. PRESENTATIE VAN DE IKONEN

a. Kwaliteit van het signaal
b. Opnamemodus
c.lading van de batterij in de intercom
aan de straatkant
- de batterij is vol (geel)
- Zwakke batterij (rood/knippert)
d. Handmatige opname
e. : geen SD-kaart
F : SD-kaart vol
Err. : geen SD-kaart
: SD-kaart vergrendeld
: Nieuwe opname toegestaan
f. Indicator van de SD-kaart
g. Capaciteit van de SD-kaart
h. Verlies van het signaal
i. stekker verbinding
j. Opnametijd
k. Datum en tijd
D
F
E
6' *
5(&
G H I
J
126,*1$/
K
N
M

L
7. MENUS
Druk op het menu ESC gedurende 2 seconden om de volgende schermen weer te geven (
langs schuiven, OK en uw keuze bevestigen)
en
u kunt er
1 Opname via de monitor: (SD kaart vereist)

Als de optie visiting record (opname bij bezoek) (zie b. blz.7) niet ingeschakeld is, kunt u de opname starten/
onderbreken door te drukken op
.
Als de optie visiting record (opname bij bezoek) ingeschakeld is, start de opname automatisch op bij een oproep
vanaf de straatunit.
2 Wanneer het gebruikt wordt met een elektrische slotplaat (of elektrisch slot) :
De elektrische slotplaat kan alleen worden geopend wanneer er een gesprek plaatsvindt met een bellern (Als het
elektronische kastje met laagspanning is gevoed), Om deze te openen drukt u kort op de
vervolgens steunen
kort op (1 sec.).
b. Instellingen voor de opname
Opgelet : Kunt u het gesprek beindigen door te drukken bij functioneren op de batterij.
N.B. : De slotplaat of het slot moet worden uitgerust met een mechanisch geheugen zodat de deur/ het hek kan
worden geopend
3 Wanneer het gebruikt wordt door een automatische opener dat geactiveerd wordt door het afbreken van
een contact :
Opgelet : De automatische deuropener kan op ieder als het elektronische kastje met laagspanning is gevoed
- Druk tijdens een communicatie gedurende 3 seconden op de toets
.
en vervolgens gedurende 3 seconden op
.
- Druk, zonder communicatie, op
Herinnering : De ontvangst van een oproep op de monitor is alleen mogelijk als het in de modus slaapstand
staat en met de intercom aan de straatkant (zie hoofdstuk Koppelen) is verbonden.
Belangrijk : Deze videofoon heeft een bereik van 300 m in open terrein. Dit bereik kan behoorlijk worden verminderd door bepaalde factoren uit de omgeving (nabije radiostoringen, enz.).
NL5
d. Parameters
NL6
8. TOEPASSINGEN
1 Lichtinstelling van de camera :
Druk op OK om de met de schuifregelaar de lichtinstelling aan te passen
Druk op om de lichtinstelling aan te passen, druk opnieuw OK om de instelling te bevestigen en het menu
te sluiten
2 Koppelen :
Druk op , en druk vervolgens op OK om het menu te openen, het systeem zal nu gedurende 60 secondes
aangaan. Bel vanaf de intercom, en druk vervolgens binnen 60 secondes op de koppel-sleutel (fig5-1) in het elektronische kastje. Zodra u het koppelen heeft uitgevoerd, verschijnt er een beeld op de intercom aan de straatkant.
Opmerking : het wordt ten sterkste aangeraden om voor de installatie het elektronische kastje met de intercom
aan de straatkant te koppelen.
Druk op ESC om het menu te sluiten
3 Modus wissen :
3
Druk op DEL om de modus te openen
Druk op om het gekozen bestand te wissen of op om alles te wissen.
Druk op OK en kies de icoon en druk vervolgens op OK om het te wissen.
d. Parameters
1 Instellen Datum/tijd :
Druk op om de gewenste datum en tijd in te stellen
Druk op om de klok van het systeem in te stellen.
Druk op OK om de instellingen te bevestigen
2 Versie programma : de versie van het systeem wordt weergegeven voor de intercom aan de straatkant en
de monitor
3 Formaat TV : Gebruik
om voor de TV tussen NTSC en PAL (aanbevolen). te kiezen
4 Standaardinstellingen : Druk op OK om het menu te openen, kies
, en druk vervolgens OK.
Druk op ESC om het menu te sluiten tir
5;9HU
7;9HU
b. Instellingen voor de opname (de geregistreerde sequenties zijn in formaat .avi)

1 Opnamemodus : Gebruik
de knopen ON/OFF om te kiezen.
Opmerking : Als u niet op een oproep reageert neemt de monitor gedurende 30 secondes uw bezoeker op de
video op. De controlecode
geeft een niet afgelezen opname weer.
2 Formatteren van de SD-kaart :
Druk op OK om de functie Formatteren te openen
Kies end ruk op OK om te formatteren.
Opmerking : Verifieer dat de SD-kaart niet is vergrendeld (indicatie p. 6-e). Voor het eerste gebruik wordt het
aanbevolen om de SD-kaart voor het gebruik te formatteren.
3 Een bestand wissen : In deze stand kunt u kiezen de eerste opnames definitief met de meest recente
opnames te overschrijven.
Gebruik de knopen ON/OFF om te kiezen en druk op OK om op te slaan
9. TECHNISCHE EIGENSCHAPPEN
a. Technische gegevens :
NL7
1 Modus visualisering :
Druk op OK om de opgeslagen bestanden te openen
Druk opnieuw op OK de knop om de bestanden af et spelen of te stoppen.
2 Modus afspelen :
Druk op om het volume af te stellen.
Druk op om achteruit te gaan: 2x, 4x, 8x en 16x
Druk op ESC om de opname te onderbreken en te sluiten
- Referentie : 810268
- Beeldscherm : 18 cm diagonaal
- Voeding van de monitor : 5V
- Verbruik : 900 mA
- Afmetingen : 220 x 143 x 35 (mm)
- Gebruikstemperatuur: - ongeveer -10C tot 40C
DEL
OK
ESC
RF specicatie
- Radiofrequentie 2,402-2,454 GHz
- Digitale Modulatie GFSK (Frequency Hopping Spread Spectrum)
- Anti-interferentie.
- Bandbreedte van de keten: 2MHz
NL8
c.Voeding
GARANTIEVOORWAARDEN : De garantie van dit toestel is van toepassing op de onderdelen en het

arbeidsloon in onze werkplaatsen. De garantie dekt niet : de consumptieartikelen (cellen, batterijen, enz.) en de
schade veroorzaakt door : verkeerd gebruik, slechte installatie, interventie van buitenaf, beschadiging door fysieke
of elektrische schok, val of atmosferisch verschijnsel.
Het toestel niet openen om de dekking van de garantie niet te verliezen.
Bij een eventuele terugkeer naar de Naverkoopdienst, het beeldscherm beschermen om krassen te vermijden.
Onderhouden met een zachte doek, geen solventen gebruiken. Trek voordat u het systeem reinigt de stekker uit
of zet het apparaat uit.
- Adapter 230 V /5 V 1A
In geval van stroomonderbreking, de polariteit in acht nemen.
d. Camera (PL WEVA)

- Referentie :820659
- Verwijzing :
- Afmetingen : 150 x 115 x 42 mm
- Werkingstemperatuur: - ongeveer -10C tot 45C
- Camera : C-MOS
- Lens : H : 62 V : 42
- Gevoeligheid < 8 lux
- IP 44
OPGELET Gebruik geen producten die stoffen als carboxyl, alcohol of eensgelijks bevatten. Behalve het
risico dat het uw apparaat beschadigt, zijn de dampen gevaarlijk voor uw gezondheid en zijn ze explosief.
Gebruik bij het schoonmaken geen hulpmiddelen die de stroom geleiden (metalen borstels, puntige voorwerpen...
of anders).
10. OPTIES
De kassabon of de factuur dient als bewijs van de aankoopdatum.
Alle elektrische schootplaten van Extel

Alle elektrische sloten van Extel
Alle poortmechanismen van Extel
WE 8111 BIS
12. VEILIGHEIDSINSTRUCTIES
11. TECHNISCHE HULPVERLENING / GARANTIE

6WRULQJ
2RU]DDN
2SORVVLQJ
Werkt in het geheel niet
Geen voeding
Verifieer de aansluiting van de adaptor

Verifieer dat de batterij van de monitor voldoende is opgeladen (led blauw
)
Verifieer de spanning van de batterijen in het
elektronische kastje
Op de intercom aan de
straatkant wordt gebeld,
maar de monitor gazat niet
af
Probleem met het koppelen.

Probleem bereik
Koppel het elektronische kastje met de monitor

Zet de monitor in de buurt van het elektronische kastje en verifieer als het apparaat ...
Geen geluid buiten en

binnen
Opening van microfoon

verstopt door een insect
Ontstop en reinig het gat voorzichtig (pas op

dat u de microfoon niet beschadigt)
Controleer de aansluiting van de witte of
bruin kabel met de intercom aan de straatkant
Slecht beeld
Probleem met de instelling
Open het menu en verifieer het videoformaat

(p 8)
Onmogelijk om op de
SD-kaart te nemen op
Probleem met de bescherming
Verifieer dat de kaart niet is geblokkeerd of

vol is (zie de indicaties op het scherm p 6-e)
Indien nodig staat onze technische dienst tot uw beschikking www.c-extel.com

Laatste versie van de te downloaden kleurenhandleiding op :
www.c-extel.com
NL9
Schade die wordt veroorzaakt door het niet respecteren van de handleiding, leidt tot het vervallen van de garantie.
Wij aanvaarden geen enkele verantwoordelijkheid voor schade die hier het gevolg van is!
We aanvaarden geen enkele verantwoordelijkheid betreffende enige schade aan goederen of personen die is
veroorzaakt door een verkeerd gebruik of door het niet respecteren van de veiligheidsinstructies.
Dit product is vervaardigd met volledige inachtneming van de veiligheidsinstructies. Om deze veiligheid te behouden
en om het optimale gebruik van dit product te garanderen, dient de gebruiker de veiligheidsinstructies en de
waarschuwingen in deze handleiding in acht te nemen.
De gebruiker van dit apparaat is er voor verantwoordelijk en is verplicht te controleren of de videobewaking in
overeenstemming is met de geldende wetgeving in het land waarin het wordt gebruikt.
: Dit symbool geeft een risico op elektrische schokken of kortsluiting aan.
- U dient dit product alleen te gebruiken bij een spanning tussen 100-240 volt en 50-60 hertz. - Probeer dit apparaat
nooit met een andere spanning te gebruiken.
- Let erop dat alle elektrische aansluitingen van het systeem conform de gebruiksinstructies zijn.
- Verzeker u er in bedrijven van dat u de regels voor het voorkomen van ongelukken inzake elektrische installaties
in acht neemt.
- Op scholen, opleidingen, werkplaatsen... is de aanwezigheid van bevoegd personeel noodzakelijk voor het
controleren van de werking van elektrische apparaten.
- Houd de gebruiksinstructies van andere apparaten die zijn verbonden met het systeem in acht. (videorecorder,
TV, PC bijvoorbeeld)
- Neem contact op met een deskundig persoon in het geval dat u twijfelt over de werking of de veiligheid van de
apparaten.
- U mag nooit met natte handen elektrische apparaten aansluiten of de stekkers uit stopcontacten trekken.
- Controleer tijdens de installatie van dit product goed of de voedingskabels geen risico lopen beschadigd te raken.
- Vervang nooit zelf beschadigde elektrische kabels! Verwijder ze in dat geval en doe beroep op een deskundig
persoon.
OPGELET
Waarschuwt de gebruiker over de aanwezigheid van belangrijke instructies betreffende het gebruik en het onderhoud (de reparatie) in de documentatie bij het
apparaat.
Waarschuwt de gebruiker over de aanwezigheid van niet-gesoleerde gevaarlijke spanningen

binnenin de kast van het product die van voldoende omvang zijn om een risico op elektrocutie
voor personen te betekenen.
NL10
INHALTSVERZEICHNIS
1. SICHERHEITSEMPFHLUNGEN
SICHERHEITSEMPFHLUNGEN..........................................p.2
BESCREIBUNG. ...............................................................................p.2
STCKLISTE .....................................................................................p.3
a. Monitor
b. Auensprechanlage
INSTALLATION ..............................................................................p.3
a. Installation der elektronikteil
und der Auensprechanlage (Kamra)
b. Installation der monitor
BEDIENANLEITUNG ................................................................p.5
VORSTELLUNG DER PIKTOGRAMME .......................p.6
MENS ...................................................................................................p.6
ANWENDUNG ................................................................................p.7
a. Kameraeinstellungen
b. Einstellungen Aufnahme
c. Ereignisliste
d. Parameter
TECHNISCHE DATEN ...............................................................p.8

a. Technische Besonderheiten
d. Stromversorgung
c. Kamera (PL WEVA)
10 OPTIONEN .........................................................................................p.9
11 KUNDENDIENST
Wichtig !
Bitte lesen sie dieses Handbuch sorgfltig durch bevor sie das Produkt installieren oder verwenden.
Wenn sie dieses Produkt fr Dritte installieren denken sie bitte daran, das Handbuch oder eine Kopie fr den
Endverbraucher vor Ort zu lassen.
Warnung :
Unterschiedliche Elemente drfen nur von einem zugelassenen Techniker ausgebaut werden.
Sicherheitsmanahmen :
Fr einen Betrieb in aller Sicherheit dieses Systems ist es wichtig, dass Verwender und Techniker die in diesem
Handbuch beschriebenen Sicherheitsverfahren befolgen.
Die spezischen Warnungen und Warnsymbole sind falls notwendig auf den Elementen angegeben.
Achtung :
Der Verwender dieses Systems ist fr dieses verantwortlich und muss berprfen, ob die berwachung den
gltigen Gesetzen in dem Verwendungsland entspricht.
Auch wenn es sich um digitale Kameras handelt, knnen diese auf Interferenzen von kabellosen Telefonen,
Mikrowellen und anderen kabellosen Gerten von 2,4 GHz reagieren (z.B. WiFi).
Halten whrend der Installation des Systems einen Abstand von mehr als 3 m von Vorrichtungen ein.
N.B. :
Alle elektronischen Bauteile sind gegenber statischen Entladungen durch Menschen empndlich. Daher muss vor
Arbeiten an diesen Teilen die eigene statische Ladung unbedingt abgeleitet werden (z.B. indem Sie einen Finger auf
einen Batteriekontakt der Sprechanlage, rote oder schwarze legen).
Infolge der Nichtbeachtung dieser Vorschrift enstehende Schden werden von der Garantie nicht gedeckt.
2. BESCREIBUNG (g. 1)
1 Monitor
2 Wandhalterung
3 Einsteckadapter
4 Auensprechanlage
5 Regenschutzvisier
6 Antennentrger
7 Anschlusskabel fr Schloss oder Elektrotrffner
8 Antennenkabel +/-2 m
9 Elektronikteil
10 Antennen
- GARANTIE ..........................................p.9
12 SICHERHEITSEMPFHLUNGEN .......................................p.10
Allgemeines
Diese Video Trsprechanlage besteht aus einer Innensprechstelle mit Farbdisplay und einer Auenstation mit Sprechanlage und Kamera, die es erlaubt, den Besucher, der geklingelt hat, zu sehen und mit ihm zu sprechen. Fr einen
optimalen Gebrauch lesen Sie bitte diese Bedienanleitung aufmerksam durch.
Achtung : Wenn Sie Ihr Visiophone vor der Installation testen, respektieren Sie einen Mindestabstand zwischen dem Monitor und der Auensprechstelle von etwa 3 m (berlastungsrisiko, Larsen-Effekt).
D1
D2
3. STCKLISTE
a. Monitor (g. 2)
1. Kontrolllampe: Aufzeichnung luft (blinken)
2. Kontrolllampe der nicht gelesenen Aufzeichnung
3. Audio-Anschluss // Inbetriebnahme
4. Funktion DEL (lschen) im Men // Zugriff auf den Bildschirm
5. Bedienung Trffner/Elektroschloss und/oder Torantrieb (nur besttigt wenn der Bildschirm eingeschaltet ist) //
Validierung OK.
a. Ein Impuls von 2 Sekunden fr die Bedienung eines Torantriebs.
b. Ein kurzer Impuls (unter 1 Sekunde) fr die Bedienung eines Trffners oder eines Elektroschlosses.
6. Zugriff Men // EXIT (beenden)
7. Unterer Cursor // manuelle Aufzeichnung
8. Rechter Cursor // Lautstrkeeinstellung
9. Mikrofon fr Gesprch
10. Antennen
11. SD Card Lesegert (32 Go Maxi - 1 Go Mini)
12. Anschluss mit 5 V Stecker vom Adapter (Adapter auf eine Installation anschlieen, die den gltigen Normen
entspricht: NFC 15 100 fr Frankreich).
13. Ausklappbarer Trger
b. Auensprechanlage (Kamera) (g. 3)
1. IR LED, Nachtsicht (fr das bloe Auge unsichtbares Licht)
2. Objektiv der Kamera C-MOS mit schwenkbarer Irisblende (auf der Rckseite der Kamera).
3. Lautsprecher fr den Auenbereich.
4. Anruftaste: wird der Taster gedrckt, ertnt der Klingelton drinnen und drauen, der Monitor und die Kamera
gehen an.
5. Namensschild und Kontrollleuchte :
- Wenn der Schaltschrank ber Batterien angetrieben wird, erleuchtet die Kontrollleuchte nur nach einem Anruf.
- Wenn der Schaltschrank mit Niederspannung (12 oder 24 V / ), betrieben wird, dann erleuchtet die
Kontrollleuchte bei zu groer Dunkelheit.
- Kunststoffabdeckung mit einem feinen Schraubendreher vorsichtig abheben und Namensschildetikett einschieben.
6. Mikrofon : damit kann sich der Besucher melden.
4. INSTALLATION
Wichtig : Dieses Visiophone hat eine Reichweite von 300 m auf freiem Feld. Die angegebene Reichweite
kann jedoch je nach Umfeld (Funkstrungen in der nahen Umgebung, usw.) deutlich geringer ausfallen.
Daher sollten durch Versuche der optimale Einbauort fr die Auenstation und den Monitor ermittelt werden,
bevor die Gerte fest angebracht werden.
a. Installation ihres drahtlosen der Videotrsprechanlage (Auenstation)

Aufbau: - Eine Auenstation
- Ein Elektronikteil (E) das den Funksender/-empfnger und die (nicht mitgelieferten) Batterien enthlt.
- Regenschutz-einfassung
- Antennen
Wichtig : Die Kamera sollte nicht direkt der Sonne oder einer Spiegelche ausgesetzt sein.
Rat : Zum Schutz der Drhte vor Beschdigung und Witterungseinflssen wird eine Kabelschutzhlle empfohlen.
D3
Installation der elektronikteil (g.5)

Das 6-adrige Kabel fr die Verbindung Gehuse/ strassenseitige Frontplatte unter Beachtung der Farben verwenden (Abb. 8). 4 Batterien vom Typ LR20 in das elektronische Gehuse einsetzen, um die Funkbereichversuche
durchzufhren. die Antenne mglichst weit von Metallteilen, Strquellen oder Hindernissen zwischen dem Gehuse
und dem Haus entfernt liegt. Insbesondere darf das Elektronikteil nicht in Kontakt mit Baumblttern oder -sten
kommen. Auerdem muss die Antenne senkrecht und in ausreichender Hhe (ca. 1,60 m ber dem Boden) angebracht werden, damit eine optimale Leistung erzielt wird.
N.B. : Sollte die bertragung ungengend sein, das mitgelieferte 2 m Kabel verwenden, um einen besseren
Standort ausfindig zu machen.
Nach Bestimmung der optimalen Position die definitive Montage vornehmen:
16 Kreuzschlitzschrauben (H) herausdrehen und Gehuseoberteil des Elektronikteils abmontieren.
Vorsicht : Die Leiterplatte darf nicht berhrt (s. auch Hinweis unter Wichtig, Seite 2)
2Gehuse mit 2 Schrauben in den 2 Bohrungen (J) oben und unten anschrauben, die Antenne muss rechts oben
liegen.
3Nicht vergessen, das Anschlusskabel fr die Auenstation vorher durch das vorgebohrte Loch im Torpfeiler zu
ziehen und die 2 Drhte (F) (nicht geliefert ) fr die Verbindung Schaltschrank/Elektroschloss (man muss also den
Pfeiler oder die Mauer infolgedessen durchbohren ). Die Verbindung (F) an das Elektroschloss bzw. den elektrischen Trffner
anzuschlieen und auf demVerbindung LOCK der elektronikteil.
N.B. : Nur die Original-Antenne bzw.
Achtung : Die Batterien drfen erst nach Abschlus des Einbaus eingesetzt werden.
Installation der Auensprechanlage (Kamera) (g.6 / 7 / 8)

Hinweis : Die Leitungen (fr die Auenstation und den elektrischen Trffner) sollten stosicher und witterungsgeschtzt in einem Schutzschlauch gefhrt werden. berstehende Lnge des sechsadrigen Kabels nicht abschneiden, um Probleme durch Rostansatz oder schlechte Kontaktgabe zu vermeiden. Das Kabel sollte am besten zwischen dem Torpfeiler und dem Elektronikteil aufgerollt werden.
1 Kreuzschlitzschraube herausdrehen (A)
2 Frontplatte (B) aufklappen und nach unten herausziehen
3 Mit drei Schrauben (K) Regenschutzvisier (C) so auf der Mauer befestigen, dass das Loch (D) genau gegenber
dem Kabel (E) steht.
4 Eine Silikondichtiung anbringen an der Rckseite des Regenschutzvisier (C) um die Infiltrationen zu vermeiden,
die entlang der Mauer rinnen
5 Verbindungskabel durchziehen.
6 Die 6 Adern (E) anklemmen :
VIDEO ( Gelb) GND (Schwarz) SPK (Braun) MIC (Wei) KEY (grn) VCC (Rot)
7 Die Orientierung der Kamera (G) zu prfen (fig.8)
8 Frontplatte wieder einsetzen und mit der Schraube (A) fixieren.
Wenn die Auenanlage fertig installiert ist, beim Elektronikteil , Batteriefachdeckel aufklappen und die vier
1,5V-Alkalibatterien vom Typ LR 20 einsetzen ; dabei auf polrichtige Lage achten. Batteriefachdeckel schlieen und
Gehuseoberteil des Elektronikteils mit den 6 Kreuzschlitzschrauben (H) wieder anschrauben; darauf achten, dass
die Dichtung einwandfrei sitzt. Sie knnen eine Stromquelle mit Niederspannung verwenden, die aus einem
Transformator vom Typ WETR 14602 SER.R1 oder einem Torantrieb (12 oder 24 V / ) stammt. Sie muss mit den
Verbindungsklemmen
und + dem Schaltschrank verbunden werden. Bei Gleichstrom V ganz besonders auf
die Polaritten (- +) achten.
~ ~
Achtung : Wenn Sie keine Batterien verwenden sondern eine 12/24 V / Stromquelle (Torantrieb), wie
angegeben anschlieen (g. 9).
Bei Verwendung einer 12/24 V / Stromquelle mssen die Batterien entfernt werden.
Keine wiederaufladbaren Batterien verwenden.
D4
b. Installation der monitor (g.4)
6.VORSTELLUNG DER PIKTOGRAMME
Bauen Sie den Empfnger etwa 1,60 m ber dem Boden ein (fr optimale Empfangsbedingungen).
Fr die Installation des Empfngers, whlen sie einen Platz aus, der sich nicht in der Nhe von Stahlbetonwnden,
Spiegeln, Metallregalen usw. bendet.
Lassen sie den Empfnger nicht in der Nhe von Gerten, die starke elektrische Interferenzen kreieren.
Eine starke elektrische Umgebung kann Interferenzen hervorrufen und die Verwendung stren (im Besonderen
WIFI).
Fr eine Tischmontage den Fu (A) ausklappen und den Bildschirm auf eine stabile Flche stellen.
Anschluss des Monitors:
1.Verbinden sie das Kabel des 5 V Adapters mit dem Stecker Stromversorgung des Monitors(B)
2. Stecken sie den Adapter in eine 230 V Steckdose
Achtung : Den Monitor nur auf harte und stabile Oberchen abstellen.
5. BEDIENANLEITUNG
Achtung : Wenn Sie vor der Installation einen Test Ihres Visiophones durchfhren (Test auf kurze Entfernung),
einen Mindestabstand zwischen dem Monitor und der Auensprechstelle von etwa 3 m einhalten (berlastungsrisiko).
Der Monitor muss sich im Stand-by Modus befinden, die Kontrollleuchte
leuchtet in Blau (dieser Modus wird
mit der Taste aktiviert ) Er muss auf einer stabilen Oberflche abgestellt werden mit herausgezogener Antenne.
Wenn sich ein Besucher meldet, klingelt der Handapparat ca. 8 Sekunden lang. Gleichzeitig wird an der Auenstation
durch einen Ton besttigt, dass der Ruf weitergeleitet wurde. Sie haben etwa 30 Sekunden, um den Anruf zu
beantworten. Danach, der Elektronikteil schaltet wieder auf Standby. Wenn Ihr Schaltschrank mit einer 12 oder 24
V / Stromquelle versorgt wird, knnen Sie die Kommunikation mit der Auensprechstelle erzwingen, indem Sie
auf die Taste drcken
. Wenn der Schaltschrank mit Batterien betrieben wird, so ist der Anruf verloren. Das
Gesprch wird bei einem Anruf, indem auf die Taste
und
. Erhhen Sie die Lautstrke mit der Taste
.
Die anfngliche Gesprchsdauer betrgt 30 Sekunden. Erhhen Sie die Zeit von 30 Sekunden mit der Taste
oder
(bei einer Kommunikation). Das Gesprch wird bei einem Anruf, indem auf die Taste 3 Sekunden lang
gedrckt wird, erstellt
oder
.
1 Bei Aufzeichnung ab einem Bildschirm: (SD-Karte muss vorhanden sein)
-Bei nicht aktivierter Option visiting record (Besuchsaufzeichnung ) (siehe S.7) ist es mglich, eine Aufzeichnung
durch Bettigung der Taste
zu starten/zu stoppen.
-Bei aktivierter Option visiting record startet die Aufzeichnung automatisch bei Anruf ab der Strassenplatine.
2 Anlage mit elektrischem Trffner (oder Elektroschloss) :
Das Elektroschloss kann nur whrend eines Gesprchs(wenn der Schaltschrank mit Niederstrom versorgt wird),
durch kurzes drcken der Taste
geffnet werden,dann kurz auf det Taste zu untersttzen (1 Sek.).
Atchung : Es ist nur eine einzige ffnungssteuerung pro Anruf mglich in Funktionieren auf Batterie.
N.B. : Damit die Trffnungsfunktion gewhrleistet ist, muss beim Trffner bzw. beim Elektroschloss unbedingt
die Dauerentriegelung nach dem elektrischen Impuls sichergestellt sein.
3 Anlage mit automatischem, durch Schliekontakt angesteuerten Trffnungssystem :
a. Signalzustand
b. Aufnahmemodus
c. Batteriezustand der Auensprechanlage
- Batterie voll (gelb)
- Batterie schwach (rot/blinkt)
d. Manuelle Aufzeichnung
e. : Keine SD Karte
F : SD Karte komplett
Err. : Fehler auf SD Karte
: SD Karte gesperrt
: : Neuaufnahme zugelassen
f. Indikator der SD Karte
g. Fassungsvermgen der SD Karte
h. Signalverlust
i. Anschluss fr die Linie
j. Aufnahmeuhrzeit
k. Datum und Uhrzei
t
D
F
E
6' *
5(&
G H I
J
126,*1$/
K
N
M

L
7. MENS
Auf Men drcken ESC (2 Sekunden lang) um folgende Bildschirme erscheinen zu lassen (
OK zum Besttigen).
und
Bilddurchlauf,
b. Einstellungen Aufnahme
Achtung : Das Tor kann jederzeit geffnet bzw. geschlossen werden, wenn der Schaltschrank mit
Niederstrom versorgt wird.
- Die Taste
3 Sekunden lang drcken bei einer Kommunikation.
- Ohne Kommunikation auf
und
drcken, dann 3 Sekunden lang auf.
Hinweis : Der Empfang eines Anrufs auf dem Monitor ist nur mglich, wenn sich dieser im Stand-by Modus befindet und mit der Auensprechstelle verbunden ist (siehe Kapitel Anschluss).
Achtung : Dieses Visiophone hat eine Reichweite von 300 m auf freiem Feld. Die angegebene Reichweite
kann jedoch je nach Umfeld (Funkstrungen in der nahen Umgebung, usw.) deutlich geringer ausfallen.
D5
c. Ereignisliste
d. Parameter
D6
8. ANWENDUNG
1 Helligkeit der Kamera :
Auf OK drcken, um in die Leiste zum Einstellen der Helligkeit zu gelingen.
Auf drcken, um die Helligkeit einzustellen OK zur Besttigung drcken und aus dem Men gehen.
2 Anschluss :
Auf drcken, dann auf OK, auf drcken um in das Men zu gelingen, das System setzt sich 60 Sekunden lang
in Betrieb.Von der Auensprechstelle einen Anruf ttigen, dann auf den Anschlussschlssel (fig.5-1) im Schaltschrank
innerhalb von 60 Sekunden drcken.Wenn der Anschluss beendet wurde, erscheint das Bild der Auensprechstelle.
Anmerkung : Es wird empfohlen, den Schaltschrank an die Auensprechstelle vor der Installation anzuschlieen.
Auf ESC drcken, um zurckzukehren.
3 Lschmodus :
3
Auf DELdrcken, um in den Modus zu gelangen.
verwenden, um die ausgewhlte Datei zu lschen oder um alles zu lschen.
Auf OK drcken und das Icon
auswhlen, dann zum Lschen drcken OK.
d. Parameter
1 Datum-/Uhrzeit Einstellung :
Auf drcken, um das gewnschte Datum oder die gewnschte Uhrzeit auszuwhlen.
Auf drcken, um die Systemuhrzeit zu ndern.
Auf OK drcken, um die Einstellungen zu besttigen.
2 Software-Version: Es erscheint die Software-Version fr die Auensprechstelle und den Monitor.
3 Format TV :
pverwenden, um zwischen den beiden TV-Systemen NTSC oder PAL (empfohlen)
auszuwhlen.
4 Standartmige Vorgabe : Auf OK drcken, um in das Men zu gelangen
, auswhlen, dann auf OK.
b. Einstellungen Aufnahme (die registrierten Sequenzen sind in Format .avi)

1 Aufnahmemodus : Zur Auswahl
ON/OFF auswhlen
Anmerkung : Sollten Sie auf einen Anruf nicht antworten, speichert der Monitor 30 Sekunden lang Ihren
Besucher ein. Die Kontrolleuchte
zeigt eine nicht abgelesene Aufzeichnung an.
2 Formatierung der SD Karte :
Auf OK drcken, um in die Funktion Formatieren zu gelangen.
Auswhlen eund zum formatieren drcken OK.
Anmerkung : berprfen, ob die SD Karte entriegelt ist (Angabe seite 6-e). Bei einer ersten Verwendung wird
empfohlen, die SD Karte vor der Verwendung zu formatieren.
3 Eine Datei berschreiten : Dieser Modus ermglicht die Auswahl des definitven berschreibens der ersten
Aufzeichnungen durch die aktuellsten.
Verwenden, um ON/OFF auszuwhlen, zum Einspeichern drcken OK.
5;9HU
7;9HU
9. TECHNISCHE DATEN
a. Technische Besonderheiten :
RF Spezizierung
- Radiofrequenz 2,402 - 2,454 GHz
- Digitale Modulation GFSD (Frequency Hopping Spread Spectrum)
- Anti-Interferenz
- Bandbreite der Kette: 2MHz
1 Veranschaulichungsmodus :
Auf OK drcken, um in die eingespeicherte Datei zu gelangen.
Weiterhin drcken, OK um die Datei zu lesen und zu stoppen.
2 Ablesemodus :
Auf drcken, um die Lautstrke einzustellen.
Auf drcken um auf das 2x, 4x, 8x und 16x zurckzukehren.
Auf ESC (abbrechen) drcken fr Abbruch und zurckzukehren.
D7

Artikel-Nr.: 810268
- Bildschirm: 18 cm diagonal
- Versorgung des Monitors: 5V
- Verbrauch: 900 mA
- Mae : 220 x 143 x 35 (mm)
- Betriebstemperatur: etwa -10C bis + 40C.
DEL
OK
ESC
c. Ereignisliste
D8
c. Stromversorgung
GARANTIEBEDINGUNGEN : Dieses Gert verfgt ber eine Garantie fr Einzelteile und Arbeitsaufwand
in unseren Werksttten.. Die Garantie deckt nicht ab: das Verbrauchsmaterial (Batterien, Akkus, usw.) sowie
Schden, die verursacht wurden durch: eine falsche Behandlung, falsche Installation, uere Einsse, Beschdigung
durch physischen oder elektrischen Schock, Sturz oder atmosphrische Erscheinungen.
Das Gert nicht ffnen, um die Garantiedeckung nicht zu verlieren.
Bei einer eventuellen Rcksendung an den Kundendienst den Bildschirm vor Kratzern schtzen.
Nur mit einem weichen Tuch reinigen, keine Reinigungsmittel verwenden.
Vor der Reinigung, das System vom Stromkreis unterbrechen.
Artikel-Nr.: 830677
Netzadapter 230 V /5 V 1A
Im Fall einer Netzunterbrechung ist die Polaritt zu beachten.
c. Kamera (PL WEVA)

- Artikel-Nr.: 820659
- Mae : 150 x 115 x 42 mm
- Betriebstemperatur: etwa -10C bis 45C.
- Kamera : C-MOS
- Linse : H : 62 V : 42
- Empndlichkeit < 8 lux
- IP 44
Achtung : Kein Produkt oder Benzin, Kalkungscarbonatation, Alkohol oder hnliches verwenden. Sie riskieren nicht nur ihr Gert zu beschdigen, sondern die Dmpfe knnen ebenfalls ihrer Gesundheit schdigen und sich
entznden.
Kein Werkzeug verwenden, das Spannung leiten knnte (Metallbrste, spitzes Werkzeug...oder anderes)
Der Kassenzettel oder die Rechnung dienen als Nachweis fr das Kaufdatum.
10. OPTIONEN
12. SICHERHEITSEMPFHLUNGEN
Alle Extel elektrischen Trffner

Alle Extel Elektroschlsser
Alle Extel Motorisierungen
WE 8111 bis
Schden, die durch einen Mangel an Konformitt mit dem Handbuch hervorgerufen wurden, fhren zu einer
Lschung der Garantie.
Wir bernehmen keine Haftung fr daraus entstandene Schden! Wir bernehmen keine Haftung fr Schden an
Gegenstnden oder Personen, die durch eine nicht geeignete Handhabung oder einem Mangel an Konformitt der
Sicherheitsempfehlungen entstanden sind.
Dieses Produkt wurde mit Respekt auf die Sicherheitsempfehlungen hergestellt. Um diesen Status zu erhalten
und um einen korrekten Gebrauch dieses Produkts zu erhalten, muss der Verbraucher die in diesem Handbuch
enthaltenen Sicherheitsratschlge und Warnungen respektieren.
Der Verwender ist dafr verantwortlich, zu berprfen ob das Videoberwachungssystem den geltenen Gesetzen
im Verwendungsland entspricht.
11. KUNDENDIENST - GARANTIE

Defekt
mglicher Grund
Lsung
Keine Funktion
Keine Stromversorgung
Den Anschluss des Adapters berprfen

berprfen, ob der Akku des Monitors korrekt aufgeladen ist (led blau
)
Die Spannung der Batterien im Steuergert
berprfen
Die Auensprechstelle
klingelt, aber nicht der
Monitor
Anschlussproblem
Problem der Reichweite
Das Steuergert mit dem Monitor verbinden

Den Monitor nher am Steuergert anbringen
und berprfen wenn das Gert ...
Auen und innen kein Ton
Loch des Mikrofons durch

ein Insekt verstopft
Entfernen und das Loch vorsichtig reinigen

(dabei darauf achten, dass die Mikrozelle nicht
beschdigt wird)
Den Anschluss der weien oder brauner
Drhte auf der Auensprechstelle berprfen
Schlechtes Bild
Konfigurationsprobleme
In das Men gehen und das Videoformat berprfen (S 8)
Aufnahme auf SD Karte

unmglich
Schutzproblem
berprfen, ob die Karte nicht gesperrt oder

voll ist (siehe Angaben Bildschirm S 6-e)
Bei Bedarf steht ihnen unsere technische Website zur Verfgung www.c-extel.com
Die neueste Downloade Version der Gebrauchsanweisung in Farbe ist verfgbar auf :
www.c-extel.com
D9
: Dieses Symbol gibt eine Gefahr auf Elektroschock oder Kurzschluss an.
- Sie drfen dieses Gert nur verwenden mit einer Spannung zwischen: 100 - 240 Volt und 50-60 Herz. Versuchen
sie niemals dieses Gert mit einer anderen Spannung zu verwenden.
- Achten sie darauf, dass alle an dieses System angeschlossenen elektrischen Anschlsse, den Verwendungsratschlgen
entsprechen.
- In kommerziellen Einrichtungen versichern sie sich, dass die Schutzregeln fr Unflle mit elektrischen Installationen
beachtet werden.
- In Schulen, Ausbildungsausrstungen, Werksttten... ist die Gegenwart von qualiziertem Personal notwendig, um
den Betrieb von Elektrogerten zu kontrollieren.
- Die Verwendungsratschlge der an das System angeschlossenen Gerten beachten (z.B.Videorekorder, TV, PC)
- Bei Zweifelsfllen hinsichtlich des Betriebs oder Sicherheit des Gerts, kontaktieren sie bitte erfahrene Personen
- Niemals elektrische Gerte mit feuchten Hnden ein- oder ausschalten.
- Bei der Installation dieses Produkts bitte darauf achten, dass die Stromkabel nicht beschdigt werden knnen.
- Sie sollten niemals selbst ein beschdigtes Stromkabel ersetzen! In diesem Fall dieses entfernen und Rat bei einer
erfahrenen Person suchen.
ACHTUNG
Der Verwender wird auf wichtige Anweisungen hinsichtlich der Verwendung und
Wartung (Reparatur) in dem das Gert begleitenen Dokument hingewiesen.
Warnt den Verwender vor nicht isolierten gefhrlichen Spannungen im Inneren des
Produktgehuses, die ausreichend sind, um fr Menschen eine Gefahr fr einen tdlichen
Elektroschock darzustellen.
D10
'(&/$5$7,21'(&21)250,7(
29(5((1.20679(5./$5,1*
',&+,$5$=,21(',&21)250,7$
'(&/$5$&,1'(&21)250,'$'
'(&/$5$d2'(&21)250,'$'(
.21)250,7b76(5./b581*
'(&/$5$7,212)&21)250,7<
1RP1DDP1RPEUH1RPEUH1RPH1DPH1DPH
0;DYLHU%$,/2GLUHFWHXUJpQpUDO
IDEULFDQWPDQGDWDLUHRXSHUVRQQHUHVSRQVDEOHGHODPLVHVXUOHPDUFKpGHO
pTXLSHPHQW
IDEULNDQWJHYROPDFKWLJGHRIYHUDQWZRRUGHOLMNHYRRUKHWRSGHPDUNWEUHQJHQYDQGHXLWUXVWLQJ
IDEEULFDQWHPDQGDWDULRRSHUVRQDUHVSRQVDELOHGHOOLQWURGX]LRQHGHOSURGRWWRVXOPHUFDWR
IDEULFDQWHPDQGDWDULRRSHUVRQDUHVSRQVDEOHGHODSXHVWDHQHOPHUFDGRGHOHTXLSR
IDEULFDQWHPDQGDWiULRRXUHSUHVHQWDQWHOHJDOSHODFRORFDomRGRHTXLSDPHQWRQR0HUFDGR
GHV+HUVWHOOHUVVHLQHV%HYROOPlFKWLJWHQRGHUGHUIUGDV,QYHUNHKUEULQJHQGHV*HUlWVYHUDQWZRUWOLFKHQ3HUVRQ
PDQXIDFWHURUSHUVRQUHVSRQVLEOH
6LqJHVRFLDO+RRIGNDQWRRU'RPLFLOLRVRFLDO'RPLFLOLRVRFLDO6HGHVRFLDO)LUPHQVLW]&RPSDQ\ QDPH
&RPSWRLU)UDQoDLVGHO
,QWHUSKRQH&),7HO
$GUHVVH$UGUHV,QGLUL]]R'LUHFFLyQ(QGHUHoR$GUHVVH$GGUHVV
$OOpHGH)pWDQ=,GH)pWDQ%3
75(928;FHGH[)UDQFH
)D[
,GHQWLILFDWLRQGXSURGXLW,GHQWLILFDWLHYDQKHWSURGXNW,GHQWLILFD]LRQHGHOSURGRWWR
,GHQWLILFDFLyQGHOSURGXFWR,GHQWLILFDomRGRSURGXWR3URGXNWPHUNPDOH,GHQWLILFDWLRQRIWKHSURGXFW
1DWXUH6RRUW1DWXUD1DWXUDOH]D*pQHUR$UW.LQG 9LVLRSKRQHVDQVILO
'UDDGOR]HYLGHRIRRQ9LGHRFLWRIRQRVHQ]DILOL9LGHRSRUWHURLQDOiPEULFR9LGHRIRQHVHPILRV
'UDKWORVHV9LVLRSKRQ:LUHOHVVYLGHRSKRQH
7\SH7\SH7LSR7LSR7LSR7\S7\SH :(9$ 01:(9$ 936)%$ 936)3/$
5pIpUHQFHFRPPHUFLDOH&RPPHUFLsOHUHIHUHQWLH5LIHULPHQWRFRPPHUFLDOH5HIHUHQFLDFRPHUFLDO
5HIHUrQFLDFRPHUFLDO3URGXNWEH]HLFKQXQJ&RPPHUFLDOUHIHUHQFH (;7(/
$XWUHVLQIRUPDWLRQV$QGHUHLQIRUPDWLHV$OWUDLQIRUPD]LRQH2WUDVLQIRUPDFLRQHV2XWUDVLQIRUPDo}HV
6RQVWLJH$QJDEHQ2WKHULQIRUPDWLRQ
,GHQWLILFDWLRQGHORUJDQLVPHQRWLILpLGHQWLILFDWLHYDQQHWDDQJHZH]HQRUJDQLVPH,GHQWLILFD]LRQH
GHOORUJDQLVPRQRWLILFDWR,GHQWLILFDFLyQGHORUJDQLVPRQRWLILFDGR,GHQWLILFDomRGR2UJDQLVPRQRWLILFDGR
,GHQWLIL]LHUXQJGHUEHQQDQQWHQ,GHQWLILFDWLRQRIWKH1RWLILHGERG\
1RP1DDP1RPH1RPEUH1RPH1DPH1DPH
'pFODUHVRXVVRQHQWLqUHUHVSRQVDELOLWpTXHOHSURGXLWGpFULWFLGHVVXVHVWHQFRQIRUPLWpDYHFOHVH[LJHQFHV
HVVHQWLHOOHVDSSOLFDEOHVHWHQSDUWLFXOLHUFHOOHVGHODGLUHFWLYH&(VXLYDQWHV
9HUNODDUWRQGHU]LMQYROOHGLJHYHUDQWZRRUGLQJGDWKHWKLHURQGHURPVFKUHYHQSURGXNWRYHUHHQNRPWPHWGH
KRRIG]DNHOLMNHWRHWHSDVVHQHLVHQHQLQKHWELM]RQGHUGLHJHQHQYROJHQVGHYROJHQGHULFKWOLMQ&(
'LFKLDUDVRWWRODSURSULDUHVSRQVDELOLWjFKHLOSURGRWWRGHVFULWWRTXLVRSUDqFRQIRUPHDOOHHVLJHQ]HHVVHQ]LDOOL
DSSOOLFDELOLHLQSDUWLFRODUHDOOHHVLJHQ]HGHOODGLUHWWLYD&(VHJXHQWL
'HFODUDEDMRVXFRPSOHWDUHVSRQVDELOLGDGTXHHOSURGXFWRDQWHULRUPHQWHGHVFULWRHVFRQIRUPHDODVH[LJHQFLDV
HVHQFLDOHVDSOLFDEOHVVREUHWRGRDODVH[LJHQFLDVGHODGLUHFWLYD&(TXHILJXUDQDFRQWLQXDFLyQ
'HFODUDVREDVXDUHVSRQVDELOLGDGHTXHRSURGXWRDFLPDLGHQWLILFDGRHVWiHPFRQIRUPLGDGHFRPRVUHTXLVLWRV
HVVHQFLDLVDSOLFiYHLVHHPSDUWLFXODUFRPRVVHJXLQWHVUHTXLVLWRVGDGLUHFWLYD&(
(UNOlUWLQHLJHQHU9HUDQWZRUWXQJGDVVGDVREHQEHVFKULHEHQH3URGXNWGLHHLQVFKOlJLJHQJUXQGOHJHQGHQ
$QIRUGHUXQJHQLQVEHVRQGHUHIROJHQGH$QIRUGHUXQJHQGHU5LFKWOLQLH&(HUIOOW
'HFODUHVXQGHULWVRZQUHVSRQVLELOLW\WKDWWKHSURGXFWKHUHDERYHPHQWLRQHGLVLQFRQIRUPLW\ZLWKWKH
UHTXLUHPHQWVRIWKHDQGPRUHSDUWLFXODULW\WKHRQHVRIWKH&(GLUHFWLYH
$UWLFOHDSURWHFWLRQGHODVDQWpHWGHODVpFXULWpGHO
XWLOLVDWHXU
$UWLNHODEHVFKHUPLQJYDQGHJH]RQGKHLGHQYHLOLJKHLGYRRUGHJHEUXLNHU
$UWLFRORDSURWH]LRQHGHOODVDOXWHHGHOODVLFXUH]]DGHOOXWHQWH
$UWtFXORDSURWHFFLyQGHODVDOXG\GHODVHJXULGDGGHOXVXDULR
$UWLJRDSURWHFomRGDVD~GHHGDVHJXUDQoDGRXWLOL]DGRU
$UWLNHOD6FKXW]GHU*HVXQGKHLWXQG6LFKHUKHLWGHV%HQXW]HUV
$UWLFOHD6DIHW\DQGXVHU
EN 60065 : 2002 + A1: 2006 + A11:2008
$UWLFOHE H[LJHQFHVGHODSURWHFWLRQHQFHTXLFRQFHUQHODFRPSDWLELOLWppOHFWURPDJQpWLTXH

$UWLNHOEEHVFKHUPLQJVHLVHQZDWGHHOHNWURPDJQHWLVFKHRYHUHHQVWHPPLQJEHWUHIW
$UWLFROREHVLJHQ]HGHOODSURWH]LRQHUHODWLYDDOODFRPSDWLELOLWjHOHWWURPDJQHWLFD
$UWtFXOREH[LJHQFLDVGHODSURWHFFLyQHQFXDQWRDODFRPSDWLELOLGDGHOHFWURPDJQpWLFD
$UWLJREUHTXLVLWRVGHSURWHFomRUHODWLYDjFRPSDWLELOLGDGHHOHFWURPDJQpWLFD
$UWLNHOE6KXW]DQIRUGHUXQJHQLQ%H]XJDXIGLHHOHNWURPDJQHWLVFKH9HUWUlJOLFKNHLW
$UWLNHOE5HTXLUHPHQWVRISURWHFWLRQUHDJDUGLQJHOHFWURPDJQHWLFFRPSDWLELOLW\
EN 301 489-1 : V1.8.1: 2008
EN 301 489-17 : V 2.1.1: 2009
$UWLFOHERQQHXWLOLVDWLRQGXVSHFWUHUDGLRpOHFWULTXHGHIDoRQjpYLWHUOHVLQWHUIpUHQFHVGRPPDJHDEOHV
$UWLNHOMXLVWJHEUXLNYDQKHWUDGLRHOHNWULVFKVSHFWUXPRPEHVFKDGLJHQGHLQWHUIHUHQWLHVRSGLHPDQLHUXLWGH
ZHJWHJDDQ
$UWLFRORXVRFRUUHWWRGHOORVSHWWURUDGLRHOHWWULFRSHUHYLWDUHOHLQWHUIHUHQ]HGDQQHJJLDELOL
$UWtFXORFRUUHFWDXWLOL]DFLyQGHOHVSHFWURUDGLRHOpFWULFRSDUDHYLWDULQWHUIHUHQFLDVSHUMXGLFLDOHV
$UWLJRERDXWLOL]DomRGRHVSHFWURUDGLRHOpFWULFRGHIRUPDDHYLWDUDVLQWHUIHUrQFLDVGDQLILFDGRUDV
$UWLNHODQJHPHVVHQH1XW]XQJGHV)XQNVSHNWUXPV]XU9HUPHLGXQJYRQVFKlGLFKHQ,QWHUIHUHQ]HQ
$UWLFOHULJKWXVHRIWKHUDGLRHOHFWULFVSHFWUXPLQRUGHUWRDYRLGHSUHMXGLFLDOLQWHUIHUHQFHV
EN 300 328 : V 1.7.1: 2006
$FHWHIIHWGpFODUHTXHWRXWHVOHVVpULHVG
HVVDLVUDGLRRQWpWpHIIHFWXpHV9HUNODDUWGDDUWRHGDWDOOHVHULHVUDGLR
WHVWHQXLWJHYRHUG]LMQ$WDOHHIIHWWRGLFKLDUDFKHWXWWHOHSURYHUDGLRVRQRVWDWHHVHJXLWH
$WDOHIHFWRGHFODUDTXHVHKDQHIHFWXDGRWRGDVODVVHULHVGHSUXHEDVUDGLR3DUDRHIHLWRGHFODUDTXH
IRUDPHIHFWXDGDVWRGDVDVVpULHVGHHQVDLRVGHUiGLR (UNOlUWGDVVDOOH)XQN7HVWUHLKHQGXUFKJHIKUWZXUGHQ
'HFODUHVWKDWDOOWKHUHTXLUHGUDGLRWHVWVKDYHEHHQGRQH
1XPpURG
LGHQWLILFDWLRQ,GHQWLILFDWLHQXPPHU1XPHURGL LGHQWLILFD]LRQHGHOORUJDQLVPR1~PHURGH
LGHQWLILFDFLyQ1~PHURGHLGHQWLILFDomR.HQQXPPHU,GHQWLILFDWLRQQXPEHU
$UWpYHQWXHOHYHQWXHHOHYHQWXDOHHYHQWXDOHYHQWXDOHYHQWXHOOHYHQWXDO
3URFpGXUHVXLYLH$QQH[HV*HYROJGHSURFHGXUHELMODJHQ3URFHGXUDVHJXLWDDOOHJDWL3URFHGLPLHQWR

VHJXLGR$QH[RV3URFHVVRVHJXLGR$QH[RV%HZHUWXQJVYHUIDKUHQ$QODJHQ
)ROORZHGSURFHGXUH$QQH[HV,,,
'DWH'DWXP'DWD'DWD'DWD'DWXP 'DWH
&),=,GH)pWDQ
75e928;)UDQFH
WpO
6$6DXFDSLWDOGH
QVLUHW%285*
129
6LJQDWXUHHWWLWUH+DQGWHNHQLQJHQIXQFWLH)LUPDHWLWROR)LUPD\FDUJR$VVLQDWXUDHWtWXOR8QWHUVFKULIW
XQGIXQNWLRQ6LJQDWXUHDQGWLWOH
0;DYLHU%$,/2GLUHFWHXUJpQpUDO
SHUVRQQHDXWRULVpHEHYRHJGSHUVRRQSHUVRQDDXWRUL]]DWDSHUVRQDDXWRUL]DGDUHSUHVHQWDQWHOHJDO
DXWRULVLHUWH3HUVRQDXWKRUL]HGSHUVRQ
&),=,GH)pWDQ
75e928;)UDQFH
WpO
6$6DXFDSLWDOGH
QVLUHW %285*
:(9$
Conforme R&TTE, utilisable dans la C.E.E.

Conforme R&TTE, utilzzabile nei paesi C.E.E.
Conforme R&TTE, usado en de la C.E.E.
ConformR&TTE, utilizvel na C.E.E.
Conform product R&TTE, te gebruiken in de EEG
Compliant with R&TTE, usable in the EEC
Entspricht der R&TTE, in der EWG verwendbar
FR 1H MHWH] SDV OHV SLOHV HW OHV DSSDUHLOV KRUV GXVDJH DYHF OHV RUGXUHV PpQDJqUHV /HV
VXEVWDQFHV GDQJHUHXVHV TXLOV VRQW VXVFHSWLEOHV GH FRQWHQLU SHXYHQW QXLUH j OD VDQWp HW j
OHQYLURQQHPHQW )DLWHV UHSUHQGUH FHV DSSDUHLOV SDU YRWUH GLVWULEXWHXU RX XWLOLVH] OHV
PR\HQVGHFROOHFWHVpOHFWLYHPLVHjYRWUHGLVSRVLWLRQSDUYRWUHFRPPXQH
IT 1RQ JHWWDUH OH SLOH H OH DSSDUHFFKLDWXUH IXRUL XVR LQVLHPH DL ULILXWL GRPHVWLFL /H
VRVWDQ]H GDQQRVH FRQWHQXWH LQ HVVH SRVVRQR QXRFHUH DOOD VDOXWH GHOODPELHQWH 5HVWLWXLUH
TXHVWRPDWHULDOHDOGLVWULEXWRUHRXWLOL]]DUHODUDFFROWDGLIIHUHQ]LDWDRUJDQL]]DWDGDOFRPXQH
ES 1R WLUH ODV SLODV QL ORV DSDUDWRV LQVHUYLEOHV FRQ ORV UHVLGXRV GRPpVWLFRV \D TXH ODV
(
VXVWDQFLDVSHOLJURVDVTXHSXHGDQFRQWHQHUSXHGHQSHUMXGLFDUODVDOXG\DOPHGLRDPELHQWH
3tGDOHDVXGLVWULEXLGRUTXHORVUHFXSHUHRXWLOLFHORVPHGLRVGHUHFRJLGDVHOHFWLYDSXHVWRVD
VXGLVSRVLFLyQSRUHOD\XQWDPLHQWR
PT 1mR MXQWH DV SLOKDV QHP RV DSDUHOKRV TXH Mi QmR VH XVDP FRP R OL[R FDVHLUR$V
VXEVWkQFLDVSHULJRVDVTXHDPERVSRGHPFRQWHUSRGHPVHUSUHMXGLFLDLVSDUDDVD~GHHSDUD
R DPELHQWH (QWUHJXH HVVHV DSDUHOKRV DR VHX OL[HLUR RX UHFRUUD DRV PHLRV GH UHFROKD
VHOHFWLYDDRVHXGLVSRU
GB
'H OHJH EDWWHULMHQ HQ RXGH DSSDUDWHQ QLHW PHW KHW KXLVYXLO PHHJHYHQ GH]H NXQQHQ
JHYDDUOLMNHVWRIIHQEHYDWWHQGLHGHJH]RQGKHLGHQKHWPLOLHXVFKDGHQ
'HRXGHDSSDUDWHQGRRUXZGLVWULEXWHXUODWHQLQQHPHQRIGHJHVFKHLGHQYXLOLQ]DPHOLQJYDQ
XZJHPHHQWHJHEUXLNHQ
NL
'RQW WKURZ EDWWHULHV RU RXW RI RUGHU SURGXFWV ZLWK WKH KRXVHKROG ZDVWH JDUEDJH
7KH GDQJHURXV VXEVWDQFHV WKDW WKH\ DUH OLNHO\ WR LQFOXGH PD\ KDUP KHDOWK RU WKH
HQYLURQPHQW 0DNH \RXU UHWDLOHU WDNH EDFN WKHVH SURGXFWV RU XVH WKH VHOHFWLYH FROOHFW RI
JDUEDJHSURSRVHGE\\RXUFLW\
D
9HUEUDXFKWH%DWWHULHQXQGQLFKWPHKUEHQW]WH*HUlWHVLQG6RQGHUPOO6LHHQWKDOWHQ
P|JOLFKHUZHLVHJHVXQGKHLWVXQGXPZHOWVFKlGOLFKH6XEVWDQ]HQ
*HEHQ6LHDOWH*HUlWH]XUIDFKJHUHFKWHQ(QWVRUJXQJEHLP*HUlWHKlQGOHUDEE]ZEHQXW]HQ
6LHGLH|UWOLFKHQ5HF\FOLQJK|IH
Dcouvrez nos produits sur :
www.c-extel.com,,
Printed in P.R.C.
France : Hotline : 0 892 350 069 (0,337 ttc/min)

Italia : Assistenza Tecnica : +39 02 96488273
[email protected]
Espaa : Asistencia tcnica : 902 109 819
[email protected]
Portugal : Servio de apoio ao cliente : 707 201 138
&

Extel WEVA Notice

Transféré par

Droits d'auteur :

Formats disponibles

Extel WEVA Notice

Transféré par

Informations du document

Description originale:

Copyright

Formats disponibles

Partager ce document

Partager ou intégrer le document

Options de partage

Avez-vous trouvé ce document utile ?

Ce contenu est-il inapproprié ?

Droits d'auteur :

Formats disponibles

Extel WEVA Notice

Transféré par

Droits d'auteur :

Formats disponibles

WEVA

Guide dinstallation et dutilisation

CFI EXTEL WEVA - 11/2011

CFI EXTEL WEVA - 11/2011

MODE DEMPLOI ...........................................................................p.5

PRSENTATION DES ICNES ...........................................p.6

CARACTRISTIQUES TECHNIQUES ...........................p.8

CFI EXTEL WEVA - 11/2011

CFI EXTEL WEVA - 11/2011

Installation du botier lectronique (g.5)

b. Platine de rue, camra extrieur (g. 3)

a. Installation (partie extrieure) de votre visiophone sans l.

une platine de rue

CFI EXTEL WEVA - 11/2011

Installation de la platine de rue (g.6 / 7 / 8)

CFI EXTEL WEVA - 11/2011

6. PRESENTATION DES ICONES

b. Installation du moniteur (g.4)

pour dfiler, OK pour

1 Cas dun enregistrement partir du moniteur : (prsence carte SD obligatoire)

CFI EXTEL WEVA - 11/2011

b. Rglages Enregistrement (les squences enregistres sont en format .avi)

b. Moniteur (MN WEVA)

CFI EXTEL WEVA - 11/2011

CFI EXTEL WEVA - 11/2011

d. Camra (PL WEVA)

Le ticket de caisse ou la facture fait preuve de la date dachat.

Toutes les gches lectriques Extel

12. MESURES DE SCURIT

11. ASSISTANCE TECHNIQUE - GARANTIE

Vrifier le branchement de ladaptateur

La platine de rue sonne

Appairer le botier lectronique avec le moniteur

Trou du micro bouch par

Dboucher et nettoyer le trou dlicatement

Aller dans le menu et vrifier le format vido

Vrifier que la carte ne soit pas verrouille ou

CFI EXTEL WEVA - 11/2011

CFI EXTEL WEVA - 11/2011

DESIGNAZIONE ELEMENTI ................................................p.3

MODALIT DUSO .....................................................................p.5

PRESENTAZIONE DELLE ICONE ....................................p.6

CARATTERISTICHE TECNICHE .......................................p.8

CFI EXTEL WEVA - 11/2011

CFI EXTEL WEVA - 11/2011

Installazione della scatola elettronica (g.5)

b. Pulsantiera esterna, telecamera esterna (g. 3)

a. Installazione (parte esterna) videocitfono senza lli.

CFI EXTEL WEVA - 11/2011

Installazione della pulsantiera esterna (telecamera) (g.6 / 7 / 8)

CFI EXTEL WEVA - 11/2011

b. Installazione del monitor (g.4)

6. PRESENTAZIONE DELLE ICONE

per far scorrere, OK per

1 Registrazione a partire dal monitor: ( necessaria una scheda SD)

Attenzione : possibile un solo comando di apertura per chiamatain funzionamento su batteria

CFI EXTEL WEVA - 11/2011

b. Regolazioni Registrazione (le sequenze registrate sono in formato .avi)

CFI EXTEL WEVA - 11/2011